[Full Bars]

[SiteTable]


Summary Bars[60 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57771 73 0 P0DTD3(Y14_SARS2) RecName: Full=Uncharacterized protein 14;
QUERYSEQ
MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTD3(Y14_SARS2)]

73
region name description
1-73 CHAIN /note="Uncharacterized protein 14" /id="PRO_0000449658"
1-1 DISORDER predicted by DISOPRED (1-1)

No homologue is found in PDB.

Please check [SiteTable] for homologues.