#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[SiteTable]


Full Bars[30 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
50964 4405 500 YP_009725295.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725295.1()]

4405
region name description
1-4405 DISORDER predicted by DISOPRED (1-17,752-770,922-1028,1193-1239,1272-1275,1300-1301,1305-1306,1308-1316,1401-1402,1404-1406,1408-1408,1492-1492,1606-1622,1877-1885,1889-1889,2025-2058,2420-2420,2544-2544,2546-2546,2550-2551,2553-2553,2569-2569,2571-2576,2578-2579,2599-2599,2608-2612,2615-2615,2619-2619,2639-2651,3258-3259,3261-3275,3451-3454,3457-3459,3569-3569,3966-3967,3969-3973,3988-4025,4111-4118,4141-4141,4143-4165,4309-4321,4384-4405)

MONOMER
4405
pdb_id a1 identity[%]2 description
6wuu B 98.8 R1AB_SARS2 papain-like protease
6wuu A 99.7 R1AB_SARS2 papain-like protease
6wx4 A 99.1 R1AB_SARS2 Non-structural protein 3
6wuu C 99.7 R1AB_SARS2 papain-like protease
6wuu D 99.7 R1AB_SARS2 papain-like protease
6wzu A 100.0 R1AB_SARS2 Non-structural protein 3
7jrn A 100.0 R1A_SARS2 Papain-like proteinase
7jrn B 100.0 R1A_SARS2 Papain-like proteinase
7cjm A 99.7 R1AB_SARS2 Non-structural protein 3
6wrh A 99.7 R1AB_SARS2 Non-structural protein 3
6w9c A 100.0 R1A_SARS2 Papain-like proteinase
6xa9 A 100.0 R1AB_SARS2 Papain-like protease
6xa9 C 100.0 R1AB_SARS2 Papain-like protease
7jit A 99.7 R1A_SARS2 Papain-like protease
6w9c C 100.0 R1A_SARS2 Papain-like proteinase
7jir A 99.7 R1A_SARS2 Papain-like protease
6xg3 A 99.7 R1AB_SARS2 Peptidase C16
7jn2 A 100.0 R1A_SARS2 Papain-Like Protease
7cjd A 99.7 R1AB_SARS2 Replicase polyprotein 1ab
7jiv A 99.7 R1A_SARS2 Papain-like protease
7cjd C 99.7 R1AB_SARS2 Replicase polyprotein 1ab
6xaa A 100.0 R1AB_SARS2 Papain-like protease
7cjd D 99.7 R1AB_SARS2 Replicase polyprotein 1ab
6xbi A 100.0 R1AB_SARS2 main protease
6xqu A 100.0 R1AB_SARS2 3C-like proteinase
7jvz A 100.0 R1AB_SARS2 3C-like proteinase
6xqs A 100.0 R1AB_SARS2 3C-like proteinase
6yt8 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6yb7 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7jyc A 100.0 R1AB_SARS2 3C-like proteinase
6y2e A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7jun A 100.0 R1AB_SARS2 3C-like proteinase
6wtm A 100.0 R1AB_SARS2 3C-like proteinase
6wtm B 100.0 R1AB_SARS2 3C-like proteinase
6wtj A 100.0 R1AB_SARS2 3C-like proteinase
6wtk A 100.0 R1AB_SARS2 3C-like proteinase
6lu7 A 100.0 R1AB_SARS2 main protease
6xqt A 100.0 R1AB_SARS2 3C-like proteinase
6xqt B 100.0 R1AB_SARS2 3C-like proteinase
7c8t A 100.0 R1AB_SARS2 3C-like proteinase
6z2e A 100.0 R1AB_SARS2 Main Protease
6wqf A 100.0 R1AB_SARS2 3C-like proteinase
7buy A 100.0 SARS-CoV-2 virus Main protease
6xhu A 100.0 R1AB_SARS2 3C-like proteinase
6ynq A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6m2n B 100.0 SARS-CoV-2 3CL protease
6m2n D 100.0 SARS-CoV-2 3CL protease
6m2n A 100.0 SARS-CoV-2 3CL protease
6xb2 A 100.0 R1AB_SARS2 3C-like proteinase
6xch A 100.0 R1AB_SARS2 3C-like proteinase
7c8r A 100.0 R1AB_SARS2 3C-like proteinase
6xhu B 100.0 R1AB_SARS2 3C-like proteinase
6wnp A 100.0 R1AB_SARS2 3C-like proteinase
6m03 A 100.0 R1A_SARS2 main protease
6yvf A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6xa9 E 100.0 R1AB_SARS2 Papain-like protease
6w63 A 100.0 R1AB_SARS2 3C-like proteinase
6m2n C 100.0 SARS-CoV-2 3CL protease
6m2q A 100.0 SARS-CoV-2 3CL protease
7jfq A 100.0 R1AB_SARS2 3C-like proteinase
6xr3 A 100.0 R1AB_SARS2 3C-like proteinase
6xoa B 99.7 R1AB_SARS2 3C-like proteinase
6xoa C 99.7 R1AB_SARS2 3C-like proteinase
6xoa D 99.7 R1AB_SARS2 3C-like proteinase
6xoa A 99.7 R1AB_SARS2 3C-like proteinase
6xkh A 100.0 R1AB_SARS2 3C-like proteinase
6xb1 A 100.0 R1AB_SARS2 3C-like proteinase
6xkf B 100.0 R1AB_SARS2 3C-like proteinase
6xkf A 100.0 R1AB_SARS2 3C-like proteinase
6xb0 A 100.0 R1AB_SARS2 3C-like proteinase
6xfn A 100.0 R1AB_SARS2 main protease
6xa4 A 100.0 R1AB_SARS2 main protease
6xbh A 100.0 R1AB_SARS2 main protease
6m0k A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
5ref A 100.0 R1AB_SARS2 3C-like proteinase
5rgl A 100.0 R1AB_SARS2 3C-like proteinase
5rf2 A 100.0 R1AB_SARS2 3C-like proteinase
5r80 A 100.0 R1AB_SARS2 3C-like proteinase
5rh1 A 100.0 R1AB_SARS2 3C-like proteinase
5ret A 100.0 R1AB_SARS2 3C-like proteinase
5r83 A 100.0 R1AB_SARS2 3C-like proteinase
5rgg A 100.0 R1AB_SARS2 3C-like proteinase
5rgs A 100.0 R1AB_SARS2 3C-like proteinase
5rey A 100.0 R1AB_SARS2 3C-like proteinase
5rfb A 100.0 R1AB_SARS2 3C-like proteinase
5rec A 100.0 R1AB_SARS2 3C-like proteinase
5rfw A 100.0 R1AB_SARS2 3C-like proteinase
5rg1 A 100.0 R1AB_SARS2 3C-like proteinase
5rgr A 100.0 R1AB_SARS2 3C-like proteinase
5re5 A 100.0 R1AB_SARS2 3C-like proteinase
7ju7 A 100.0 R1AB_SARS2 3C-like proteinase
5rff A 100.0 R1AB_SARS2 3C-like proteinase
5rer A 100.0 R1AB_SARS2 3C-like proteinase
5rgm A 100.0 R1AB_SARS2 3C-like proteinase
6y84 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
5r81 A 100.0 R1AB_SARS2 3C-like proteinase
5rfg A 100.0 R1AB_SARS2 3C-like proteinase
5rf1 A 100.0 R1AB_SARS2 3C-like proteinase
5rfv A 100.0 R1AB_SARS2 3C-like proteinase
5rea A 100.0 R1AB_SARS2 3C-like proteinase
5reh A 100.0 R1AB_SARS2 3C-like proteinase
5re9 A 100.0 R1AB_SARS2 3C-like proteinase
5rfo A 100.0 R1AB_SARS2 3C-like proteinase
5rfy A 100.0 R1AB_SARS2 3C-like proteinase
5r82 A 100.0 R1AB_SARS2 3C-like proteinase
5rft A 100.0 R1AB_SARS2 3C-like proteinase
5rfd A 100.0 R1AB_SARS2 3C-like proteinase
5r7y A 100.0 R1AB_SARS2 3C-like proteinase
5r7z A 100.0 R1AB_SARS2 3C-like proteinase
5rfx A 100.0 R1AB_SARS2 3C-like proteinase
5rfq A 100.0 R1AB_SARS2 3C-like proteinase
5rfs A 100.0 R1AB_SARS2 3C-like proteinase
5rfn A 100.0 R1AB_SARS2 3C-like proteinase
5rfp A 100.0 R1AB_SARS2 3C-like proteinase
5rfj A 100.0 R1AB_SARS2 3C-like proteinase
5rfi A 100.0 R1AB_SARS2 3C-like proteinase
5rf8 A 100.0 R1AB_SARS2 3C-like proteinase
5rf9 A 100.0 R1AB_SARS2 3C-like proteinase
5rf6 A 100.0 R1AB_SARS2 3C-like proteinase
5rf7 A 100.0 R1AB_SARS2 3C-like proteinase
5rf4 A 100.0 R1AB_SARS2 3C-like proteinase
5rf3 A 100.0 R1AB_SARS2 3C-like proteinase
5rez A 100.0 R1AB_SARS2 3C-like proteinase
5rev A 100.0 R1AB_SARS2 3C-like proteinase
5rex A 100.0 R1AB_SARS2 3C-like proteinase
5rew A 100.0 R1AB_SARS2 3C-like proteinase
5reu A 100.0 R1AB_SARS2 3C-like proteinase
5reo A 100.0 R1AB_SARS2 3C-like proteinase
5rep A 100.0 R1AB_SARS2 3C-like proteinase
5rel A 100.0 R1AB_SARS2 3C-like proteinase
5rem A 100.0 R1AB_SARS2 3C-like proteinase
5rej A 100.0 R1AB_SARS2 3C-like proteinase
5reg A 100.0 R1AB_SARS2 3C-like proteinase
5ree A 100.0 R1AB_SARS2 3C-like proteinase
5reb A 100.0 R1AB_SARS2 3C-like proteinase
5re4 A 100.0 R1AB_SARS2 3C-like proteinase
5re6 A 100.0 R1AB_SARS2 3C-like proteinase
5r84 A 100.0 R1AB_SARS2 3C-like proteinase
5rg2 A 100.0 R1AB_SARS2 3C-like proteinase
5rgq A 100.0 R1AB_SARS2 3C-like proteinase
5rgn A 100.0 R1AB_SARS2 3C-like proteinase
5rgk A 100.0 R1AB_SARS2 3C-like proteinase
6yz6 A 100.0 R1AB_SARS2 Main Protease
5rek A 100.0 R1AB_SARS2 3C-like proteinase
5rei A 100.0 R1AB_SARS2 3C-like proteinase
5rfh A 100.0 R1AB_SARS2 3C-like proteinase
5rf0 A 100.0 R1AB_SARS2 3C-like proteinase
5rgj A 100.0 R1AB_SARS2 3C-like proteinase
5rf5 A 100.0 R1AB_SARS2 3C-like proteinase
5rhc A 100.0 R1AB_SARS2 3C-like proteinase
5rhe A 100.0 R1AB_SARS2 3C-like proteinase
5rfk A 100.0 R1AB_SARS2 3C-like proteinase
5rhf A 100.0 R1AB_SARS2 3C-like proteinase
5r8t A 100.0 R1AB_SARS2 3C-like proteinase
5rh4 A 100.0 R1AB_SARS2 3C-like proteinase
5rgp A 100.0 R1AB_SARS2 3C-like proteinase
5red A 100.0 R1AB_SARS2 3C-like proteinase
5rgo A 100.0 R1AB_SARS2 3C-like proteinase
5rfu A 100.0 R1AB_SARS2 3C-like proteinase
5res A 100.0 R1AB_SARS2 3C-like proteinase
5rfz A 100.0 R1AB_SARS2 3C-like proteinase
5rfr A 100.0 R1AB_SARS2 3C-like proteinase
5rhd A 100.0 R1AB_SARS2 3C-like proteinase
5rhb A 100.0 R1AB_SARS2 3C-like proteinase
5rfm A 100.0 R1AB_SARS2 3C-like proteinase
5rha A 100.0 R1AB_SARS2 3C-like proteinase
5rg0 A 100.0 R1AB_SARS2 3C-like proteinase
5re8 A 100.0 R1AB_SARS2 3C-like proteinase
5rh0 A 100.0 R1AB_SARS2 3C-like proteinase
5rgz A 100.0 R1AB_SARS2 3C-like proteinase
5rgy A 100.0 R1AB_SARS2 3C-like proteinase
5rgv A 100.0 R1AB_SARS2 3C-like proteinase
5rh2 A 100.0 R1AB_SARS2 3C-like proteinase
5rh3 A 100.0 R1AB_SARS2 3C-like proteinase
5rgw A 100.0 R1AB_SARS2 3C-like proteinase
5rgx A 100.0 R1AB_SARS2 3C-like proteinase
5rgt A 100.0 R1AB_SARS2 3C-like proteinase
5rh9 A 100.0 R1AB_SARS2 3C-like proteinase
5rh7 A 100.0 R1AB_SARS2 3C-like proteinase
5rh8 A 100.0 R1AB_SARS2 3C-like proteinase
5rh6 A 100.0 R1AB_SARS2 3C-like proteinase
5rh5 A 100.0 R1AB_SARS2 3C-like proteinase
5rgi A 100.0 R1AB_SARS2 3C-like proteinase
5rgu A 100.0 R1AB_SARS2 3C-like proteinase
5rgh A 100.0 R1AB_SARS2 3C-like proteinase
5ren A 100.0 R1AB_SARS2 3C-like proteinase
5re7 A 100.0 R1AB_SARS2 3C-like proteinase
6zrt A 100.0 R1AB_SARS2 Main Protease
6zru A 100.0 R1AB_SARS2 Main Protease
5rfl A 100.0 R1AB_SARS2 3C-like proteinase
5rfc A 100.0 R1AB_SARS2 3C-like proteinase
5rg3 A 100.0 R1AB_SARS2 3C-like proteinase
5rfe A 100.0 R1AB_SARS2 3C-like proteinase
7cmd C 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7jiw A 100.0 R1A_SARS2 Papain-Like Protease
7cmd B 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6lze A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6xbg B 100.0 R1AB_SARS2 main protease
6y2g B 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6w9c B 100.0 R1A_SARS2 Papain-like proteinase
6y2f A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6xhm A 100.0 R1AB_SARS2 3C-like proteinase
6xbi B 100.0 R1AB_SARS2 main protease
6xmk B 100.0 R1AB_SARS2 3C-like proteinase
6wtt A 100.0 R1AB_SARS2 3C-like proteinase
6wtt C 100.0 R1AB_SARS2 3C-like proteinase
6wtt B 100.0 R1AB_SARS2 3C-like proteinase
7brr A 100.0 R1A_SARS2 3C-like proteinase
7cmd D 100.0 R1AB_SARS2 Replicase polyprotein 1ab
5rfa A 100.0 R1AB_SARS2 3C-like proteinase
7c6u A 100.0 R1AB_SARS2 3C-like proteinase
7c6s A 100.0 R1AB_SARS2 3C-like proteinase
7c8b A 100.0 R1AB_SARS2 3C-like proteinase
7c7p A 100.0 R1AB_SARS2 main protease
7bqy A 100.0 R1AB_SARS2 main protease
6xhm B 100.0 R1AB_SARS2 3C-like proteinase
6y2g A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7com A 100.0 R1AB_SARS2 main protease
7brp A 100.0 R1A_SARS2 3C-like proteinase
7brp B 100.0 R1A_SARS2 3C-like proteinase
7cmd A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7c8u A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7jr3 A 100.0 R1AB_SARS2 3C-like proteinase
7bro A 100.0 R1A_SARS2 3C-like proteinase
6xbg A 100.0 R1AB_SARS2 main protease
7brr B 100.0 R1A_SARS2 3C-like proteinase
7c7p B 100.0 R1AB_SARS2 main protease
6xmk A 100.0 R1AB_SARS2 3C-like proteinase
6lnq A 96.1 Severe Acute Respiratory Syndrome Coronavirus 3c Like Protease
3vb4 B 96.1 R1A_CVHSA 3C-like proteinase
3tiu A 96.1 R1A_CVHSA SARS coronavirus main protease
2z3e A 96.1 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2v6n A 96.1 R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
3vb3 B 96.1 R1A_CVHSA 3C-like proteinase
6wco A 96.1 A0A3G5BIY8_CVHSA Main protease
3v3m A 96.1 R1A_CVHSA 3C-like proteinase
2duc A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
3sn8 A 96.1 R1A_CVHSA 3C-like proteinase
3tnt A 96.1 R1A_CVHSA SARS coronavirus main protease
2a5i A 96.1 R1AB_CVHSA 3C-like peptidase
3vb7 B 96.1 R1A_CVHSA 3C-like proteinase
2z9g A 96.1 R1AB_CVHSA 3C-like proteinase
2zu4 A 96.1 R1A_CVHSA 3C-like proteinase
2h2z A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
2zu5 A 96.1 R1A_CVHSA 3C-like proteinase
3sne A 96.1 R1A_CVHSA 3C-like proteinase
3tns A 96.1 R1A_CVHSA SARS coronavirus main protease
3snd A 96.1 R1A_CVHSA 3C-like proteinase
3snd B 96.1 R1A_CVHSA 3C-like proteinase
5n19 A 96.1 R1AB_CVHSA SARS coronavirus main protease
3snb A 96.1 R1A_CVHSA 3C-like proteinase
2gx4 A 96.1 R1AB_CVHSA 3C-like proteinase
3snc A 96.1 R1A_CVHSA 3C-like proteinase
2gz9 A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
6w79 A 96.1 Main protease
6y7m A 96.1 R1A_CVHSA Replicase polyprotein 1a
3vb5 B 96.1 R1A_CVHSA 3C-like proteinase
6lny A 96.1 R1A_CVHSA Replicase polyprotein 1a
2z3c A 96.1 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2gz7 A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
2gz8 A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
2z3d A 96.1 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3szn A 96.1 R1A_CVHSA 3C-like proteinase
6lo0 A 96.1 R1A_CVHSA Replicase polyprotein 1a
2z9k B 96.1 R1AB_CVHSA 3C-like proteinase
5n5o A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
3tit A 96.1 R1A_CVHSA SARS coronavirus main protease
2duc B 96.1 R1AB_CVHSA Replicase polyprotein 1ab
2z94 A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
3vb6 B 96.1 R1A_CVHSA 3C-like proteinase
2a5a A 96.1 R1AB_CVHSA 3C-like peptidase
2hob A 96.1 R1AB_CVHSA Replicase polyprotein 1ab
7jr4 A 100.0 R1AB_SARS2 3C-like proteinase
7cbt B 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7cbt A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
3ea8 A 96.1 R1A_CVHSA 3C-like proteinase
3m3v A 96.1 R1A_CVHSA 3C-like proteinase
7com B 100.0 R1AB_SARS2 main protease
5b6o A 94.8 R1AB_CVHSA 3C-like proteinase
2z9k A 96.1 R1AB_CVHSA 3C-like proteinase
3ea7 A 96.1 R1A_CVHSA 3C-like proteinase
3e91 A 96.1 R1A_CVHSA 3C-like proteinase
2qcy A 95.8 R1AB_CVHSA 3C-like proteinase
1wof A 96.1 R1AB_CVHSA 3C-like proteinase
2amd A 96.1 R1AB_CVHSA 3C-like proteinase
3m3s A 95.8 R1A_CVHSA 3C-like proteinase
1z1j B 95.8 R1AB_CVHSA 3C-like proteinase
1z1j A 95.8 R1AB_CVHSA 3C-like proteinase
4tww B 95.8 R1AB_CVHSA 3C-like proteinase
4tww A 95.8 R1AB_CVHSA 3C-like proteinase
4wy3 A 95.8 R1AB_CVHSA 3C-like proteinase
4twy A 95.8 R1AB_CVHSA 3C-like proteinase
5c5n A 95.8 R1AB_CVHSA 3C-like proteinase
3aw0 A 95.8 R1A_CVHSA 3C-Like Proteinase
2z9j B 96.1 R1AB_CVHSA 3C-like proteinase
2a5k A 96.1 R1AB_CVHSA 3C-like peptidase
2qc2 B 95.7 R1AB_CVHSA 3C-like proteinase
3m3t A 95.7 R1A_CVHSA 3C-like proteinase
2q6g A 95.7 R1AB_CVHSA severe acute respiratory syndrome coronavirus (SARS-CoV)
3m3v B 96.0 R1A_CVHSA 3C-like proteinase
7cx9 A 100.0 R1AB_SARS2 3C protein
2qc2 A 95.7 R1AB_CVHSA 3C-like proteinase
2amq A 96.0 R1AB_CVHSA 3C-like proteinase
1wof B 96.0 R1AB_CVHSA 3C-like proteinase
2amd B 96.0 R1AB_CVHSA 3C-like proteinase
4mds A 96.0 R1A_CVHSA 3C-like proteinase
6w2a B 95.7 R1A_CVHSA Replicase polyprotein 1a
2alv A 96.0 R1AB_CVHSA Replicase polyprotein 1ab
1uk3 B 96.0 R1AB_CVHSA 3C-like proteinase
2gt7 B 96.0 R1AB_CVHSA 3C-like proteinase
1uk4 B 96.0 R1AB_CVHSA 3C-like proteinase
1uk2 B 96.0 R1AB_CVHSA 3C-LIKE PROTEINASE
2z9j A 96.0 R1AB_CVHSA 3C-like proteinase
2c3s A 96.0 R1AB_CVHSA SARS COV 3C-LIKE PROTEINASE
1uk2 A 96.0 R1AB_CVHSA 3C-LIKE PROTEINASE
1uj1 B 96.0 R1AB_CVHSA 3C-like proteinase
2amq B 96.0 R1AB_CVHSA 3C-like proteinase
2d2d B 96.0 R1AB_CVHSA 3C-like proteinase
2op9 A 96.0 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase (3CL-PRO, 3CLp)
3sna A 96.0 R1A_CVHSA 3C-like proteinase
6w2a A 95.7 R1A_CVHSA Replicase polyprotein 1a
6xhn A 96.0 R1A_CVHSA 3C-like proteinase
6xhl A 96.0 R1A_CVHSA 3C-like proteinase
2z9l B 96.0 R1AB_CVHSA 3C-like proteinase
3vb3 A 96.0 R1A_CVHSA 3C-like proteinase
1z1i A 96.0 R1AB_CVHSA 3C-like proteinase
3vb5 A 96.0 R1A_CVHSA 3C-like proteinase
3iwm A 96.0 R1A_CVHSA 3C-like proteinase
3vb7 A 96.0 R1A_CVHSA 3C-like proteinase
3vb4 A 96.0 R1A_CVHSA 3C-like proteinase
3iwm B 96.0 R1A_CVHSA 3C-like proteinase
3vb6 A 96.0 R1A_CVHSA 3C-like proteinase
1uk4 A 96.0 R1AB_CVHSA 3C-like proteinase
1uj1 A 96.0 R1AB_CVHSA 3C-like proteinase
1uk3 A 96.0 R1AB_CVHSA 3C-like proteinase
2d2d A 96.0 R1AB_CVHSA 3C-like proteinase
3ea7 B 96.0 R1A_CVHSA 3C-like proteinase
3m3s B 95.7 R1A_CVHSA 3C-like proteinase
3eaj A 95.7 R1A_CVHSA 3C-like proteinase
3eaj B 95.7 R1A_CVHSA 3C-like proteinase
2qiq A 95.7 R1AB_CVHSA Replicase polyprotein 1ab
2q6g B 95.7 R1AB_CVHSA severe acute respiratory syndrome coronavirus (SARS-CoV)
3iwm D 96.0 R1A_CVHSA 3C-like proteinase
3iwm C 96.0 R1A_CVHSA 3C-like proteinase
2bx3 A 96.0 R1AB_CVHSA MAIN PROTEINASE
2a5k B 96.0 R1AB_CVHSA 3C-like peptidase
6xho A 96.0 R1A_CVHSA 3C-like proteinase
2vj1 B 96.0 A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2vj1 A 96.0 A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
7cjd B 99.7 R1AB_SARS2 Replicase polyprotein 1ab
3e91 B 96.0 R1A_CVHSA 3C-like proteinase
4hi3 B 95.7 R1A_CVHSA 3C-like proteinase
3ea9 A 95.7 R1A_CVHSA 3C-like proteinase
2gt7 A 96.3 R1AB_CVHSA 3C-like proteinase
2z9l A 96.3 R1AB_CVHSA 3C-like proteinase
3aw1 A 95.7 R1A_CVHSA 3C-Like Proteinase
5b6o B 95.7 R1AB_CVHSA 3C-like proteinase
2gtb A 96.0 R1AB_CVHSA 3C-like proteinase
2op9 B 96.3 R1AB_CVHSA Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase (3CL-PRO, 3CLp)
3d62 A 96.0 R1AB_CVHSA 3C-like proteinase
6xhn B 96.0 R1A_CVHSA 3C-like proteinase
3f9h B 95.7 R1A_CVHSA 3C-like proteinase
4hi3 A 95.7 R1A_CVHSA 3C-like proteinase
3atw A 95.7 R1A_CVHSA 3C-Like Proteinase
3atw B 95.7 R1A_CVHSA 3C-Like Proteinase
5c5o B 95.7 R1AB_CVHSA 3C-like proteinase
5c5o A 95.7 R1AB_CVHSA 3C-like proteinase
3aw1 B 95.7 R1A_CVHSA 3C-Like Proteinase
3avz A 95.7 R1A_CVHSA 3C-Like Proteinase
6xhl B 96.0 R1A_CVHSA 3C-like proteinase
2bx4 A 96.0 R1A_CVHSA 3C-LIKE PROTEINASE
2gt8 A 96.0 R1AB_CVHSA 3C-like proteinase
3f9f B 95.7 R1A_CVHSA 3C-like proteinase
3f9f A 95.7 R1A_CVHSA 3C-like proteinase
3f9h A 95.7 R1A_CVHSA 3C-like proteinase
7c2y A 100.0 R1AB_SARS2 3C-like proteinase
3f9e A 95.6 R1A_CVHSA 3C-like proteinase
3f9g A 95.6 R1A_CVHSA 3C-like proteinase
7c2q A 100.0 R1AB_SARS2 3C-like proteinase
1q2w A 96.3 R1A_CVHSA 3C-like protease
1q2w B 96.3 R1A_CVHSA 3C-like protease
3fzd A 95.6 R1A_CVHSA 3C-like proteinase
3f9g B 95.6 R1A_CVHSA 3C-like proteinase
6xho B 95.9 R1A_CVHSA 3C-like proteinase
7c2q B 100.0 R1AB_SARS2 3C-like proteinase
7c2y B 100.0 R1AB_SARS2 3C-like proteinase
2pwx A 95.5 R1AB_CVHSA 3C-like proteinase
6yva A 99.6 R1A_SARS2 Replicase polyprotein 1a
5tl6 A 82.9 R1AB_CVHSA Replicase polyprotein 1ab
4mm3 B 82.9 R1A_CVHSA Papain-like proteinase
5tl7 B 82.9 R1AB_CVHSA Replicase polyprotein 1ab
4m0w A 82.3 R1A_CVHSA Replicase polyprotein 1a
5e6j A 82.0 R1AB_CVHSA Replicase polyprotein 1ab
5y3e A 82.8 R1A_CVHSA Replicase polyprotein 1a
5y3q A 82.8 R1A_CVHSA Replicase polyprotein 1a
2fe8 A 82.8 R1AB_CVHSA Replicase polyprotein 1ab
5tl7 D 82.7 R1AB_CVHSA Replicase polyprotein 1ab
2fe8 B 82.7 R1AB_CVHSA Replicase polyprotein 1ab
5e6j D 82.7 R1AB_CVHSA Replicase polyprotein 1ab
5tl6 B 83.0 R1AB_CVHSA Replicase polyprotein 1ab
3e9s A 82.7 R1A_CVHSA Non-structural protein 3
2fe8 C 82.7 R1AB_CVHSA Replicase polyprotein 1ab
3mj5 A 82.7 R1A_CVHSA Replicase polyprotein 1a
4ow0 A 82.6 R1A_CVHSA papain-like protease
4ovz A 82.5 R1A_CVHSA Papain-like proteinase
3mj5 B 81.3 R1A_CVHSA Replicase polyprotein 1a
4ow0 B 81.1 R1A_CVHSA papain-like protease
4ovz B 81.3 R1A_CVHSA Papain-like proteinase
2w2g A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2wct B 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2wct A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2w2g B 75.0 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2wct C 75.8 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2wct D 75.4 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
2ahm H 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6xez B 100.0 R1AB_SARS2 nsp8
6xez D 100.0 R1AB_SARS2 nsp8
6yyt D 100.0 R1AB_SARS2 nsp8
6yyt B 100.0 R1AB_SARS2 nsp8
2ahm G 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6wey A 100.0 R1AB_SARS2 Non-structural protein 3
6ywm A 100.0 R1AB_SARS2 NSP3 macrodomain
6woj B 100.0 R1AB_SARS2 Non-structural protein 3
6woj D 100.0 R1AB_SARS2 Non-structural protein 3
6ywl C 100.0 R1AB_SARS2 NSP3 macrodomain
6ywk C 100.0 R1AB_SARS2 NSP3 macrodomain
6woj C 100.0 R1AB_SARS2 Non-structural protein 3
6woj A 100.0 R1AB_SARS2 Non-structural protein 3
6ywl E 100.0 R1AB_SARS2 NSP3 macrodomain
6ywl B 100.0 R1AB_SARS2 NSP3 macrodomain
6ywl A 100.0 R1AB_SARS2 NSP3 macrodomain
6ywk E 100.0 R1AB_SARS2 NSP3 macrodomain
6ywk D 100.0 R1AB_SARS2 NSP3 macrodomain
6ywk A 100.0 R1AB_SARS2 NSP3 macrodomain
6ywk B 100.0 R1AB_SARS2 NSP3 macrodomain
6ywm B 100.0 R1AB_SARS2 NSP3 macrodomain
6w6y A 100.0 R1AB_SARS2 SARS-CoV-2 NSP3
6wen A 100.0 R1AB_SARS2 Non-structural protein 3
6ywl D 100.0 R1AB_SARS2 NSP3 macrodomain
6w6y B 100.0 R1AB_SARS2 SARS-CoV-2 NSP3
6vxs B 100.0 R1AB_SARS2 Non-structural protein 3
6vxs A 100.0 R1AB_SARS2 Non-structural protein 3
6w02 B 100.0 R1AB_SARS2 Non-structural protein 3
6ywm C 100.0 R1AB_SARS2 NSP3 macrodomain
6wcf A 100.0 R1AB_SARS2 Non-structural protein 3
7jme A 100.0 R1AB_SARS2 Non-structural protein 3
6w02 A 100.0 R1AB_SARS2 Non-structural protein 3
4rsp A 52.3 V9TU12_9BETC Orf1a protein
4ylu A 52.2 A0A0A7E693_9BETC ORF1a protein
4ylu D 52.2 A0A0A7E693_9BETC ORF1a protein
6vh2 B 52.5 A0A1L2E0X0_9BETC Orf1a protein
5wkj A 52.5 A0A1L2E0X0_9BETC Orf1a protein
5wkl A 52.5 A0A1L2E0X0_9BETC Orf1a protein
6vh3 B 52.7 A0A1L2E0X0_9BETC Orf1a protein
6vh3 A 52.7 A0A1L2E0X0_9BETC Orf1a protein
4wme D 51.7 W6A941_9BETC MERS-CoV 3CL protease
4wme A 51.7 W6A941_9BETC MERS-CoV 3CL protease
5wkk A 52.7 A0A1L2E0X0_9BETC Orf1a protein
4ylu C 52.0 A0A0A7E693_9BETC ORF1a protein
4ylu B 52.0 A0A0A7E693_9BETC ORF1a protein
5wkm A 52.9 A0A1L2E0X0_9BETC Orf1a protein
5c3n A 52.2 A0A0A7E693_9BETC ORF1a protein
5c3n B 52.2 A0A0A7E693_9BETC ORF1a protein
4wme B 51.8 W6A941_9BETC MERS-CoV 3CL protease
4wmd B 51.8 W6A941_9BETC ORF1a
6vh2 A 52.6 A0A1L2E0X0_9BETC Orf1a protein
4wmd C 51.8 W6A941_9BETC ORF1a
4wmf B 51.8 W6A941_9BETC MERS-CoV 3CL protease
6vh1 B 52.7 A0A1L2E0X0_9BETC Orf1a protein
6vgz B 52.7 A0A1L2E0X0_9BETC Orf1a protein
6vgy B 52.9 A0A1L2E0X0_9BETC Orf1a protein
6vh0 B 52.9 A0A1L2E0X0_9BETC Orf1a protein
6vh1 A 52.9 A0A1L2E0X0_9BETC Orf1a protein
6vgy A 52.9 A0A1L2E0X0_9BETC Orf1a protein
6vh0 A 52.9 A0A1L2E0X0_9BETC Orf1a protein
6vgz A 52.9 A0A1L2E0X0_9BETC Orf1a protein
4wme C 51.7 W6A941_9BETC MERS-CoV 3CL protease
4wmd A 51.9 W6A941_9BETC ORF1a
4wmf A 51.7 W6A941_9BETC MERS-CoV 3CL protease
2ahm E 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
4yog B 51.0 R1AB_BCHK4 3C-like proteinase
4yoj A 51.0 R1AB_BCHK4 3C-like proteinase
4yoj B 51.0 R1AB_BCHK4 3C-like proteinase
4yo9 A 51.0 R1AB_BCHK4 3C-like proteinase
4yoi B 51.0 R1AB_BCHK4 3C-like proteinase
4yoi A 51.0 R1AB_BCHK4 3C-like proteinase
4yog A 51.0 R1AB_BCHK4 3C-like proteinase
2ynb A 51.0 R1A_BCHK4 3C-LIKE PROTEINASE
2yna A 51.0 R1A_BCHK4 3C-LIKE PROTEINASE
2ynb B 51.0 R1A_BCHK4 3C-LIKE PROTEINASE
2yna B 51.0 R1A_BCHK4 3C-LIKE PROTEINASE
4yo9 B 51.2 R1AB_BCHK4 3C-like proteinase
4wmf C 52.3 W6A941_9BETC MERS-CoV 3CL protease
3d23 A 49.7 R1AB_CVHN1 3C-like proteinase
6jij B 51.0 Q66WN6_CVMA5 Replicative polyprotein 1ab
3d23 D 49.5 R1AB_CVHN1 3C-like proteinase
6jij A 50.8 Q66WN6_CVMA5 Replicative polyprotein 1ab
6jij C 50.8 Q66WN6_CVMA5 Replicative polyprotein 1ab
3d23 B 49.8 R1AB_CVHN1 3C-like proteinase
3d23 C 49.3 R1AB_CVHN1 3C-like proteinase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez A R1AB_SARS2 nsp12[926 aa] D 100.0
/100.0
11
/11
R1AB_SARS2 nsp8
6yyt A R1AB_SARS2 nsp12[853 aa] D 100.0
/100.0
10
/10
R1AB_SARS2 nsp8
6yyt A R1AB_SARS2 nsp12[853 aa] B 100.0
/100.0
44
/44
R1AB_SARS2 nsp8
6xez A R1AB_SARS2 nsp12[926 aa] B 100.0
/100.0
34
/34
R1AB_SARS2 nsp8
7c8b B Z-VAD(OMe)-FMK[5 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
6xez E R1AB_SARS2 nsp13[596 aa] D 100.0
/100.0
6
/6
R1AB_SARS2 nsp8
6xez F R1AB_SARS2 nsp13[596 aa] B 100.0
/100.0
6
/6
R1AB_SARS2 nsp8
6xbh B inhibitor UAW247[3 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 main protease
6xbh B inhibitor UAW247[3 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 main protease
6xfn B UAW243[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 main protease
6xfn B UAW243[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 main protease
6xbg C inhibitor UAW246[4 aa] A 100.0
/100.0
19
/19
R1AB_SARS2 main protease
6xbg D inhibitor UAW246[4 aa] B 100.0
/100.0
16
/16
R1AB_SARS2 main protease
6xbi C inhibitor UAW248[5 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 main protease
6xbi D inhibitor UAW248[5 aa] B 100.0
/100.0
20
/20
R1AB_SARS2 main protease
6xch B Leupeptin[4 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6xch B Leupeptin[4 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6xa4 B inhibitor UAW241[4 aa] A 100.0
/100.0
15
/15
R1AB_SARS2 main protease
6xa4 B inhibitor UAW241[4 aa] A 100.0
/100.0
15
/15
R1AB_SARS2 main protease
6yz6 B LEUPEPTIN[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 Main Protease
6yz6 B LEUPEPTIN[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 Main Protease
6wuu F VIR250[5 aa] B 100.0
/98.8
16
/16
R1AB_SARS2 papain-like protease
6wx4 B VIR251[5 aa] A 100.0
/99.1
16
/16
R1AB_SARS2 Non-structural protein 3
6wuu E VIR250[5 aa] A 100.0
/99.7
18
/18
R1AB_SARS2 papain-like protease
6wuu G VIR250[5 aa] C 100.0
/99.7
16
/16
R1AB_SARS2 papain-like protease
6wuu H VIR250[5 aa] D 100.0
/99.7
17
/17
R1AB_SARS2 papain-like protease
6yva B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6
29
/29
R1A_SARS2 Replicase polyprotein 1a
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] H 100.0
/97.4
25
/25
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/97.4
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6xez C R1AB_SARS2 nsp7[73 aa] D 100.0
/100.0
15
/15
R1AB_SARS2 nsp8
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4
5
/5
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4
24
/24
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] H 100.0
/97.4
25
/25
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] G 100.0
/97.4
22
/22
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6yyt C R1AB_SARS2 nsp7[73 aa] D 100.0
/100.0
24
/24
R1AB_SARS2 nsp8
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] E 100.0
/97.4
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4
5
/5
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6yyt C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] E 100.0
/97.4
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] G 100.0
/97.4
22
/22
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
6xez C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4
24
/24
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
3
/3
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4
7
/7
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/97.4
10
/10
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4
8
/8
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
3sne B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
3sne B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
3snc B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/96.1
18
/18
R1A_CVHSA 3C-like proteinase
3snc B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/96.1
18
/18
R1A_CVHSA 3C-like proteinase
3snd C Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] A 100.0
/96.1
12
/12
R1A_CVHSA 3C-like proteinase
3snd D Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] B 100.0
/96.1
14
/14
R1A_CVHSA 3C-like proteinase
3vb7 C M4Z inhibitor[4 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb7 C M4Z inhibitor[4 aa] A 100.0
/96.0
20
/20
R1A_CVHSA 3C-like proteinase
3vb7 D M4Z inhibitor[4 aa] B 100.0
/96.1
17
/17
R1A_CVHSA 3C-like proteinase
2z3d B Inhibitor[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2z3d B Inhibitor[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3snb B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/96.1
19
/19
R1A_CVHSA 3C-like proteinase
3snb B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/96.1
19
/19
R1A_CVHSA 3C-like proteinase
2z3e B ACE VAL Z3E LEU KCQ peptide[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2z3c B inhibitor[5 aa] A 100.0
/96.1
19
/19
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2z3c B inhibitor[5 aa] A 100.0
/96.1
19
/19
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2z3e B ACE VAL Z3E LEU KCQ peptide[5 aa] A 100.0
/96.1
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3sna B Peptide aldehyde inhibitor Ac-NSFSQ-H[6 aa] A 100.0
/96.0
17
/17
R1A_CVHSA 3C-like proteinase
3sna B Peptide aldehyde inhibitor Ac-NSFSQ-H[6 aa] A 100.0
/96.0
17
/17
R1A_CVHSA 3C-like proteinase
3iwm G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/96.0
21
/21
R1A_CVHSA 3C-like proteinase
3iwm F N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. B 100.0
/96.0
19
/19
R1A_CVHSA 3C-like proteinase
3iwm H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/96.0
22
/22
R1A_CVHSA 3C-like proteinase
2hob B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.1
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
3d23 F N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. B 68.8
/49.8
16
/16
R1AB_CVHN1 3C-like proteinase
3d23 H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 68.2
/49.5
22
/22
R1AB_CVHN1 3C-like proteinase
3iwm H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/96.0
22
/22
R1A_CVHSA 3C-like proteinase
3iwm G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
2hob B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.1
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
6jij E 02J-ALA-VAL-LEU-PJE-010[6 aa] B 64.7
/51.0
17
/17
Q66WN6_CVMA5 Replicative polyprotein 1ab
6jij F 02J-ALA-VAL-LEU-PJE-010[6 aa] C 70.6
/50.8
17
/17
Q66WN6_CVMA5 Replicative polyprotein 1ab
3d23 G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 70.0
/49.3
20
/20
R1AB_CVHN1 3C-like proteinase
3d23 E N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 72.2
/49.7
18
/18
R1AB_CVHN1 3C-like proteinase
6jij D 02J-ALA-VAL-LEU-PJE-010[6 aa] A 66.7
/50.8
18
/18
Q66WN6_CVMA5 Replicative polyprotein 1ab
7bqy B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
21
/21
R1AB_SARS2 main protease
2amq C N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.0
24
/24
R1AB_CVHSA 3C-like proteinase
3iwm H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
6lu7 B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
22
/22
R1AB_SARS2 main protease
6lu7 B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
2amq D N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. B 100.0
/96.0
21
/21
R1AB_CVHSA 3C-like proteinase
7bqy B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
21
/21
R1AB_SARS2 main protease
6lu7 B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
22
/22
R1AB_SARS2 main protease
6lu7 B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
3iwm G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/96.0
21
/21
R1A_CVHSA 3C-like proteinase
3iwm H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
3iwm G N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
3d23 H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. D 68.2
/49.5
22
/22
R1AB_CVHN1 3C-like proteinase
3d23 H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 25.0
/49.7
4
/4
R1AB_CVHN1 3C-like proteinase
3iwm F N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. B 100.0
/96.0
19
/19
R1A_CVHSA 3C-like proteinase
3iwm E N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.0
22
/22
R1A_CVHSA 3C-like proteinase
3iwm E N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/96.0
22
/22
R1A_CVHSA 3C-like proteinase
1uk4 D 5-mer peptide of inhibitor[5 aa] B 100.0
/96.0
15
/15
R1AB_CVHSA 3C-like proteinase
1uk4 E 5-mer peptide of inhibitor[5 aa] B 100.0
/96.0
3
/3
R1AB_CVHSA 3C-like proteinase
1uk4 C 5-mer peptide of inhibitor[5 aa] A 100.0
/96.0
17
/17
R1AB_CVHSA 3C-like proteinase
3vb6 D C6Z inhibitor[4 aa] A 100.0
/96.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb6 D C6Z inhibitor[4 aa] B 100.0
/96.1
16
/16
R1A_CVHSA 3C-like proteinase
3vb6 C C6Z inhibitor[4 aa] A 100.0
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
3vb4 C B4Z inhibitor[5 aa] A 100.0
/96.0
21
/21
R1A_CVHSA 3C-like proteinase
3vb4 C B4Z inhibitor[5 aa] B 100.0
/96.1
1
/1
R1A_CVHSA 3C-like proteinase
3vb5 D C4Z inhibitor[5 aa] B 100.0
/96.1
21
/21
R1A_CVHSA 3C-like proteinase
3vb4 D B4Z inhibitor[5 aa] B 100.0
/96.1
18
/18
R1A_CVHSA 3C-like proteinase
3vb5 C C4Z inhibitor[5 aa] A 100.0
/96.0
18
/18
R1A_CVHSA 3C-like proteinase
3aw0 B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/95.8
18
/18
R1A_CVHSA 3C-Like Proteinase
3aw0 B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/95.8
18
/18
R1A_CVHSA 3C-Like Proteinase
2q6g C Polypeptide chain[11 aa] A 100.0
/95.7
24
/24
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
2q6g D Polypeptide chain[8 aa] B 96.0
/95.7
25
/25
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
3avz B peptide ACE-SER-ALA-VAL-ALC-HIS-H[6 aa] A 94.7
/95.7
19
/19
R1A_CVHSA 3C-Like Proteinase
3atw C peptide ACE-THR-VAL-ALC-HIS-H[5 aa] A 95.2
/95.7
21
/21
R1A_CVHSA 3C-Like Proteinase
3atw D peptide ACE-THR-VAL-ALC-HIS-H[5 aa] B 94.7
/95.7
19
/19
R1A_CVHSA 3C-Like Proteinase
6xa9 B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
6xa9 D ISG15_HUMAN ISG15 CTD-propargylamide[79 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
5tl6 D ISG15_HUMAN Ubiquitin-like protein ISG15[78 aa] A 100.0
/82.9
21
/21
R1AB_CVHSA Replicase polyprotein 1ab
6xa9 F ISG15_HUMAN ISG15 CTD-propargylamide[79 aa] E 100.0
/100.0
24
/24
R1AB_SARS2 Papain-like protease
5tl6 C ISG15_HUMAN Ubiquitin-like protein ISG15[79 aa] B 95.5
/83.0
22
/22
R1AB_CVHSA Replicase polyprotein 1ab
5tl7 C ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] D 91.7
/82.7
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
5tl7 A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9
27
/27
R1AB_CVHSA Replicase polyprotein 1ab
5e6j F UBB_HUMAN Polyubiquitin-B[75 aa] D 70.0
/82.7
10
/10
R1AB_CVHSA Replicase polyprotein 1ab
5e6j B UBC_HUMAN ubiquitin[76 aa] A 92.0
/82.0
25
/25
R1AB_CVHSA Replicase polyprotein 1ab
6xaa B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0
25
/25
R1AB_SARS2 Papain-like protease
5e6j E UBC_HUMAN ubiquitin[76 aa] D 92.0
/82.7
25
/25
R1AB_CVHSA Replicase polyprotein 1ab
4mm3 A UBC_HUMAN Ubiquitin[76 aa] B 88.0
/82.9
25
/25
R1A_CVHSA Papain-like proteinase
5e6j C UBB_HUMAN Polyubiquitin-B[75 aa] A 63.6
/82.0
11
/11
R1AB_CVHSA Replicase polyprotein 1ab
4m0w B RS27A_BOVIN Ubiquitin[76 aa] A 88.5
/82.3
26
/26
R1A_CVHSA Replicase polyprotein 1a
4rsp B Peptide inhibitor[5 aa] A 70.0
/52.3
20
/20
V9TU12_9BETC Orf1a protein
4rsp B Peptide inhibitor[5 aa] A 70.0
/52.3
20
/20
V9TU12_9BETC Orf1a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yyt G RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6yyt F RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6yyt H RNA product B 100.0
/100.0
4
/4
R1AB_SARS2 nsp8
6yyt F RNA product B 100.0
/100.0
4
/4
R1AB_SARS2 nsp8
6yyt H RNA product D 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez G Product RNA D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6xez G Product RNA B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez H Template RNA B 100.0
/100.0
2
/2
R1AB_SARS2 nsp8
6xez H Template RNA D 100.0
/100.0
1
/1
R1AB_SARS2 nsp8
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rha B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfw F T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rha B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfw F T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rgt F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgt F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5r7y B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5r7y B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfu F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfu F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rft E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rft E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfi E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfi E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rg0 F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rg0 F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfz E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfz E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgu B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rgu B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rfy E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfy E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfx E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfx E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rh9 F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rh9 F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rh7 F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rh7 F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
6xqt D NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
B 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
7jyc B NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
7jyc B NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
6xqt C NNA
(1R,2S,5S)-3-[N-({1-[(tert-butylsulfonyl)methyl]cy..
A 100.0
/100.0
25
/25
R1AB_SARS2 3C-like proteinase
5reh E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5reh E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re8 E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re8 E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re7 E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re7 E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5reb E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5reb E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6z2e B Q5T
(4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[..
A 100.0
/100.0
21
/21
R1AB_SARS2 Main Protease
6z2e B Q5T
(4~{S})-4-[[(2~{S})-2-[[(2~{S})-2-[[(2~{S})-2-[3-[..
A 100.0
/100.0
21
/21
R1AB_SARS2 Main Protease
5rer E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rer E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6zru D U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 Main Protease
6zru D U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 Main Protease
6wnp B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
6wnp B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
7c6s B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
7com D U5G
boceprevir (bound form)[37 atoms]
B 100.0
/100.0
15
/15
R1AB_SARS2 main protease
6xqu B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
7com C U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 main protease
7c6s B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
6xqu B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5red E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5red E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfj E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfj E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfl E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfl E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rf8 E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf8 E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfm E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfm E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6xr3 B V7G
N-[(2S)-1-({(1S,2S)-1-(1,3-benzothiazol-2-yl)-1-hy..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
6xr3 B V7G
N-[(2S)-1-({(1S,2S)-1-(1,3-benzothiazol-2-yl)-1-hy..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
6woj H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
6woj E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 100.0
/100.0
21
/21
R1AB_SARS2 Non-structural protein 3
6ywl P APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
C 100.0
/100.0
24
/24
R1AB_SARS2 NSP3 macrodomain
6woj F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 100.0
/100.0
22
/22
R1AB_SARS2 Non-structural protein 3
6w02 E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 100.0
/100.0
21
/21
R1AB_SARS2 Non-structural protein 3
6ywl X APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
E 100.0
/100.0
23
/23
R1AB_SARS2 NSP3 macrodomain
6woj G APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
C 100.0
/100.0
22
/22
R1AB_SARS2 Non-structural protein 3
6ywl T APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
22
/22
R1AB_SARS2 NSP3 macrodomain
6ywl F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 100.0
/100.0
22
/22
R1AB_SARS2 NSP3 macrodomain
6ywl M APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 100.0
/100.0
24
/24
R1AB_SARS2 NSP3 macrodomain
6w02 C APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 100.0
/100.0
21
/21
R1AB_SARS2 Non-structural protein 3
5rfn E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfn E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfp E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfp E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfs F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfs F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfr E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rfr E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6yvf B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
6yvf B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
5r84 B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5r84 B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
7c8r B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8r B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7c8r B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
7c8r B TG3
ethyl (4R)-4-[[(2S)-4-methyl-2-[[(2S,3R)-3-[(2-met..
A 100.0
/100.0
23
/23
R1AB_SARS2 3C-like proteinase
5rh2 B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh2 B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh0 B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rh0 B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
4m0w E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 85.7
/82.3
7
/7
R1A_CVHSA Replicase polyprotein 1a
6vxs H NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
4m0w F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 83.3
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
6vxs D NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rgz B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgz B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
7jme B CMP
ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE[22 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 3
5rem E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rem E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgw B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgw B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rfo E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfo E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgv B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgv B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rel E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rel E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5reo E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5reo E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re4 E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5re4 E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgy B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgy B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6w6y C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 SARS-CoV-2 NSP3
5rgx B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgx B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh1 B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rh1 B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5ren E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5ren E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rg2 E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rg2 E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rhf F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rhf F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5ref E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5ref E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rg1 E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rg1 E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rhe B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rhe B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfe E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfe E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7brp D HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
B 100.0
/100.0
16
/16
R1A_SARS2 3C-like proteinase
7brp C HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
A 100.0
/100.0
16
/16
R1A_SARS2 3C-like proteinase
6lze F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
6lze F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rea E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rea E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rg3 F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rg3 F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7cx9 B GKF
3-iodanyl-1~{H}-indazole-7-carbaldehyde[12 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C protein
7cx9 B GKF
3-iodanyl-1~{H}-indazole-7-carbaldehyde[12 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C protein
5rh4 B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rh4 B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfq E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfq E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfa D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfa D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5ree E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5ree E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rh8 F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rh8 F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rf9 E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rf9 E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rec E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rec E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reu E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5reu E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rej E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rej E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7buy B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
SARS-CoV-2 virus Main protease
7buy B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
SARS-CoV-2 virus Main protease
5rei E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rei E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase