[Full Bars]

[SiteTable]


Summary Bars[100 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
50964 4405 194 YP_009725295.1(YP_009725295.1) RecName: Full=orf1a polyprotein
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725295.1(YP_009725295.1)]

4405
region name description
1-4405 DISORDER predicted by DISOPRED (1-17,752-770,922-1028,1193-1239,1272-1275,1300-1301,1305-1306,1308-1316,1401-1402,1404-1406,1408-1408,1492-1492,1606-1622,1877-1885,1889-1889,2025-2058,2420-2420,2544-2544,2546-2546,2550-2551,2553-2553,2569-2569,2571-2576,2578-2579,2599-2599,2608-2612,2615-2615,2619-2619,2639-2651,3258-3259,3261-3275,3451-3454,3457-3459,3569-3569,3966-3967,3969-3973,3988-4025,4111-4118,4141-4141,4143-4165,4309-4321,4384-4405)

MONOMER
4405
pdb_id a1 identity[%]2 description
6wzu A 100.0 R1AB_SARS2 Non-structural protein 3
6yb7 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
6yyt B 100.0 R1AB_SARS2 nsp8
6wey A 100.0 R1AB_SARS2 Non-structural protein 3
6wvn B 100.0 R1AB_SARS2 Non-structural protein 10
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7c2i[15] A R1AB_SARS2 Replicase polyprotein 1ab[298 aa] B 100.0
/100.0
20
/20
R1AB_SARS2 Replicase polyprotein 1ab
6yz6[2] B LEUPEPTIN[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 Main Protease
6yyt[1] C R1AB_SARS2 nsp7[73 aa] D 100.0
/100.0
24
/24
R1AB_SARS2 nsp8
7btf[1] B R1AB_SARS2 NSP7[68 aa] C 100.0
/100.0
4
/4
R1AB_SARS2 NSP8
6yyt[1] C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6wqd[1] C R1AB_SARS2 SARS-CoV-2 NSP7[73 aa] B 100.0
/100.0
9
/9
R1AB_SARS2 SARS-CoV-2 NSP8
6wqd[1] A R1AB_SARS2 SARS-CoV-2 NSP7[74 aa] B 100.0
/100.0
25
/25
R1AB_SARS2 SARS-CoV-2 NSP8
7bqy[4] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
21
/21
R1AB_SARS2 main protease
6lu7[2] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
1
/1
R1AB_SARS2 main protease
7btf[2] A R1AB_SARS2 NSP12[915 aa] C 100.0
/100.0
48
/48
R1AB_SARS2 NSP8
6yyt[1] A R1AB_SARS2 nsp12[853 aa] D 100.0
/100.0
10
/10
R1AB_SARS2 nsp8
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yyt[1] G RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
6yyt[4] F RNA product D 100.0
/100.0
3
/3
R1AB_SARS2 nsp8
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rha[4] B T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfv[2] E T8J
1-[4-(thiophene-2-carbonyl)piperazin-1-yl]ethan-1-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5r7y[2] B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7brp[2] D HU5
(1R,2S,5S)-N-[(1S)-3-AMINO-1-(CYCLOBUTYLMETHYL)-2,..
B 100.0
/100.0
16
/16
R1A_SARS2 3C-like proteinase
5rfu[2] F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rft[2] E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfi[2] E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rg0[2] F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfz[2] E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfy[2] E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfx[2] E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rh9[2] F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5re5[2] E T0J
N~1~-phenylpiperidine-1,4-dicarboxamide[18 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5reh[2] E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re8[2] E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re7[2] E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5reb[2] E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5re9[2] E LPZ
2-(4-methylphenoxy)-1-(4-methylpiperazin-4-ium-1-y..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6woj[11] H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
5rgp[2] E U1M
1-{4-[(2,4-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6wnp[2] B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5red[2] E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfj[2] E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfl[2] E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk[2] E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rf8[2] E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfm[2] E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfo[2] E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfn[2] E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfp[2] E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfs[2] F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rfr[2] E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5r80[2] E RZG
methyl 4-sulfamoylbenzoate[14 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5r84[2] B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rh2[2] B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh0[2] B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rf6[2] E NTG
5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile[15 at..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgz[2] B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rem[2] E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgw[2] B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rel[2] E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rgu[2] B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5reo[2] E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5re4[2] E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgy[2] B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 SARS-CoV-2 NSP3
5rgx[2] B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh1[2] B UGV
2-(5-chlorothiophen-2-yl)-N-(pyridin-3-yl)acetamid..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5ren[2] E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rg2[2] E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6w4h[1] J BDF
BETA-D-FRUCTOPYRANOSE[12 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP10
5ref[2] E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rg1[2] E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
6yt8[2] B PK8
9-oxa-7-thia-1-azonia-8$l^{2}-zincabicyclo[4.3.0]n..
A 100.0
/100.0
6
/6
R1AB_SARS2 Replicase polyprotein 1ab
5rfe[2] E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rfa[2] D JGY
1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rea[2] E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rg3[2] F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rh4[2] B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfq[2] E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rh3[2] B UHA
(2R)-2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)pr..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5ree[2] E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rh8[2] F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rf9[2] E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rec[2] E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rh5[2] B UHV
N-(5-tert-butyl-1,2-oxazol-3-yl)-N-[(1R)-2-[(4-met..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rej[2] E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rgt[2] F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rei[2] E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rek[2] E T1Y
1-{4-[(3-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rh6[2] F UHY
N-[(1R)-2-[(2-ethyl-6-methylphenyl)amino]-2-oxo-1-..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rey[2] E T4Y
1-{4-[(2-methylphenyl)methyl]-1,4-diazepan-1-yl}et..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m0k[2] F FJC
~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
5rex[2] E T4V
1-{4-[(naphthalen-1-yl)methyl]piperazin-1-yl}ethan..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rh7[2] F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rev[2] E T4J
N-[3-(thiomorpholine-4-carbonyl)phenyl]acetamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rew[2] E T4M
N-[(1R)-1-(naphthalen-1-yl)ethyl]acetamide[16 atom..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf5[2] E HV2
1,1-bis(oxidanylidene)thietan-3-ol[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reu[2] E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rgh[2] E U0M
5-fluoro-1-[(5-methyl-1,3,4-thiadiazol-2-yl)methyl..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5r7z[2] E HWH
~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethana..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
6wtk[1] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
5r83[2] E K0G
N-phenyl-N'-pyridin-3-ylurea[16 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgk[2] E U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rgj[2] E U0S
(5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane[..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6w63[2] B X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rgl[2] E U0Y
1-[4-(4-methylbenzene-1-carbonyl)piperazin-1-yl]et..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6y2f[4] C O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] D O6K
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclopropyl-1-oxi..
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
5rer[2] E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m2n[4] E 3WL
5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one[20 atom..
A 100.0
/100.0
13
/13
SARS-CoV-2 3CL protease
5rgn[2] E U1A
1-{4-[(4-methylphenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rep[2] E T3G
1-{4-[(2,6-difluorophenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfc[2] E K1Y
methyl (2-methyl-4-phenyl-1,3-thiazol-5-yl)carbama..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5ret[2] E T47
1-{4-[(3-chlorophenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgm[2] E U1D
N'-acetyl-4,5,6,7-tetrahydro-1-benzothiophene-2-ca..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgo[2] E U1G
1-[4-(furan-2-carbonyl)piperazin-1-yl]ethan-1-one[..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgr[2] E K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rgr[2] D K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5res[2] E T3V
1-{4-[(2-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7buy[2] B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
SARS-CoV-2 virus Main protease
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[4] D K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rfh[2] E T6Y
1-{4-[(5-chlorothiophen-2-yl)methyl]piperazin-1-yl..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfg[2] E T6V
N-[(3S)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rff[2] E T6M
1-{4-[(4-chlorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rfd[2] E T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reg[2] E LWA
(2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carb..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6ynq[2] B P6N
(2~{S})-2-methyl-3,4-dihydro-2~{H}-naphthalen-1-on..
A 100.0
/100.0
8
/8
R1AB_SARS2 Replicase polyprotein 1ab
6vxs[2] H NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
B 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wtt[1] N UCS
N~2~-[(benzyloxy)carbonyl]-N-[(1R,2S)-1-hydroxy-3-..
C 100.0
/100.0
20
/20
R1AB_SARS2 3C-like proteinase
5rez[2] E T54
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxamid..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6lze[2] F FHR
~{N}-[(2~{S})-3-cyclohexyl-1-oxidanylidene-1-[[(2~..
A 100.0
/100.0
17
/17
R1AB_SARS2 Replicase polyprotein 1ab
6yvf[2] B A82
2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylid..
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
5rf4[2] E T5Y
pyridin-2-ol[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5re6[2] E O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5r81[2] B RZJ
1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf3[2] E T5V
pyrimidin-5-amine[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5r82[2] B RZS
6-(ethylamino)pyridine-3-carbonitrile[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgg[2] E NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[2] E T5G
4-bromobenzene-1-sulfonamide[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfb[2] E K3S
N-[(1-methyl-1H-1,2,3-triazol-4-yl)methyl]ethanami..
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf7[2] E T67
1-(4-methylpiperazin-1-yl)-2-(1H-pyrrolo[2,3-b]pyr..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rgs[2] E S7V
[(2~{R})-4-(phenylmethyl)morpholin-2-yl]methanol[1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wtt[2] J MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6ywm[1] O MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywk[2] I MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/4
R1AB_SARS2 NSP3 macrodomain
6wtt[1] M MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wks[2] G ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
7c2i[2] E ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6w9c[3] D ZN
ZINC ION[1 atoms]
C 100.0
/100.0
1
/1
R1A_SARS2 Papain-like proteinase
7c2j[2] D ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6w61[1] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6wks[2] F ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6wkq[10] N ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP10
6wjt[10] Y ZN
ZINC ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6wzu[3] B ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
6w61[1] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6yvf[2] L CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6w75[1] R NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP10
6w75[1] JA NA
SODIUM ION[1 atoms]
D 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP10
6yvf[2] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[1] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6wtt[2] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6yt8[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
5r7y[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wzu[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
6wen[3] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6yvf[2] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6yz6[5] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6ynq[8] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6wvn[2] EA CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 10
6wtt[1] O CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
6wzu[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6wvn[1] CA CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 10
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w9c[6] A R1A_SARS2 Papain-like proteinase[313 aa] C 100.0
/100.0
3
/3
R1A_SARS2 Papain-like proteinase
5rgm[274] A R1AB_SARS2 3C-like proteinase[304 aa] A 100.0
/100.0
37
/37
R1AB_SARS2 3C-like proteinase
6wks[2] B R1AB_SARS2 Non-structural protein 10[114 aa] B 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 10
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
4405 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wtt[2] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wzu[1] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
6wzu[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
6ywk[2] DA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6yt8[2] C IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6yz6[2] E IMD
IMIDAZOLE[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6w75[1] KA FMT
FORMIC ACID[3 atoms]
D 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP10
6wjt[1] P FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 10
5rf2[2] E HVB
1-azanylpropylideneazanium[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6wks[2] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 10
6ywk[5] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywk[8] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywl[3] R EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywk[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 NSP3 macrodomain
6ywk[7] T EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywm[6] K EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywl[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywl[1] U EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6ywl[6] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywk[2] O EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
4
/5
R1AB_SARS2 NSP3 macrodomain
6ywk[1] M EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 NSP3 macrodomain
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6vxs[2] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Non-structural protein 3
6ywk[1] EA EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6wqd[1] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
6wqd[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP8
6ywm[1] P EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6ywk[1] L EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/3
R1AB_SARS2 NSP3 macrodomain
6y2g[1] C GLY
GLYCINE[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6y2g[1] C GLY
GLYCINE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
5rg3[228] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rf1[226] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[224] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[10] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgy[50] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rg3[226] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6lze[14] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
5rh6[38] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfp[14] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6yvf[6] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
SARS-CoV-2 virus Main protease
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
SARS-CoV-2 virus Main protease
6yz6[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
5rea[14] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6m0k[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6yb7[4] I DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6vxs[2] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
6vxs[2] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6wq3[3] N SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 10
6wrz[2] S SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 10
6wvn[3] FA SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Non-structural protein 10
6wcf[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6w6y[4] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/100.0
11
/11
R1AB_SARS2 SARS-CoV-2 NSP3
6yvf[2] K PEG
DI(HYDROXYETHYL)ETHER[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6yt8[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6yvf[2] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6yvf[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6wtt[2] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6yt8[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Replicase polyprotein 1ab
6wzu[1] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6wzu[1] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.