#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57003 298 40 YP_009725311.1()
QUERYSEQ
SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725311.1()]

298
region name description
1-298 DISORDER predicted by DISOPRED (1-3,295-298)

MONOMER
298
pdb_id a1 identity[%]2 description
7jyy A 100.0 R1AB_SARS2 2'-O-methyltransferase
6wks A 100.0 R1AB_SARS2 2'-O-methyltransferase
7jz0 A 100.0 R1AB_SARS2 2'-O-methyltransferase
7jz0 C 100.0 R1AB_SARS2 2'-O-methyltransferase
6xkm A 100.0 R1AB_SARS2 2'-O-methyltransferase
6wq3 A 100.0 R1AB_SARS2 2'-O-methyltransferase
7jhe A 100.0 R1AB_SARS2 2'-O-methyltransferase
7jpe A 100.0 R1AB_SARS2 2'-O-methyltransferase
7jib A 100.0 R1AB_SARS2 2'-O-methyltransferase
6w4h A 100.0 R1AB_SARS2 SARS-CoV-2 NSP16
6wrz A 100.0 R1AB_SARS2 2'-O-methyltransferase
6wvn A 100.0 R1AB_SARS2 2'-O-methyltransferase
7c2j A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7c2i A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7bq7 A 100.0 R1AB_SARS2 SARS-CoV-2 nsp16
6yz1 A 100.0 R1AB_SARS2 nsp16
6wjt A 100.0 R1AB_SARS2 2'-O-methyltransferase
6wkq A 100.0 R1AB_SARS2 SARS-CoV-2 NSP16
6w75 A 100.0 R1AB_SARS2 SARS-CoV-2 NSP16
7jyy C 100.0 R1AB_SARS2 2'-O-methyltransferase
6w61 A 100.0 R1AB_SARS2 2'-O-methyltransferase
6wjt C 100.0 R1AB_SARS2 2'-O-methyltransferase
6wkq C 100.0 R1AB_SARS2 SARS-CoV-2 NSP16
6w75 C 100.0 R1AB_SARS2 SARS-CoV-2 NSP16
3r24 A 93.5 R1AB_CVHSA 2'-O-methyl transferase
2xyq A 93.7 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyr A 94.1 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv A 94.4 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
5ynn A 66.1 K0BWD0_9BETC nsp16 protein
5ynp A 66.0 K0BWD0_9BETC nsp16 protein
5yni A 66.3 K0BWD0_9BETC nsp16 protein
5ynf A 65.9 K0BWD0_9BETC nsp16 protein
5ynj A 65.9 K0BWD0_9BETC nsp16 protein
5ynm A 66.2 K0BWD0_9BETC nsp16 protein
5yno A 66.0 K0BWD0_9BETC nsp16 protein
5ynq A 66.0 K0BWD0_9BETC nsp16 protein
5ynb A 65.6 K0BWD0_9BETC nsp16 protein
5yn5 A 65.4 K0BWD0_9BETC nsp16 protein
5yn6 A 66.1 K0BWD0_9BETC nsp16 protein
5yn8 A 66.2 K0BWD0_9BETC nsp16 protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3r24 B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/93.5
21
/21
R1AB_CVHSA 2'-O-methyl transferase
7bq7 B R1AB_SARS2 SARS-CoV-2 nsp10[113 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 SARS-CoV-2 nsp16
7jib B R1AB_SARS2 Non-structural protein 10[114 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 2'-O-methyltransferase
6wkq B R1AB_SARS2 SARS-CoV-2 NSP10[122 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
6w61 B R1AB_SARS2 Non-structural protein 10[115 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 2'-O-methyltransferase
6wrz B R1AB_SARS2 Non-structural protein 10[118 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
6wq3 B R1AB_SARS2 Non-structural protein 10[119 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 2'-O-methyltransferase
6xkm B R1AB_SARS2 Non-structural protein 10[115 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 2'-O-methyltransferase
6wjt D R1AB_SARS2 Non-structural protein 10[115 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
6w4h B R1AB_SARS2 SARS-CoV-2 NSP10[116 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 SARS-CoV-2 NSP16
2xyv B R1AB_CVHSA NON-STRUCTURAL PROTEIN 10[115 aa] A 100.0
/94.4
22
/22
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wkq D R1AB_SARS2 SARS-CoV-2 NSP10[116 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 SARS-CoV-2 NSP16
6wvn B R1AB_SARS2 Non-structural protein 10[123 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 2'-O-methyltransferase
7c2i B R1AB_SARS2 Replicase polyprotein 1ab[116 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 Replicase polyprotein 1ab
7jhe B R1AB_SARS2 Non-structural protein 10[115 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
7jyy B R1AB_SARS2 Non-structural protein 10[129 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 2'-O-methyltransferase
6wjt B R1AB_SARS2 Non-structural protein 10[122 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 2'-O-methyltransferase
2xyq B R1AB_CVHSA NON-STRUCTURAL PROTEIN 10[122 aa] A 100.0
/93.7
21
/21
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75 D R1AB_SARS2 SARS-CoV-2 NSP10[115 aa] C 100.0
/100.0
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
6yz1 B R1AB_SARS2 nsp10[113 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 nsp16
6w75 B R1AB_SARS2 SARS-CoV-2 NSP10[122 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 B R1AB_SARS2 Non-structural protein 10[129 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 2'-O-methyltransferase
2xyr B R1AB_CVHSA NON-STRUCTURAL PROTEIN 10[116 aa] A 100.0
/94.1
21
/21
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wks B R1AB_SARS2 Non-structural protein 10[114 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
7jz0 D R1AB_SARS2 Non-structural protein 10[115 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
7jpe B R1AB_SARS2 Non-structural protein 10[115 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 2'-O-methyltransferase
7c2j B R1AB_SARS2 Replicase polyprotein 1ab[115 aa] A 100.0
/100.0
19
/19
R1AB_SARS2 Replicase polyprotein 1ab
7jyy D R1AB_SARS2 Non-structural protein 10[115 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 2'-O-methyltransferase
5yn8 B K4LC41_9BETC nsp10 protein[117 aa] A 63.6
/66.2
22
/22
K0BWD0_9BETC nsp16 protein
5yn5 B K4LC41_9BETC nsp10 protein[124 aa] A 62.5
/65.4
24
/24
K0BWD0_9BETC nsp16 protein
5ynj B K4LC41_9BETC nsp10 protein[124 aa] A 60.0
/65.9
25
/25
K0BWD0_9BETC nsp16 protein
5ynf B K4LC41_9BETC nsp10 protein[125 aa] A 60.0
/65.9
25
/25
K0BWD0_9BETC nsp16 protein
5ynq B K4LC41_9BETC nsp10 protein[120 aa] A 59.1
/66.0
22
/22
K0BWD0_9BETC nsp16 protein
5ynm B K4LC41_9BETC nsp10 protein[120 aa] A 61.5
/66.2
26
/26
K0BWD0_9BETC nsp16 protein
5ynp B K4LC41_9BETC nsp10 protein[122 aa] A 58.3
/66.0
24
/24
K0BWD0_9BETC nsp16 protein
5yno B K4LC41_9BETC nsp10 protein[121 aa] A 59.1
/66.0
22
/22
K0BWD0_9BETC nsp16 protein
5ynn B K4LC41_9BETC nsp10 protein[121 aa] A 60.0
/66.1
25
/25
K0BWD0_9BETC nsp16 protein
5yn6 B K4LC41_9BETC nsp10 protein[120 aa] A 57.1
/66.1
21
/21
K0BWD0_9BETC nsp16 protein
5yni B K4LC41_9BETC nsp10 protein[120 aa] A 61.9
/66.3
21
/21
K0BWD0_9BETC nsp16 protein
5ynb B K4LC41_9BETC nsp10 protein[122 aa] A 61.5
/65.6
26
/26
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7jz0 F RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') C 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jz0 E RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jyy E RNA (5'-D(*(M7G))-R(P*AP*UP*UP*A)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jyy F RNA (5'-D(*(M7G))-R(P*AP*UP*UP*A)-3') C 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5ynf C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 89.5
/65.9
19
/19
K0BWD0_9BETC nsp16 protein
7jib G GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
7jpe C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5yno D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 88.2
/66.0
17
/17
K0BWD0_9BETC nsp16 protein
5ynp D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 88.2
/66.0
17
/17
K0BWD0_9BETC nsp16 protein
6wks E GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
6wrz D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6wvn O GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5ynm D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 93.8
/66.2
16
/16
K0BWD0_9BETC nsp16 protein
6wq3 D GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jib I MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
6wvn P MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6wrz E MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
7jhe F MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
7jhe E V9G
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-(2'-O-METHYL..
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6w4h G BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h J BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wks D ADN
ADENOSINE[19 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wvn Q ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn R ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jpe E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6wq3 E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
5ynn D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 92.9
/66.1
14
/14
K0BWD0_9BETC nsp16 protein
5ynj C GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 94.1
/65.9
17
/17
K0BWD0_9BETC nsp16 protein
5ynq D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 93.8
/66.0
16
/16
K0BWD0_9BETC nsp16 protein
5yni D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 87.5
/66.3
16
/16
K0BWD0_9BETC nsp16 protein
7jz0 G SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
5ynq C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/66.0
19
/19
K0BWD0_9BETC nsp16 protein
2xyq E SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/93.7
17
/17
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wrz C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
2xyv J SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/94.4
16
/16
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wjt R SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jz0 T SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jhe D SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5yno C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/66.0
19
/19
K0BWD0_9BETC nsp16 protein
6wjt F SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6wq3 C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
5yn8 C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.4
/66.2
18
/18
K0BWD0_9BETC nsp16 protein
7jyy Q SAM
S-ADENOSYLMETHIONINE[27 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jpe D SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
7c2j C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
6w61 F SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jib E SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7jyy G SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7c2i C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
3r24 C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.5
19
/19
R1AB_CVHSA 2'-O-methyl transferase
6w4h D SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
5yni C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 94.1
/66.3
17
/17
K0BWD0_9BETC nsp16 protein
6wks C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6wvn N SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6w75 W SAM
S-ADENOSYLMETHIONINE[27 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
7bq7 C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 nsp16
6w75 F SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
5ynm C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 94.1
/66.2
17
/17
K0BWD0_9BETC nsp16 protein
6xkm D SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
5yn6 C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 94.4
/66.1
18
/18
K0BWD0_9BETC nsp16 protein
6yz1 C SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 nsp16
2xyr H SFG
SINEFUNGIN[27 atoms]
A 100.0
/94.1
17
/17
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wkq G SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 NSP16
5ynb C SFG
SINEFUNGIN[27 atoms]
A 94.4
/65.6
18
/18
K0BWD0_9BETC nsp16 protein
6wkq R SFG
SINEFUNGIN[27 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 SARS-CoV-2 NSP16
5ynn C SFG
SINEFUNGIN[27 atoms]
A 93.8
/66.1
16
/16
K0BWD0_9BETC nsp16 protein
5ynp C SFG
SINEFUNGIN[27 atoms]
A 94.1
/66.0
17
/17
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xyq G NA
SODIUM ION[1 atoms]
A 100.0
/93.7
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75 V NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jyy S NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wkq E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 I NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wjt Q NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
2xyv E NA
SODIUM ION[1 atoms]
A 100.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyr C NA
SODIUM ION[1 atoms]
A 100.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75 S NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6w75 E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq Q NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
2xyv D NA
SODIUM ION[1 atoms]
A 100.0
/94.4
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0 H NA
SODIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wjt E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w75 T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 V NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jyy I NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wkq F NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq P NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
2xyv C NA
SODIUM ION[1 atoms]
A 100.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyq F NA
SODIUM ION[1 atoms]
A 100.0
/93.7
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75 U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
2xyr I MG
MAGNESIUM ION[1 atoms]
A 0.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv K MG
MAGNESIUM ION[1 atoms]
A 0.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyq H MG
MAGNESIUM ION[1 atoms]
A 0.0
/93.7
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jyy H MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jyy R MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jib D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
7jz0 K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6xkm C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyr D CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jhe C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyr E CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0 Z CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyr G CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wrz N CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz O CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jib C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jz0 W CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jz0 J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w61 C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jz0 AA CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyq C CL
CHLORIDE ION[1 atoms]
A 100.0
/93.7
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyv I CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz P CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jyy J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/4
R1AB_SARS2 2'-O-methyltransferase
2xyv F CL
CHLORIDE ION[1 atoms]
A 75.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyr F CL
CHLORIDE ION[1 atoms]
A 66.7
/94.1
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0 Y CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyv H CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jz0 X CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn DA CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn M CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
2xyq D CL
CHLORIDE ION[1 atoms]
A 100.0
/93.7
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyv G CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
3
/3
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wkq V FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 BA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 O FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wkq T FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq S FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 FA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy W FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75 AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wkq Y FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 KA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 BA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
7jyy U FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wkq W FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq I FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq U FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 Y FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt S FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
7jz0 L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6w75 CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt U FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wjt K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wjt W FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75 Z FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wkq K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 J FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt I FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75 DA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 GA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wjt G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wjt T FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
7jz0 CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
7jyy L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wjt V FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wkq L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 X FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq J FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt P FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6w75 I FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt J FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wkq AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0 N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75 K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy V FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wjt H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6w75 M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq X FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75 G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
6wkq Z FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wkq H FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6w75 EA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w61 D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6w61 E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w4h C SO3
SULFITE ION[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wvn FA SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn W SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wrz L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn Y SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wrz G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn V SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
6wvn X SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn Z SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wrz I SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wrz J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wq3 I SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wq3 K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wq3 H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6wq3 G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wq3 J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wrz K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
6wq3 F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6yz1 D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 nsp16
6w4h E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.