#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[50 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57003 298 40 YP_009725311.1()
QUERYSEQ
SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725311.1()]

298
region name description
1-298 DISORDER predicted by DISOPRED (1-3,295-298)

MONOMER
298
pdb_id a1 identity[%]2 description
7jyy A 100.0 R1AB_SARS2 2'-O-methyltransferase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3r24[1] B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/93.5
21
/21
R1AB_CVHSA 2'-O-methyl transferase
7bq7[27] B R1AB_SARS2 SARS-CoV-2 nsp10[113 aa] A 100.0
/100.0
21
/21
R1AB_SARS2 SARS-CoV-2 nsp16
5yn8[12] B K4LC41_9BETC nsp10 protein[117 aa] A 63.6
/66.2
22
/22
K0BWD0_9BETC nsp16 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7jz0[1] F RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') C 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] E RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
7jyy[2] E RNA (5'-D(*(M7G))-R(P*AP*UP*UP*A)-3') A 100.0
/100.0
26
/26
R1AB_SARS2 2'-O-methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5ynf[5] C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 89.5
/65.9
19
/19
K0BWD0_9BETC nsp16 protein
7jib[5] G GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..
A 100.0
/100.0
17
/17
R1AB_SARS2 2'-O-methyltransferase
7jib[4] I MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
7jhe[1] E V9G
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-(2'-O-METHYL..
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
6w4h[1] G BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] J BDF
beta-D-fructopyranose[12 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wks[1] D ADN
ADENOSINE[19 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Q ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] R ADE
ADENINE[10 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jpe[2] E 8NK
7-methylguanosine 5'-diphosphate [29 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
5ynn[4] D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 92.9
/66.1
14
/14
K0BWD0_9BETC nsp16 protein
7jz0[7] G SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
5ynq[5] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
A 94.7
/66.0
19
/19
K0BWD0_9BETC nsp16 protein
7jyy[15] Q SAM
S-ADENOSYLMETHIONINE[27 atoms]
C 100.0
/100.0
18
/18
R1AB_SARS2 2'-O-methyltransferase
7c2j[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 Replicase polyprotein 1ab
3r24[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms]
A 100.0
/93.5
19
/19
R1AB_CVHSA 2'-O-methyl transferase
6yz1[5] C SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 nsp16
6wkq[2] G SFG
SINEFUNGIN[27 atoms]
A 100.0
/100.0
17
/17
R1AB_SARS2 SARS-CoV-2 NSP16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xyq[2] G NA
SODIUM ION[1 atoms]
A 100.0
/93.7
6
/6
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6w75[3] V NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy[10] T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jyy[1] S NA
SODIUM ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
2xyv[1] E NA
SODIUM ION[1 atoms]
A 100.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
2xyr[3] C NA
SODIUM ION[1 atoms]
A 100.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0[2] U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6w75[1] T NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[1] U NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
2xyr[3] I MG
MAGNESIUM ION[1 atoms]
A 0.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jyy[2] H MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
7jib[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
7jz0[5] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6xkm[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyr[3] D CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
1
/1
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jhe[3] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyr[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0[1] Z CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
2xyr[3] G CL
CHLORIDE ION[1 atoms]
A 100.0
/94.1
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0[2] W CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
7jz0[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w61[1] C CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
7jz0[1] AA CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyv[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/94.4
2
/2
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
6wvn[1] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wrz[1] P CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
2xyv[2] F CL
CHLORIDE ION[1 atoms]
A 75.0
/94.4
4
/4
R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
7jz0[1] Y CL
CHLORIDE ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[2] DA CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
298 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wkq[16] V FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[13] BA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
6w75[3] O FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6wjt[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wkq[3] T FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
7jyy[6] W FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75[3] AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0[3] M FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w75[1] KA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0[1] L FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wjt[1] K FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6wjt[1] W FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
7jyy[1] N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6w75[2] DA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0[1] CA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6wjt[1] P FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wkq[2] AA FMT
FORMIC ACID[3 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
7jz0[1] N FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 2'-O-methyltransferase
6w61[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 2'-O-methyltransferase
6w61[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6w4h[1] C SO3
SULFITE ION[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 SARS-CoV-2 NSP16
6wvn[6] FA SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[3] U SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[2] S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[4] T SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wrz[1] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Y SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 2'-O-methyltransferase
6wvn[3] V SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 2'-O-methyltransferase
6wvn[2] X SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 2'-O-methyltransferase
6wvn[1] Z SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 2'-O-methyltransferase
6yz1[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 nsp16
6w4h[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 SARS-CoV-2 NSP16
6w4h[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 SARS-CoV-2 NSP16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.