[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57782 468 51 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha {ECO:0000305}; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha {ECO:0000305}; Short=sIL6R {ECO:0000303|PubMed:12794819, ECO:0000303|PubMed:26876177, ECO:0000303|PubMed:28060820};Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
SIGNAL DISORDER predicted by DISOPRED SIGNAL
2L----
LM
SIGNAL DISORDER predicted by DISOPRED SIGNAL
3A----
SAT
SIGNAL DISORDER predicted by DISOPRED SIGNAL
4V----
VS
SIGNAL DISORDER predicted by DISOPRED SIGNAL
5G----
GS
SIGNAL DISORDER predicted by DISOPRED SIGNAL
6C----
C
SIGNAL DISORDER predicted by DISOPRED SIGNAL
7A----
SAT
SIGNAL DISORDER predicted by DISOPRED SIGNAL
8L----
LG
SIGNAL DISORDER predicted by DISOPRED SIGNAL
9L----
LS
SIGNAL DISORDER predicted by DISOPRED SIGNAL
10A----
VTLSA
SIGNAL DISORDER predicted by DISOPRED SIGNAL
11A----
VAR
SIGNAL DISORDER predicted by DISOPRED SIGNAL
12L----
LVF
SIGNAL DISORDER predicted by DISOPRED SIGNAL
13L----
L
SIGNAL DISORDER predicted by DISOPRED SIGNAL
14A----
AVT
SIGNAL DISORDER predicted by DISOPRED SIGNAL
15A----
AS
SIGNAL DISORDER predicted by DISOPRED SIGNAL
16P----
PV
SIGNAL DISORDER predicted by DISOPRED SIGNAL
17G----
ALIG
SIGNAL DISORDER predicted by DISOPRED SIGNAL
18A----
VMTAL
SIGNAL DISORDER predicted by DISOPRED SIGNAL
19A----
A
SIGNAL SIGNAL
20L e 45.5 1n26_A
LIM
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
21A b 4.5 1n26_A
WVA
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
22PSb 6.2 1n26_A
ESLP
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
23RSe 88.1 1n26_A
LSGR
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
24R e 73.1 1n26_A
ESKPGR
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
25C b 10.0 1n26_A
CK
DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular"
26P e 42.6 1n26_A
PDNRS
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
27A e 31.2 1n26_A
VQAK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
28Q e 34.2 1n26_A
YALQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
29E e 84.4 1n26_A
VEWI
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
30V e 32.0 1n26_A
VG
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
31A e 65.2 1n26_A
EAP
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
32RTe 91.7 1n26_A
LPNVQR
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
33GTe 90.5 1n26_A
DG
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
34VEe 24.7 1n26_A
WVT
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
35LEe 41.6 1n26_A
YQLVSH
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
36TEe 32.5 1n26_A
TPY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
37SEb 10.2 1n26_A
DSGLN
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
38L e 37.1 1n26_A
LAQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
39PTe 37.2 1n26_A hetero
PILA
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
40GTe 47.6 1n26_A
G
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
41D e 45.7 1n26_A
EASRD
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
42S e 61.7 1n26_A hetero
TSMPDRK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
43VEb 8.0 1n26_A
VL
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
44TEe 39.0 1n26_A
VTMNQK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
45LEb 0.0 1n26_A
LAIM
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
46TEe 25.3 1n26_A
TCIKR
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
47C b 0.0 1n26_A
C
DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
48PTe 65.1 1n26_A
PDNSGH
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
49GTe 66.7 1n26_A
GTSADEKLPV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
50VSb 1.3 1n26_A
VAKSMPGLDEIRTCFHNQY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
51E e 64.8 1n26_A
ETDSNLAGIKPRVCFHMQY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
52PTe 75.2 1n26_A
PAEWGLSVDFHIKMNQRTY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
53ETe 56.3 1n26_A compound NAG
EDGALFIKNPQRSTVY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
54D e 32.7 1n26_A compound NAG
DEGALFIKNPQRSTVY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
55N e 72.1 1n26_A compound NAG
DNGALEKSTVFIPQRYCHMW
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: Strongly induces cleavage and sIL6R levels. No effect on IL6R signaling; when associated with A-93, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-93, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: Strongly induces cleavage and sIL6R levels. No effect on IL6R signaling; when associated with A-93, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-93, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
56ASe 22.3 1n26_A
AGTVILSDEFKNPQRCHMWY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
57TEe 51.9 1n26_A
TPALGSVDEIKRFNQYCHMW
MUTAGEN /note="T->A: Strongly induces cleavage and sIL6R levels." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" MUTAGEN /note="T->A: Strongly induces cleavage and sIL6R levels." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
58VEb 0.0 1n26_A
IVLADEGKNPQRST
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
59HEe 51.3 1n26_A homo
THSYIADEGKLNPQRV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
60WEb 0.8 1n26_A
WADEGKLPSTV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
61VEb 3.3 1n26_A
TVFLAEGSDIKNPQRCHMWY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
62LEb 2.2 1n26_A hetero
LYFRSADEGKTVINPQCHMW
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
63REe 37.2 1n26_A otherpoly
RDLNQAGEKPSTVFIYCHMW
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
64K e 25.5 1n26_A otherpoly
KGDENQALPSTVFIRYCHMW
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
65PSe 77.5 1n26_A otherpoly
PRGQNSALDEKTVFIYCHMW
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
66ASe 58.0 1n26_A
RADKSVGLEFINPQTCHMWY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
67ASe 92.9 1n26_A
TSLQNEAG
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
68GSe101.2 1n26_A
GSPRLAV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
69S e 32.8 1n26_A hetero
SDCLTQAEGIKPRV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
70H e 56.5 1n26_A hetero
QHEDLGPRAIKSTV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
71P e 55.0 1n26_A hetero
SLPYIQDNKAEGRTV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
72SEe 21.9 1n26_A
SDGRNAEIKLPTV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
73REe 68.4 1n26_A hetero homo
ERDPAFGIKLNQSTVY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
74WEe 41.8 1n26_A homo
VWLRSDPIAEFGKNQTY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
75AEe 62.5 1n26_A hetero homo
LASNTVH
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
76GEb 15.5 1n26_A
GKNTL
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
77MEe 67.6 1n26_A homo
SLTVNM
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
78GSb 14.3 1n26_A
GISK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
79RSe 24.1 1n26_A
KHSLMTNRY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
80REe 55.3 1n26_A homo
TRYLQVE
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
81LEe 20.8 1n26_A homo
LYAKV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
82LEe 51.7 1n26_A hetero homo
VTLIFQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
83LEb 8.4 1n26_A hetero homo
LIVD
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
84R e 87.7 1n26_A hetero homo
RQAKNLH
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
85SSe 41.4 1n26_A
VSQAGRCND
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
86V b 0.0 1n26_A hetero
VKRILSA
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
87Q e 35.7 1n26_A hetero
EDQCKNRL
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
88LGe 45.5 1n26_A hetero
FLSAQMTV
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
89HGe 60.2 1n26_A hetero
GESHTLQPNRA
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
90DGb 19.8 1n26_A hetero metal NA homo
DHSQN
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
91S b 13.3 1n26_A hetero
ASGEPTI
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
92GEb 3.6 1n26_A
GDH
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
93NEe 35.2 1n26_A otherpoly
QENTYLHSDGW
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
94YEb 0.4 1n26_A hetero
YLW
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
95SEb 9.4 1n26_A
TSVALNI
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
96CEb 0.7 1n26_A
CES
DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
97YEe 24.8 1n26_A
HRWQFYTS
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
98RSe 39.5 1n26_A
KTRSHLVEAQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
99ASe 90.2 1n26_A
GSDLTNA
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
100GSe 63.1 1n26_A
GEWDS
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
101RSe 79.4 1n26_A
EHRVFSALK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
102P e101.6 1n26_A
PVLDITASF
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
103ASb 8.9 1n26_A
LGVTRAK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
104G e 35.7 1n26_A compound NAG
SGIATHCY
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
105TEe 30.5 1n26_A
TQHGRIMS
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
106VEb 13.3 1n26_A hetero metal K NA
VSITM
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
107HEe 41.9 1n26_A hetero metal K otherpoly
LTERHNCGPYDFQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
108LEb 2.2 1n26_A
LIM
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
109LEe 24.2 1n26_A metal K NA
LHKIYFRSAQT
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
110VEb 2.7 1n26_A hetero metal CL
VLSIGKT
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
111D b 0.6 1n26_A
GDQEHK
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
112V e 40.0 1n26_A hetero IL23A_HUMAN precipitant
VILSFYAKQ
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular"
113P e 50.4 1n26_A hetero IL23A_HUMAN
PLDAFVK
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
114P b 14.0 1n26_A hetero IL23A_HUMAN
PKQGR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
115E b 19.6 1n26_A hetero precipitant
EDKGANR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
116E e 39.7 1n26_A hetero IL23R_HUMAN precipitant
KQERDPI
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
117P b 0.0 1n26_A
PKTS
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
118Q e 61.7 1n26_A hetero IL23R_HUMAN metal NA K
EKRQNVFGT
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
119L b 11.8 1n26_A
LIVN
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
120SEe 47.7 1n26_A precipitant
SKTIFQMRHV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
121CEb 6.7 1n26_A hetero precipitant
CKVTR
MUTAGEN /note="C->S: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->S: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
122FEe 23.0 1n26_A precipitant
EICFRVWMADGKLNPQSTY
MUTAGEN /note="F->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
123RBb 1.6 1n26_A hetero precipitant
ARSQVL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
124KSe 27.8 1n26_A
KSNAER
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
125SSb 0.8 1n26_A hetero metal NA precipitant
NPTEGDSVCRAL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
126PTb 0.0 1n26_A hetero IL23A_HUMAN IL6_HUMAN I12A_HUMAN IL12A_HUMAN compound NAG
YEGDPSN
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
127LTe 52.2 1n26_A hetero PRL_HUMAN IL6_HUMAN compound NAG
SKAPLYMRNQDEGTV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
128SSe 30.5 1n26_A hetero PRL_HUMAN IL6_HUMAN CSH_SHEEP otherpoly
GEKSAIV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
129N e 35.8 1n26_A hetero compound NAG metal NA otherpoly precipitant
NTRGHSDAK
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
130VEb 0.0 1n26_A metal NA
FVMILA
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
131VEb 16.7 1n26_A hetero metal NA otherpoly precipitant
TSAYLDRFGIV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
132CEb 0.0 1n26_A
CL
MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
133EEe 20.1 1n26_A hetero precipitant
WSTEQRA
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
134WEb 4.8 1n26_A metal NA
WL
MUTAGEN /note="W->L: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="W->L: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
135G e 40.5 1n26_A
GSDTKHIRELNAPV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
136P b 10.1 1n26_A hetero IL23A_HUMAN
PSRTLGFADEIKV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
137RSe 73.9 1n26_A hetero IL23A_HUMAN precipitant
GSRTAPDEIKLV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
138SSe 60.2 1n26_A
SRDAYQPEKTIVGNL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
139T e 55.8 1n26_A
DLVIPTENHSA
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
140P e 20.2 1n26_A precipitant
TGPSQAR
MUTAGEN /note="P->G: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="P->G: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
141S e 27.3 1n26_A otherpoly precipitant
GNASYEHD
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
142LTe 93.3 1n26_A
LSTIVPFH
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
143TTe 27.9 1n26_A precipitant
TPSFEYKG
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
144T b 7.8 1n26_A
TCLNIS
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
145KEe 57.1 1n26_A precipitant
NRGKDHAEPVIT
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
146AEb 4.5 1n26_A
YATVLGSK
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
147VEe 25.3 1n26_A hetero LIF_HUMAN otherpoly
TVAKLSNFE
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
148LEb 0.0 1n26_A hetero IL6_HUMAN Q98823_HHV8 LIF_HUMAN
LFTVISYWM
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
149LEb 1.1 1n26_A hetero LIF_HUMAN precipitant
SLQTHFIAKVY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
150VEb 0.0 1n26_A hetero Q98823_HHV8 LIF_HUMAN precipitant
YLVSAGQTDEIKPR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
151REe 28.5 1n26_A hetero IL6_HUMAN IL6RB_HUMAN LIF_HUMAN precipitant
KRSTAHYNDEGILPV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
152KEb 16.0 1n26_A hetero LIF_HUMAN
KSEGYRADILPTV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
153FEe 42.6 1n26_A hetero IL6RB_HUMAN IL6_HUMAN
KPFRSIVEHMAGLDNQTY
MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
154QSe 44.9 1n26_A hetero IL6RB_HUMAN IL6_HUMAN
RVLTNMDKASQYEFGIP
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
155NSe100.0 1n26_A hetero IL6_HUMAN
NGRTVLDESAFIKPQY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
156SSe 51.6 1n26_A hetero IL6RB_HUMAN
SLVWCPTGKMADEFINQRY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
157PSe 90.7 1n26_A hetero PRL_HUMAN IL6RB_HUMAN CSH_SHEEP
EDAGKSTNYPVILQR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
158A e 43.8 1n26_A hetero PRL_HUMAN IL6RB_HUMAN metal CL precipitant
AGSKNTCQRVEDILP
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
159EEe 57.3 1n26_A
EDKRQTVGLSMAFINPY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
160DEe 32.7 1n26_A
DTESVKGILWAPR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
161FEe 27.3 1n26_A
FYHQLWASKNRVDITEGP
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
162QEe 59.7 1n26_A precipitant
QRIPTSAVEGKNMDFL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
163EEe 26.6 1n26_A otherpoly
EKHSDNVYWRALFGIPQT
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
164PEe 64.3 1n26_A otherpoly
PEQYSTKNRAGLVDFHIM
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
165CEb 11.3 1n26_A
CSKNRVFADEGILPQTWY
MUTAGEN /note="C->L: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->L: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
166QEe 52.6 1n26_A otherpoly
KEPQFRCDNAGILSTV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
167YEe 26.5 1n26_A hetero
YDREHILSTAGKPV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
168SEe 28.9 1n26_A metal NA
YSTKPQDCEIRL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
169QTe 78.1 1n26_A hetero precipitant
VQKHLRCFDNI
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
170ETe 98.0 1n26_A hetero precipitant
ETPRDKAGQSY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
171STe 46.1 1n26_A hetero
CALSGQVYPTDKH
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
172QTe 32.1 1n26_A hetero metal NA precipitant
QGLSTKDNEH
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
173KEe 34.0 1n26_A hetero
PESKRDCGL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
174FEb 1.9 1n26_A metal NA
NLFGTDHYAEIKPQRSV
MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
175SEe 21.9 1n26_A hetero I12A_HUMAN compound MNB metal NA precipitant
SGRKFTADEILPV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
176CEb 0.0 1n26_A precipitant
CILAVEGSTDFHKMNPQRY
MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
177QEe 44.9 1n26_A hetero metal NA otherpoly precipitant
HYDQTNMVAEFGKLSCIPR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
178LEb 1.1 1n26_A
IVFLMRCAEGKSTDHNPQY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
179A e 59.8 1n26_A hetero I12A_HUMAN compound MNB precipitant
ATSPDGHENRCFIKLQV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
180V b 4.7 1n26_A hetero IL23A_HUMAN PRL_HUMAN IL12A_HUMAN I12A_HUMAN compound MNB metal NA precipitant
CKVYIGRALSDEFHMNPQT
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
181P e 55.8 1n26_A hetero IL6_HUMAN I12A_HUMAN IL12A_HUMAN
PMQAKDLNVEFGIRSTY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
182ETe 31.7 1n26_A hetero IL23A_HUMAN IL6_HUMAN I12A_HUMAN IL12A_HUMAN compound NAG
EAHLTYDKSNFGIPQRV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
183GTe 63.1 1n26_A hetero IL23A_HUMAN IL6_HUMAN PRL_HUMAN IL12A_HUMAN compound CYS metal NA
AGTFLSKDEINPQRV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
184D b 5.6 1n26_A hetero IL23A_HUMAN PRL_HUMAN CSH_SHEEP IL12A_HUMAN I12A_HUMAN compound CYS
ESDALWFPNYHGIKQRTV
MUTAGEN /note="D->T: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->T: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
185S e 64.1 1n26_A hetero PRL_HUMAN IL6_HUMAN LIF_HUMAN Q98823_HHV8 IL23A_HUMAN CSH_SHEEP compound CYS homo precipitant
ESTIGMFKNP
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
186S b 2.3 1n26_A hetero IL23A_HUMAN PRL_HUMAN Q98823_HHV8 CSH_SHEEP IL12A_HUMAN
TSVEKAPR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
187FEe 46.9 1n26_A hetero PRL_HUMAN IL6_HUMAN IL6RB_HUMAN Q98823_HHV8 CSH_SHEEP IL23A_HUMAN homo
LIYPWFTRSKQVMN
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
188YEb 0.9 1n26_A hetero IL6_HUMAN Q98823_HHV8 IL12A_HUMAN
YPFHRL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
189IEe 23.4 1n26_A hetero IL6_HUMAN Q98823_HHV8 LIF_HUMAN homo precipitant
IKVFNTER
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
190VEb 0.0 1n26_A hetero IL6_HUMAN Q98823_HHV8 LIF_HUMAN otherpoly precipitant
VIENALTM
MUTAGEN /note="V->G: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="V->G: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
191SEb 0.0 1n26_A hetero IL6_HUMAN LIF_HUMAN otherpoly precipitant
VTNKSWREGMQIL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
192MEb 0.0 1n26_A otherpoly
VLITM
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
193CEb 6.0 1n26_A hetero LIF_HUMAN otherpoly
TVECNASKLM
MUTAGEN /note="C->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular"
194VEb 0.0 1n26_A compound NAG otherpoly
AVDEM
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
195AEb 3.6 1n26_A
ATEIVKNS
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
196SEb 0.0 1n26_A
NVIPAHS
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
197STb 10.9 1n26_A hetero
HSAQPLERD
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
198VTe 24.0 1n26_A hetero
LKVMGHIWA
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
199GEe 22.6 1n26_A hetero
GLAKF
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
200SEe 28.1 1n26_A hetero precipitant
SKNAYHITV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
201KEe 43.9 1n26_A compound NAG otherpoly precipitant
SYKNATVQR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
202FEe 40.7 1n26_A precipitant
SETYCRFVNAGL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
203S b 0.0 1n26_A compound NAG otherpoly precipitant
SNTLE
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
204K e 78.8 1n26_A precipitant
DYLEAHNTSRFK
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
205T e 32.5 1n26_A otherpoly precipitant
PTIDNVYFSHLE
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
206QEe 33.7 1n26_A
SLVQIHERF
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
207TEe 55.2 1n26_A hetero PRL_HUMAN IL6RB_HUMAN LIF_HUMAN CSH_SHEEP
TSYNRDPAGV
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
208FEb 9.6 1n26_A hetero
FVLI
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
209QEe 34.2 1n26_A hetero PRL_HUMAN IL23A_HUMAN IL6_HUMAN LIF_HUMAN IL12A_HUMAN CSH_SHEEP compound CYS
DFTQHISEY
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
210GTb 1.2 1n26_A
IVPSFELGTR
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
211CTe 22.7 1n26_A hetero IL23A_HUMAN PRL_HUMAN CSH_SHEEP IL12A_HUMAN I12A_HUMAN compound CYS metal NA
RLTVFEQYC
MUTAGEN /note="C->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
212GTe 34.5 1n26_A hetero PRL_HUMAN IL23A_HUMAN IL6_HUMAN CSH_SHEEP metal NA
DYSGKTHAL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
213I b 15.2 1n26_A precipitant
IKVM
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
214LBb 0.6 1n26_A
VIL
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
215Q e 29.1 1n26_A hetero precipitant
KQRETI
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
216P b 1.6 1n26_A precipitant
PT
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
217D e 32.1 1n26_A hetero precipitant
DLEGHNST
MUTAGEN /note="D->V: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->V: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular"
218P e 31.8 1n26_A hetero precipitant
PS
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
219P b 4.7 1n26_A
P
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
220AEe 22.3 1n26_A hetero compound NAG otherpoly precipitant
KEVWAQHPYLRT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
221NEe 67.3 1n26_A compound NAG otherpoly
NDGKSE
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-93, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-245 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-93, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-245 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
222IEb 17.5 1n26_A
LVI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
223TEe 42.2 1n26_A compound NAG
QRTVSHEAK
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
224VEb 13.3 1n26_A
LVIAM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
225TEe 46.1 1n26_A homo
KESTRNI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
226AEe 40.2 1n26_A metal NA homo precipitant
PANSFLRQVCKT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
227V e 26.7 1n26_A hetero IL6RA_HUMAN metal NA homo
VLKSIRQ
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
228ATe 58.9 1n26_A hetero IL6RA_HUMAN homo
PNEKASGHRDMQYFILTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
229RTe 82.6 1n26_A homo
GKAEPSRNDV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
230N e 31.5 1n26_A homo
NSLEYKDRT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
231PTe 39.5 1n26_A metal NA homo
PSDQVEGIK
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
232RTe 45.8 1n26_A hetero IL6RB_HUMAN
RSDQMGTAL
MUTAGEN /note="R->S: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="R->S: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
233W e 31.9 1n26_A hetero IL6RB_HUMAN homo
QRYWIHT
MUTAGEN /note="W->Q: 30% decrease of ligand-binding and increase of IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="W->Q: 30% decrease of ligand-binding and increase of IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
234LEb 0.0 1n26_A
LVCGM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
235SEe 25.8 1n26_A hetero IL6RA_HUMAN homo precipitant
EWKTSHRQV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
236VEb 0.0 1n26_A
VLAI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
237TEe 35.7 1n26_A hetero compound NAG precipitant
STKQRALY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
238WEb 3.6 1n26_A hetero
W
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
239QEe 46.4 1n26_A hetero compound NAG precipitant
EQSTVRLF
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
240D e 30.9 1n26_A hetero compound NAG precipitant
YPDNSTH
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
241P b 4.7 1n26_A precipitant
PEADGIKLNQRSTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
242HTe 99.0 1n26_A hetero Q98823_HHV8 PRL_HUMAN compound NAG precipitant
DATSGPELRHIKNQV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
243STe 25.8 1n26_A hetero PRL_HUMAN CSH_SHEEP compound NAG
STDALQIKMG
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
244W b 4.0 1n26_A hetero PRL_HUMAN CSH_SHEEP
WVALGTDEFIKNPQRS
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
245N e 61.8 1n26_A hetero PRL_HUMAN CSH_SHEEP compound NAG otherpoly
SDRKLFNAEGIPQTV
SITE /note="Not glycosylated" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: Slightly induces cleavage and sIL6R levels.No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" SITE /note="Not glycosylated" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: Slightly induces cleavage and sIL6R levels.No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
246S e 33.6 1n26_A hetero PRL_HUMAN IL12A_HUMAN CSH_SHEEP I12A_HUMAN otherpoly homo precipitant
TPSDRAGKQEILV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
247SSe 71.9 1n26_A hetero IL23A_HUMAN PRL_HUMAN IL6_HUMAN Q98823_HHV8 IL12A_HUMAN I12A_HUMAN CSH_SHEEP homo
SEGQFPY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
248FSe 78.5 1n26_A hetero IL23A_HUMAN PRL_HUMAN IL6_HUMAN Q98823_HHV8 IL12A_HUMAN LIF_HUMAN I12A_HUMAN CSH_SHEEP homo
YWSHILGFV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
249YSe 20.4 1n26_A hetero IL23A_HUMAN IL6_HUMAN I12A_HUMAN CSH_SHEEP IL12A_HUMAN homo
FLYIN
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
250R e 43.9 1n26_A hetero PRL_HUMAN IL6_HUMAN IL6RA_HUMAN CSH_SHEEP I12A_HUMAN homo
SLTVRPIQHDM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
251LEb 1.1 1n26_A
LAIVM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
252REe 33.2 1n26_A hetero PRL_HUMAN CSH_SHEEP homo
KTQLHIDEMR
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
253FEb 0.0 1n26_A
FYNS
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
254EEb 15.6 1n26_A compound MNB homo
ERCQFDSWGHNL
MUTAGEN /note="E->A: 50% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="E->A: 50% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
255LEb 0.0 1n26_A
LIV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
256REe 22.9 1n26_A hetero compound MNB precipitant
RQ
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
257YEb 3.5 1n26_A hetero IL6RB_HUMAN compound MAN
YVLAIT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
258REb 18.6 1n26_A hetero
RKQHY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
259AEb 3.6 1n26_A
PGRTVAEL
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
260ETe 43.2 1n26_A
KEALVQIS
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
261RTe 66.0 1n26_A hetero IL6RB_HUMAN
DNKEQRIWGSYTH
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
262S e 45.3 1n26_A hetero IL6RB_HUMAN
ASKHELNDYT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
263KSe 91.0 1n26_A hetero IL6RB_HUMAN
RKEAPSTDL
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
264T e 68.8 1n26_A hetero IL6RB_HUMAN
ETSALRKDQIG
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
265F e 26.8 1n26_A hetero precipitant
WFKDEGLSRA
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
266TEe 39.6 1n26_A hetero IL6RB_HUMAN precipitant
ETKNSIQVHDW
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
267TEe 43.5 1n26_A hetero homo precipitant
TDMQEHSVLRI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
268WEe 33.9 1n26_A hetero compound MNB precipitant
VWHILRQFKNADEGPST
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
269MEe 42.0 1n26_A homo
FPLNEMKHITQSVADGR
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
270V b 3.3 1n26_A hetero homo
VALFPSDHCIT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
271KGe 63.2 1n26_A hetero IL6RB_HUMAN homo
ETAVGDQKSPHLM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
272DGe 80.2 1n26_A hetero IL23A_HUMAN IL6RA_HUMAN homo
DKGPNQTEVF
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
273LGb 16.9 1n26_A hetero IL6_HUMAN
TALIVKGNQSEDPR
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
274Q e 36.2 1n26_A hetero IL6RA_HUMAN homo precipitant
QTKSRGEA
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
275HSe 27.2 1n26_A hetero CSH_SHEEP homo precipitant
TSGAHKLCENPY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
276HEe 42.4 1n26_A hetero IL6RA_HUMAN homo precipitant
QSHAERTKVGM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
277CEb 11.3 1n26_A hetero IL6RA_HUMAN precipitant
CFTEHKLYSAIDGNPQRV
MUTAGEN /note="C->D: 30% increase of ligand-binding and 100% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->D: 30% increase of ligand-binding and 100% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
278VEe 27.3 1n26_A hetero IL6RA_HUMAN homo precipitant
VKTDRICFNL
MUTAGEN /note="V->N: 50% Decrease of ligand-binding and 50% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="V->N: 50% Decrease of ligand-binding and 50% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
279IEb 0.0 1n26_A homo
ILVTHCMS
MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
280HSe 51.3 1n26_A hetero IL6RB_HUMAN IL6RA_HUMAN homo
TLFKHQCRAVNS
MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
281DSe 39.5 1n26_A hetero IL6RB_HUMAN homo
DRSGHCKNT
MUTAGEN /note="D->G: 70% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->G: 70% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
282A b 0.0 1n26_A homo
LAKCGST
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
283W e 57.8 1n26_A hetero IL6RB_HUMAN homo
KYVNRLDWQHAEFGIPST
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
284STe 53.9 1n26_A
PARSGKCDEFILNQTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
285GTe 45.2 1n26_A compound MAN
GFRKSQADEILNPTV
MUTAGEN /note="G->D: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="G->D: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
286L e 25.3 1n26_A
TKLQAMVIGFDENPRSY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
287R e 54.2 1n26_A compound MAN homo
EKRPVTLNADFGIQSY
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
288HEb 1.0 1n26_A compound MAN homo
YHAGLSDEFIKNPQRTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
289VEb 4.0 1n26_A
VELIAFNSYDGKPRT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
290VEb 0.0 1n26_A
VFIL
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
291QEb 11.2 1n26_A precipitant
QRSE
MUTAGEN /note="Q->K: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->K: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
292LEb 0.0 1n26_A
VILT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
293REe 26.1 1n26_A hetero compound MNB homo precipitant
RSQAH
MUTAGEN /note="R->G: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="R->G: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
294AEb 0.0 1n26_A
ACSG
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
295QEb 15.8 1n26_A hetero I12A_HUMAN precipitant
KRQIMNT
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
296EEb 0.5 1n26_A hetero IL23A_HUMAN IL6_HUMAN I12A_HUMAN IL12A_HUMAN homo
DPEKLAGSTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
297ETb 15.1 1n26_A hetero IL23A_HUMAN PRL_HUMAN IL6_HUMAN CSH_SHEEP I12A_HUMAN homo
RDEHFNPL
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
298FTe 75.1 1n26_A hetero IL23A_HUMAN IL6_HUMAN I12A_HUMAN IL12A_HUMAN homo
LYFTDNSHAGEIKPQRV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
299GTe 58.3 1n26_A hetero IL23A_HUMAN I12A_HUMAN IL12A_HUMAN
YDGESQAFIKLNPRTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
300QBb 19.4 1n26_A hetero IL23A_HUMAN PRL_HUMAN IL6_HUMAN CSH_SHEEP I12A_HUMAN homo
HSKAINGPYLQ
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
301GSb 16.7 1n26_A hetero I12A_HUMAN
GS
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
302E e 60.3 1n26_A hetero metal CL precipitant
SYTEFIQLR
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
303W b 19.1 1n26_A hetero compound MNB metal CL IOD homo precipitant
WL
MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
304S b 2.3 1n26_A precipitant
SN
MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
305E e 62.8 1n26_A precipitant
EDANRTKV
MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
306W e 20.3 1n26_A hetero compound MNB
W
MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
307S b 0.0 1n26_A
SAT
MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
308P e 82.9 1n26_A hetero
PEVLQSA
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
309E e 58.3 1n26_A compound NAG
EATP
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
310AEb 13.4 1n26_A compound NAG
ASV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
311MEe 36.7 1n26_A compound NAG homo
TSWHAFLM
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
312GEb 16.7 1n26_A homo
GASR
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
313T e 37.7 1n26_A homo
TI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
314P b 2.3 1n26_A
PTQ
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
315W e 30.3 1n26_A homo
WSYRADEGIKLPTV
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
316T e 49.4 1n26_A homo
TESAI
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular"
317E e 81.9 1n26_A homo
EDGP
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
318S e137.5 1n26_A homo
SRPETADGIKLV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
319RSb 17.0 3l5h_A
RKPEADGILSTV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
320S e 39.3 3l5h_A
ESAGTDIKLPRV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
321P b 6.2 3l5h_A
PTIRSADEGKLV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
322P----
PI
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
323A----
AGL
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
324E----
EMQWAGLSDFIKNPRTVY
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
325N----
GLDTN
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
326E----
ENIQ
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
327V----
LVIP
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
328S----
WHPSGADEFIKLNQRTVY
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
329T----
TNYLADEFGIKPQRSV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
330P----
PMSADEFGIKLNQRTVY
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
331M----
TRDMAEFGIKLNPQSVY
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
332Q----
QW
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
333A----
AHVPS
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
334L----
ISEQPL
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
335T----
VDTG
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
336T----
ETYH
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
337N----
NDGP
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
338K----
QREKSY
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
339D----
QDVA
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
340D----
DQNL
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
341D----
EIHSD
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
342N----
SEAPDN
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
343I----
ILDAV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
344L----
FQPVSL
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
345F----
WYAPSF
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
346R----
KRQEG
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
347D----
ENSPD
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
348S----
SD
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
349A----
ATLS
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
350N----
NEPQ
CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-245. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-245." TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-245. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-245." DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
351A----
AP
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
352T----
THP
CARBOHYD /note="O-linked (GlcNAc) threonine" MUTAGEN /note="T->A: No effect on IL6R signaling." TOPO_DOM /note="Extracellular" CARBOHYD /note="O-linked (GlcNAc) threonine" MUTAGEN /note="T->A: No effect on IL6R signaling." DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
353S----
SAP
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
354L----
RLV
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
355P----
PL
MUTAGEN /note="P->I,D: Reduces cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" MUTAGEN /note="P->I,D: Reduces cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular"
356V----
VLS
MUTAGEN /note="V->E,G: Abolishes cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" MUTAGEN /note="V->E,G: Abolishes cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular"
357Q----
QDL
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
358D----
DHQEG
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" D->A:(0.0 %):Polymorphism - dbSNP:rs2228145
359S----
SPR
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
360S----
SDA
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
361S----
SP
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
362V----
VRIM
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
363P----
PES
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
364L----
LQ
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
365P----
PV
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
366T----
TAL
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
367F----
FEV
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
368L----
LQ
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
369V----
V
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
370A----
AS
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
371G----
GLV
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
372G----
GA
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
373S----
SI
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
374L----
L
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
375A----
AGS
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
376F----
FI
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
377G----
GFL
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
378T----
TLGS
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
379L----
LC
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
380L----
LV
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
381C----
CAG
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
382I----
IVGL
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
383A----
AFG
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
384I----
ILV
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
385V----
IAGV
TRANSMEM /note="Helical" TRANSMEM /note="Helical" V->I:(43.0 %):Polymorphism - dbSNP:rs2228146
386L----
LA
TRANSMEM /note="Helical" TRANSMEM /note="Helical"
387R----
RGL
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
388F----
LFA
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
389K----
KLAGSDEFINPQRTVY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
390K----
KGQALSDEFINPRTVY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
391T----
TKLAGSDEFINPQRVY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
392W----
WG
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
393K----
KQLAEGSVDFINPRTCHMWY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
394L----
LS
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
395R----
RQE
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
396A----
AL
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
397L----
RLE
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
398K----
KR
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
399E----
EGS
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
400G----
GS
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
401K----
K
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
402T----
TD
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
403S----
GTNS
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
404M----
PSM
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
405H----
PHQ
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
406P----
PK
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
407P----
P
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
408Y----
YG
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
409S----
SFLP
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
410L----
L
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
411G----
GA
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
412Q----
PQS
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
413L----
LMV
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
414V----
IVLADEGKSTCFHMNPQRY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
415P----
PLADEGKSTVCFHIMNQRY
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
416E----
EAGLDKPSTVFINQRYCHMW
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
417R----
RAGLDEKPSTVFINQYCHMW
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
418P----
PAGLDEKSTVFINQRYCHMW
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
419R----
KR
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
420P----
PS
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
421T----
T
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
422P----
PF
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
423V----
VL
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
424L----
L
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
425V----
V
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
426P----
P
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
427L----
L
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
428I----
IL
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
429S----
STAEGLVDFHIKMNPQRY
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
430P----
PAEGLSVDFHIKMNQRTY
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
431P----
PSAEGLVDFHIKMNQRTY
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
432V----
VGAELSDFHIKMNPQRTY
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
433S----
ST
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
434P----
PH
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
435S----
NSH
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
436S----
S
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
437L----
LS
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
438G----
G
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
439S----
STAEGLVDFHIKMNPQRY
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
440D----
D
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
441N----
N
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
442T----
T
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
443S----
SGV
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
444S----
SRN
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
445H----
HN
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
446N----
SN
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
447R----
RC
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
448P----
PL
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
449D----
GDE
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
450A----
AV
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
451R----
R
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
452D----
DG
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
453P----
PA
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
454R----
QR
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
455S----
SC
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
456P----
P
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
457Y----
YN
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
458D----
D
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
459I----
NIV
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
460S----
S
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
461N----
N
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
462T----
RT
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
463D----
D
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
464Y----
Y
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
465F----
FL
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
466F----
F
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
467P----
P
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
468R----
R
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"