[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36204 212 17 P05231(IL6_HUMAN) RecName: Full=Interleukin-6 {ECO:0000305}; Short=IL-6;AltName: Full=B-cell stimulatory factor 2; Short=BSF-2;AltName: Full=CTL differentiation factor; Short=CDF;AltName: Full=Hybridoma growth factor;AltName: Full=Interferon beta-2; Short=IFN-beta-2;Flags: Precursor;
QUERYSEQ
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
2N----
NKT
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
3S----
SF
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
4F----
LFRV
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
5S----
SFADEGIKLPRTV
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
6T----
TA
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
7S----
SR
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
8A----
ADT
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
9F----
FLV
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
10G----
SGTHQRADEIKLPV
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
11P----
PADEGIKLRSTV
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
12V----
VLFI
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
13A----
AG
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
14F----
FVC
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
15S----
SLADEFGIKNPQRTVY
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
16L----
L
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
17G----
GA
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
18L----
L
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
19L----
LM
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
20L----
L
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
21V----
VL
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
22L----
MTVL
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
23P----
ATP
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
24A----
TAS
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
25A----
A
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
26F----
F
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
27P----
P
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
28A e 64.8 2l3y_A
TAS
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" DISORDER predicted by DISOPRED SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
29P e 75.0 2l3y_A
PSQ
SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116" SIGNAL ECO:0000269|PubMed:2610854, ECO:0000269|PubMed:3279116"
30V e114.7 2l3y_A
GVEAQL
31P e 25.7 2l3y_A
PLRVT
32P e 42.3 2l3y_A
LRVPQ
DISORDER predicted by DISOPRED P->S:(0.0 %):Polymorphism - dbSNP:rs2069830
33G e 61.9 2l3y_A
GRAE
DISORDER predicted by DISOPRED
34E e 53.7 2l3y_A
EGD
DISORDER predicted by DISOPRED
35D e 75.1 2l3y_A
DVFE
DISORDER predicted by DISOPRED
36S e 48.1 2l3y_A
SFGTEA
DISORDER predicted by DISOPRED
37K e 68.8 2l3y_A
KELTNQ
DISORDER predicted by DISOPRED
38D e 63.6 2l3y_A
DENTAG
DISORDER predicted by DISOPRED
39V----
DSEVKTG
DISORDER predicted by DISOPRED
40A e 92.2 2l3y_A
ATEVN
DISORDER predicted by DISOPRED
41A e 61.0 2l3y_A
TASGL
DISORDER predicted by DISOPRED
42P e138.0 4cni_D nucleotide
PSGRAL
DISORDER predicted by DISOPRED
43H e105.2 4cni_D
NDHAGLS
DISORDER predicted by DISOPRED
44R e 43.1 4cni_D nucleotide
RKNS
45Q e 81.6 4cni_D precipitant
LRPQTMADEFGIKNSVY
46P e 92.2 4cni_D precipitant
PLATYDEFGIKNQRSV
47L e 48.3 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU IL6RB_HUMAN nucleotide precipitant
LVFR
48T e 50.0 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU
TYLA
49SHe 60.9 4cni_D hetero
STDP
50SHe 36.7 4cni_D hetero
PTASC
51EHe 47.2 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU
EDGSN
52RHe 46.2 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU IL6RB_HUMAN nucleotide precipitant
KRQP
53IHb 2.3 4cni_D
TVMILS
54DHb 14.2 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU homo
EGADIRK
55KHe 58.5 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide
EQRAGKD
56QHb 16.3 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide
LRHQVFS
57IHb 0.6 4cni_D
IL
58RHe 43.1 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN A4L9V2_LISMN Q4G1L3_EPTBU nucleotide homo
RKNTSW
59YHe 52.6 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide
YKWHSFRAGL
60IHb 0.0 4cni_D
IMVLAGS
61LHb 14.6 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN nucleotide homo
LRVIAGS
62DHe 70.4 4cni_D hetero IL6RB_HUMAN nucleotide
GDWEKR
63GHb 3.6 4cni_D
KEDVRGT
64IHb 2.9 4cni_D
IVA
65SHe 54.7 4cni_D hetero
SAVDFKL
66AHe 37.5 4cni_D
AEQ
67LHb 1.1 4cni_D
LMCI
68RHe 45.5 4cni_D hetero precipitant
RQFK
69KHe 62.3 4cni_D
KRDN
70EHb 14.6 4cni_D
EAD
71THb 8.4 4cni_D
MLVIT
72CHb 9.3 4cni_D hetero IL6RB_HUMAN
C
DISULFID DISULFID
73NTe 63.0 4cni_D hetero IL6RB_HUMAN
DENKY
CARBOHYD /note="N-linked (GlcNAc...) asparagine" CARBOHYD /note="N-linked (GlcNAc...) asparagine"
74KSe 48.6 4cni_D hetero IL6RB_HUMAN
KRTNGH
75STe 64.1 4cni_D hetero IL6RB_HUMAN
FYNDTS
76NTe 21.2 4cni_D hetero IL6RB_HUMAN
NDSQGETV
77MTe 54.6 4cni_D hetero IL6RB_HUMAN
KLIDMEVNT
78CTb 10.7 4cni_D precipitant
C
DISULFID DISULFID
79E e 40.2 4cni_D homo precipitant
EMTKI
80S e 47.7 4cni_D
NDEGSK
81STe 78.1 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN
SEIRN
MOD_RES /note="Phosphoserine; by FAM20C" MOD_RES /note="Phosphoserine; by FAM20C"
82KTe 56.6 4cni_D hetero IL6RA_HUMAN IL6RB_HUMAN D6R9R8_HUMAN
KELDMH
83ETb 4.0 4cni_D hetero IL6RB_HUMAN
ELDV
84AHe 65.2 4cni_D hetero IL6RB_HUMAN
AQPMTV
85LHe 56.7 4cni_D hetero IL6RB_HUMAN
LAV
86AHb 0.0 4cni_D hetero IL6RB_HUMAN D6R9R8_HUMAN IL6RA_HUMAN
AVS
87EHe 48.2 4cni_D hetero IL6RB_HUMAN D6R9R8_HUMAN IL6RA_HUMAN
EQIR
88NTe 86.1 4cni_D hetero IL6RB_HUMAN D6R9R8_HUMAN IL6RA_HUMAN
NDFPV
89NTe 40.6 4cni_D hetero IL6RB_HUMAN
NDHRK
90L b 6.2 4cni_D hetero IL6RB_HUMAN
LPY
91N e 87.9 4cni_D
NKHR
92L b 15.7 4cni_D
LI
93P b 4.7 4cni_D
PV
94K e 68.9 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN
KAQSER
95M b 12.1 4cni_D hetero
LMIVADEGKNPRST
96A e 25.9 4cni_D
ATNPEQI
97EGe 62.8 4cni_D hetero IL6RA_HUMAN
EADPRG
98KGe 87.7 4cni_D
KELTN
99DGb 12.3 4cni_D
DAEGIKLPRSTV
100GTb 3.6 4cni_D
GQHKADEILPRSTV
101C b 3.3 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN
C
DISULFID DISULFID
102FSe 37.3 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN precipitant
FPGHLY
103QSe 84.2 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN homo precipitant
QLKYSP
104STe 65.6 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN homo
STAIRP
105GTe 64.3 4cni_D
GNAQ
106F e 24.9 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN
FYSV
107N e 45.5 4cni_D
NQGSD
108EHe 48.7 4cni_D hetero
QEKANR
109EHe 81.4 4cni_D
EDTA
110THe 40.9 4cni_D
TAISVKD
111CHb 0.0 4cni_D
C
DISULFID DISULFID
112LHb 6.7 4cni_D
LFM
113VHe 28.0 4cni_D
TLQMKVIR
114KHe 21.7 4cni_D
RKQE
115IHb 0.6 4cni_D
ILT
116IHb 0.0 4cni_D
TSARLIC
117THb 7.8 4cni_D
TSAEDRI
118GHb 0.0 4cni_D
G
119LHb 0.0 4cni_D
LF
120LHb 12.4 4cni_D
LHQFMVS
121EHe 32.7 4cni_D
EAITV
122FHb 0.0 4cni_D
FY
123EHe 20.6 4cni_D
QEHRMS
124VHb 8.7 4cni_D
VILDMTFS
125YHb 4.3 4cni_D
YLHS
126LHb 0.6 4cni_D
LF
127EHe 38.2 4cni_D homo
KEDGQRN
128YHb 0.9 4cni_D
YFHARI
129LHb 1.7 4cni_D
LVIM
130QHb 3.6 4cni_D homo
QEKLTR
131NHe 55.2 4cni_D hetero homo
NAEKRTD
132RHe 40.7 4cni_D hetero
ENKLRTY
133F b 2.4 4cni_D
FYL
134ESe 57.8 4cni_D hetero
EPDGRQK
135SSe 82.8 4cni_D nucleotide
SGNKQE
136S e 23.4 4cni_D nucleotide
SDNHKEG
137EHe 45.7 4cni_D nucleotide homo
KTSEVQN
138EHe 84.4 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide homo
EINTDGQALS
139QHe 31.1 4cni_D nucleotide
NLKQRTADS
140AHb 0.9 4cni_D
VALSTID
141RHe 41.9 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide homo
ERHDKPMGN
142AHb 11.6 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide
ASVTEDGL
143VHb 2.7 4cni_D
VLMIA
144QHb 12.2 4cni_D homo
QRYETCLH
145MHe 48.3 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide homo
ILSYMKFHRT
146SHb 1.6 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU nucleotide
SDNLHQY
147THb 0.0 4cni_D
TSIA
148KHe 47.6 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU homo
KNAEGRTQ
149VHe 34.7 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide homo
TAVHINGL
150LHb 0.0 4cni_D
L
151IHb 1.2 4cni_D
IVAGSL
152QHe 60.7 4cni_D hetero IL6RB_HUMAN Q4G1L3_EPTBU A4L9V2_LISMN nucleotide homo
QGKHSWAE
153FHe 21.1 4cni_D hetero A4L9V2_LISMN Q4G1L3_EPTBU IL6RB_HUMAN nucleotide homo
ILTDNMEFKS
154LHb 0.0 4cni_D
LIFV
155QHe 20.9 4cni_D homo
KQREMN
156KHe 61.8 4cni_D nucleotide homo
QEDKNRPS
157KHe 29.2 4cni_D hetero
KEQMR
158AHb 19.6 4cni_D homo
VMILAGP
159K e 39.2 4cni_D homo
KRENAIM
160N e 61.8 4cni_D
NDKVGQS
161L e 40.4 4cni_D homo
LPQRAS
162DTe 91.4 4cni_D homo
DGENTVHYS
D->V:(5.0 %):Polymorphism - dbSNP:rs2069860;D->E:(13.0 %):Polymorphism - dbSNP:rs13306435
163ATe 58.9 4cni_D homo
EKQLAV
164I b 11.1 4cni_D homo
VIDTEA
165T e 59.7 4cni_D
TVHAEMS
166T e 74.0 4cni_D homo
TVLYIDRF
167P e 24.8 4cni_D
PLSTA
168D e 48.1 4cni_D homo
DTSLPNKEVA
169PHe 76.0 4cni_D homo
PSA
170THe 64.9 4cni_D homo
TASKIR
171THe 58.4 4cni_D
TEQAFSV
172NHe 23.6 4cni_D
NDEQRAGK
173AHe 50.0 4cni_D
ARKSTVEQI
MUTAGEN /note="A->V: Almost no loss of activity." MUTAGEN /note="A->V: Almost no loss of activity."
174SHe 59.4 4cni_D
SGQLDRN
175LHb 18.5 4cni_D
LPVM
176LHb 15.7 4cni_D
LMQPT
177THe 61.0 4cni_D
AGEPKQTDN
178KHe 30.2 4cni_D hetero IL6RB_HUMAN
KDNRTEIL
179LHb 1.1 4cni_D hetero IL6RB_HUMAN
LFMTV
180QHe 37.2 4cni_D hetero
QSDEKH
181AHe 75.9 4cni_D hetero
SGATNYQ
182QSb 15.3 4cni_D hetero IL6RB_HUMAN
QPLGSDKE
183N e 53.9 4cni_D hetero IL6RB_HUMAN precipitant
NKDFSTE
184QHe 86.7 4cni_D hetero IL6RB_HUMAN precipitant
EQTDYK
185WHe 39.8 4cni_D hetero IL6RB_HUMAN
WFCAEGKLSTV
MUTAGEN /note="W->R: No loss of activity." MUTAGEN /note="W->R: No loss of activity."
186LHb 19.1 4cni_D hetero IL6RB_HUMAN
LVHMEIQAGKST
187QHb 14.3 4cni_D hetero
RKQE
188DHb 14.2 4cni_D hetero
KHNTQDVG
189MHb 0.0 4cni_D hetero IL6RB_HUMAN
TMVFKAI
190THb 0.0 4cni_D
TKAGS
191THb 2.6 4cni_D
IAMVTGS
192HHb 9.9 4cni_D hetero precipitant
HFIQ
193LHb 1.1 4cni_D
LFYAGNI
194IHb 0.0 4cni_D
IVT
195LHb 1.7 4cni_D
L
196RHe 31.2 4cni_D hetero precipitant
RSAKY
197SHb 10.9 4cni_D
SNAEQDGR
198FHb 0.5 4cni_D
LFM
199KHe 30.7 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN nucleotide homo precipitant
EHTQKR
200EHe 42.2 4cni_D hetero D6R9R8_HUMAN IL6RA_HUMAN
NDEKRYS
201FHb 1.9 4cni_D
F
202LHb 0.0 4cni_D
LAM
203QHe 34.2 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN nucleotide homo precipitant
QEVGKR
204SHb 17.2 4cni_D hetero
FDQTVNKSC
MUTAGEN /note="S->P: 87% loss of activity." MUTAGEN /note="S->P: 87% loss of activity."
205SHb 1.6 4cni_D
STACG
206LHb 11.2 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN nucleotide homo precipitant
LKVYRM
207RHe 59.7 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN nucleotide homo precipitant
RV
208AHb 0.0 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN
AVS
209LHb 7.9 4cni_D
LIVT
210RTe 60.9 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN A4L9V2_LISMN Q4G1L3_EPTBU nucleotide homo precipitant
RND
MUTAGEN /note="R->K,E,Q,T,A,P: Loss of activity." MUTAGEN /note="R->K,E,Q,T,A,P: Loss of activity."
211QTe 44.4 4cni_D hetero IL6RA_HUMAN D6R9R8_HUMAN
IKQHSRLY
212M b 17.9 4cni_D hetero
MLI
MUTAGEN /note="M->T,N,S,R: Loss of activity." MUTAGEN /note="M->T,N,S,R: Loss of activity."