#WARNING:no index is registered index 'YP_009724392.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57600 75 11 YP_009724392.1()
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
2Y----
LY
3S----
PS
4F----
F
5V----
V
6S----
QSH
7E----
E
8E e 84.9 2mm4_A homo
QEDR
9T e108.4 2mm4_A
TI
10GSe 58.3 2mm4_A
GA
11T e 23.4 2mm4_A homo
TWAL
12L e 99.4 2mm4_A homo
FLYI
13ISe 88.9 2mm4_A
IV
14VHe 50.7 2mm4_A homo
VG
15NHe 67.3 2mm4_A homo
NQ
16SHe 44.5 2mm4_A homo
FSI
17VHe 54.7 2mm4_A homo
FV
18LHe 86.0 2mm4_A homo
ILF
19LHe 74.7 2mm4_A homo
LF
20FHe 58.4 2mm4_A homo
TFVS
21LHe 68.0 2mm4_A homo
LV
22AHe 36.6 2mm4_A homo
VAS
23FHe 36.8 2mm4_A homo
CF
24VHe 36.7 2mm4_A homo
VA
25VHe 62.7 2mm4_A homo
IV
26FHe 61.7 2mm4_A homo
FT
27LHe 53.9 2mm4_A homo
L
28LHe 69.1 2mm4_A homo
LIV
29VHe 83.3 2mm4_A homo
VF
30THe 43.5 2mm4_A
CTV
31LHe 66.9 2mm4_A homo
LVM
32AHe 57.1 2mm4_A
A
33IHe 77.2 2mm4_A homo
ILFV
34LHe 52.8 2mm4_A
L
35THe 34.4 2mm4_A
TA
36AHe 47.3 2mm4_A
AT
37LHe 82.6 2mm4_A
ILT
38RHe 58.9 2mm4_A
RK
39LHe 28.1 2mm4_A
L
40CHe 41.1 2mm4_A
C
41AHe 60.7 2mm4_A
VAI
42YHe 37.4 2mm4_A
QY
43CTe 36.6 2mm4_A
CI
44CTe 87.5 2mm4_A
CMVA
45NTe 84.8 2mm4_A
SNGT
46ISe 92.4 2mm4_A
GIF
47V e 61.3 2mm4_A homo
CVF
48NSe 70.3 2mm4_A homo
NH
49V e 58.0 2mm4_A homo
TVI
50S b 3.9 2mm4_A
LSF
51L e 78.1 2mm4_A
LIV
52VSe 76.0 2mm4_A
VFI
53KSe 62.7 2mm4_A
KSLQV
54PTe 52.7 2mm4_A
P
55STb 17.5 2mm4_A
AST
56FHe 66.7 2mm4_A
VFAL
57YHe 53.0 2mm4_A homo
YH
58VHe 52.0 2mm4_A
VIL
59YHe 73.5 2mm4_A
Y
60SHe 45.3 2mm4_A homo
NS
61RHe 74.7 2mm4_A homo
RT
62VHe 78.0 2mm4_A
GV
63KHe 73.1 2mm4_A homo
RK
64NHe 78.2 2mm4_A homo
NQS
65L e119.7 2mm4_A homo
LF
66N----
QNY
67S----
SKDE
68S----
SN
69R----
RKE
70V----
PV
71P----
P
72D----
D
73L----
L
74L----
L
75V----
V