#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
36451 4405 500 YP_009725295.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
DISORDER predicted by DISOPRED
2E----
E
DISORDER predicted by DISOPRED
3S----
SP
DISORDER predicted by DISOPRED
4L----
LK
DISORDER predicted by DISOPRED
5V----
VA
DISORDER predicted by DISOPRED
6P----
LKP
DISORDER predicted by DISOPRED
7G----
G
DISORDER predicted by DISOPRED
8F----
YVKF
DISORDER predicted by DISOPRED
9N----
NTS
DISORDER predicted by DISOPRED
10E----
EL
DISORDER predicted by DISOPRED
11K----
KV
DISORDER predicted by DISOPRED
12T----
TRN
DISORDER predicted by DISOPRED
13H----
H
DISORDER predicted by DISOPRED
14V----
V
DISORDER predicted by DISOPRED
15Q----
QARS
DISORDER predicted by DISOPRED
16L----
LCV
DISORDER predicted by DISOPRED
17S----
STDK
DISORDER predicted by DISOPRED
18L----
LVA
19P----
PS
20V----
LVA
21L----
LC
22Q----
DQE
23V----
VTIA
24R----
RGDE
25D----
D
26V----
VMIL
27L----
LFV
28V----
VTL
29R----
RPTKLADEFGINQSVY
30G----
GWLADEFIKNPQRSTVY
31F----
FWLADEGIKNPQRSTVY
32G----
DGEM
33D----
DEI
34S----
GSDP
35V----
VPIALDEGKRSTCFHMNQY
36E----
EQ
37E----
EKTS
38V----
AV
39L----
LEFY
40S----
ASNEK
41E----
EQSYH
42A----
AVT
43R----
SRMK
44Q----
EQMS
45H----
QHAI
46L----
L
47K----
KQRS
48D----
NEFTKD
49G----
GP
50T----
STKE
51C----
CAIPK
52G----
LGVQ
53L----
LF
54V----
VF
55E----
EKPFQ
56V----
VLMPT
57E----
EHSPL
58K----
KQY
59G----
GRY
60V----
VALF
61L----
LMAI
62P----
PKR
63Q----
QFKGH
64L----
LTI
65E----
PES
66Q----
GQA
67P----
PMD
68Y----
RYG
69V----
VL
70F----
FYV
71I----
ILKR
72K----
RVKT
73R----
REDF
74S----
SRC
75D----
LDIT
76A----
TAWCG
77R----
GRYNLQ
78T----
GTACS
79A----
TAMR
80P----
NLEVYP
81H----
SHFDN
82G----
GKAD
83H----
HQPY
84V----
VFKP
85M----
AMVLI
86V----
VRFY
87E----
EQN
88L----
LQ
89V----
LVAMT
90A----
AMIV
91E----
DYEQ
92L----
KPLQM
93E----
DANE
94G----
GAHQ
95I----
VIA
96Q----
CGQR
97Y----
YFALE
98G----
GA
99R----
RMVLADEGIKPSTCFHNQY
100S----
SNGAIM
101G----
GAR
102E----
TKQRIEADFGLNPSV
103T----
TFP
104L----
LIHV
105G----
G
106V----
VMW
107L----
FLV
108V----
VFLI
109P----
P
110H----
YHMFAEGKLSTVCDINPQR
111V----
VDML
112G----
GASTI
113E----
EDAFS
114I----
ILTM
115P----
PVDE
116V----
TIVE
117A----
GQAY
118Y----
EYIASK
119R----
RKQFHY
120K----
KNQT
121V----
FIVY
122L----
LIADEFGKNPQRSTV
123L----
LADEFGIKNPQRSTV
124R----
RADEFGIKLNPQSTV
125K----
KADEFGILNPQRSTV
126N----
NGCYAELSVDFHIKMPQRT
127G----
GAELSVDFHIKMNPQRTY
128N----
NLERAGSVDFHIKMPQTY
129K----
KGAELSVDFHIMNPQRTY
130G----
GADEIKLPRSTV
131A----
AIQSFDEGKLPRTV
132G----
GL
133G----
GAFH
134H----
FNHRY
135S----
SERH
136Y----
RYFPH
137G----
PGAVTR
138A----
IDVWYPAEGKLRST
139D----
DVNTAGLEFIKPQRSY
140L----
LRFMAGDEIKNPQSTVY
141K----
KPFADEGILRSTV
142S----
VSLEHADGIKPRT
143F----
YVWEFADGIKLPRST
144D----
DE
145L----
ALGFIR
146G----
GFLNYDP
147D----
DVSNW
148E----
DELT
149L----
LPVSYADEFGIKNQRT
150G----
GEHCNADFIKLPQRSTV
151T----
PTADWEFGIKLNQRSV
152D----
DET
153P----
PAW
154Y----
YICKTM
155E----
EGLDS
156D----
DKE
157F----
FYVL
158Q----
SEPHMQ
159E----
QDKLAE
160N----
NKDA
161W----
PWCLAEGKSTVDFHIMNQRY
162N----
NPREKLAGSTVCDFHIMQY
163T----
TGALEKSVCDFHIMNPQRY
164K----
KDLAEGSTVCFHIMNPQRY
165H----
PYHLAEGKSTVCDFIMNQR
166S----
SGKACLETVDFHIMNPQRY
167S----
SAGCLDEIKNPQRTVFHMWY
168G----
KGALSDEINPQRTVCFHMWY
169V----
RAVYLGSDEIKPTFNQCHMW
170T----
ALGSTEVDFHIKMNPQRY
171R----
YRQGADEFIKLNPSTV
172E----
AEDNSFGIKLPQRTV
173L----
LV
174M----
LIYTM
175R----
RKL
176E----
KGES
177L----
LYD
178N----
RINQV
179G----
GY
180G----
GV
181A----
DKAVEFGILNPQRST
182Y----
PVFCYADEGIKLNQRST
183T----
TILADEFGKNPQRSV
184R----
PLRADEFGIKNQSTV
185Y----
YFAGLSDEIKPRTVNQCHMW
186V----
VIF
187D----
D
188N----
QN
189N----
YN
190F----
MGFADEIKLNPQRSTV
191C----
CADEFGIKLNPQRSTV
192G----
GDAEFIKLNPQRSTV
193P----
KPAYVDEFGILNQRST
194D----
DNTAEFGIKLPQRSV
195G----
G
196Y----
KYIAEGLSTVCDFHMNPQR
197P----
PLAEGKSTVCDFHIMNQRY
198L----
LIVADEFGKNPQRST
199E----
EASDFGIKLNPQRTV
200C----
CAPDE
201I----
YIVLF
202K----
AKM
203D----
KDFA
204L----
LGIKF
205L----
LMTV
206A----
AGEL
207R----
KRVDQS
208A----
EAIYD
209G----
GMADEFIKLNPQRSTV
210K----
KDL
211A----
SLATV
212S----
MDLAESGKTVCFHINPQRY
213C----
FCADLEGKSTVHIMNPQRY
214T----
TPDV
215L----
LIVE
216S----
SAE
217E----
EQDA
218Q----
EQLMRV
219L----
LKVA
220D----
DAEPS
221F----
FYALVRDEGIKPST
222I----
ILMSTAEGVDFHKNPQRY
223D----
DEPLAGSVFIKNQRTCHMWY
224T----
SVTLAGDEFIKNPQRCHMWY
225K----
DKWLAEGSTVCFHIMNPQRY
226R----
RELADGKSTVCFHIMNPQY
227G----
GFDYAEIKLNPQRSTV
228V----
IVKSFADEGLNPQRT
229Y----
YLIAGSDEKNPQRTVCFHMW
230C----
VCTLAEGSDFIKNPQRHMWY
231C----
LCFAEGSVDIKNPQRTHMWY
232R----
RKNLAEGSVDFIPQTCHMWY
233E----
NDEKLAGSTVCFHIMPQRY
234H----
KNHLADEGSTVCFIMPQRY
235E----
ELDAFGIKNPQRSTV
236H----
YVHADEFGIKLNPQRST
237E----
RETVADFGIKLNPQS
238I----
VILADEFGKNPQRST
239A----
VADEFGIKLNPQRST
240W----
WADEFGIKLNPQRSTV
241Y----
HNFYADEGIKLPQRSTV
242T----
VTADEFGIKLNPQRS
243E----
ETVDQAFGIKLNPRS
244R----
R
245S----
DSKTR
246E----
EPDN
247K----
VRKD
248S----
PASGV
249Y----
YM
250E----
REPSD
251L----
LKHR
252Q----
QP
253T----
TSD
254P----
APGLI
255F----
FYAS
256E----
TEA
257I----
IVM
258K----
KRNV
259L----
SVL
260A----
VIAG
261K----
VKRAEI
262K----
KQY
263F----
VFCKL
264D----
DG
265T----
TVDLMG
266F----
VFTCMADEGIKLNPQRS
267N----
EKDN
268G----
GQNDEAIKLPRSTV
269E----
SDELT
270C----
VCP
271P----
P
272N----
KGAEVHRN
273F----
HYF
274V----
VLTYSADEGIKPR
275F----
FYL
276P----
PTA
277L----
LIFDP
278N----
NGSD
279S----
SAC
280I----
IKVQE
281I----
IV
282K----
KLEQADFGINPRSTV
283T----
VTHMRADEFGIKLNPQS
284I----
ILTVADEFGKNPQRS
285Q----
QKSATEGLVCDFHIMNPRY
286P----
PADEFGIKLNQRSTV
287R----
RTSAGLDEFIKNPQVY
288V----
LVTR
289E----
EKGRVAN
290K----
QKGEVAN
291K----
KTPHQ
292K----
NKVMLA
293L----
LNTGF
294D----
KEVGYNDAFILPQRST
295G----
TGDHLNAEFIKPQRSV
296F----
FVILKADEGNPQRST
297M----
MNEYQADFGIKLPRSTV
298G----
GALRDEFIKNPQSTV
299R----
KVRLADEFGINPQST
300I----
IQMVLAEGSDFHKNPRTY
301R----
RLNHAEGSVDFIKMPQTY
302S----
SLATEGVDFHIKMNPQRY
303V----
LVFAEGSDHIKMNPQRTY
304Y----
YADEGIKLPRSTV
305P----
PGTAELSVDFHIKMNQRY
306V----
VFDKAEGLSHIMNPQRTY
307A----
AESQYLDGKTVCFHIMNPR
308S----
SGADT
309P----
VLPTK
310N----
QNKTESD
311E----
ENDAQ
312C----
CPYVADEFGIKLNQRST
313N----
NGTQADEFIKLPRSV
314Q----
YPFQDNAEGIKLRSTV
315M----
IMAFV
316C----
YCHTM
317L----
HLPQY
318S----
SVFK
319T----
ATG
320L----
YLRKF
321M----
LIVM
322K----
DKEAFGILNPQRSTV
323C----
C
324D----
DNSGT
325H----
HSALYDEFGIKNPQRTV
326C----
C
327G----
GD
328E----
FEYRNK
329T----
GVYIKDT
330S----
SGT
331W----
WADEFGIKLNPQRSTV
332Q----
QLTCV
333T----
TPF
334G----
GCL
335D----
NDKAEFGILPQRSTV
336F----
AFDMY
337V----
IVL
338K----
QDKG
339A----
GATC
340T----
FTVAC
341C----
CANG
342E----
CEDT
343F----
TDLGQFH
344C----
C
345G----
G
346T----
ATFH
347E----
ENRVSH
348N----
YNQADEFGIKLPRSTV
349L----
LESTCADFGIKNPQRV
350T----
ATVDEFGIKLNPQRS
351K----
NGCKILADESTVFHMPQRY
352E----
DELAGKSTVCFHIMNPQRY
353G----
DGLEAKSTVCFHIMNPQRY
354A----
LAPVDEGKSTCFHIMNQRY
355T----
QTSADEFGIKLNPRV
356T----
STADEFGIKLNPQRV
357C----
SCADEFGIKLNPQRTV
358G----
GV
359Y----
LYDVWM
360L----
VLAI
361P----
PEKR
362Q----
KSGVPTQRA
363N----
NA
364A----
AGMP
365V----
VLM
366V----
LVIDF
367K----
KLGHC
368I----
ATMFIDEGKLNPQRSV
369Y----
PTNKYADEFGILQRSV
370C----
CSADEFGIKLNPQRTV
371P----
PA
372A----
AGCF
373C----
CAGN
374H----
QKNYHADEFGILPRSTV
375N----
DGNSAEFIKLPQRTV
376S----
GSPDAEFIKLNQRTV
377E----
EAGSLDKTVCFHIMNPQRY
378V----
CVFIADEGKLNPQRST
379G----
GISLAVDEFKNPQRTCHMWY
380P----
PCSLAGVDEFIKNQRTHMWY
381E----
EKSADFGILNPQRTV
382H----
HGDAEFIKLNPQRSTV
383S----
SGTNADEFIKLPQRV
384L----
VLAF
385A----
ATMP
386E----
QLDE
387Y----
YLSV
388H----
HDYTLVAEFGIKNPQRS
389N----
NSKDAEFGILPQRTV
390E----
EHSITMADFGKLNPQRV
391S----
SLPVRMADEFGIKNQT
392G----
NGDTAELSVFHIKMPQRY
393L----
IGMRCDLAEFKNPQSTV
394K----
KERNADFGILPQSTV
395T----
TLASVCDEFGIKNPQR
396I----
IRCFDAEGKLNPQSTV
397L----
LVKADEGSTCFHIMNPQRY
398R----
ERLDAGKSTVCFHIMNPQY
399K----
VKPYSADEFGILNQRT
400G----
GKV
401G----
GNHQS
402R----
RKATF
403T----
TV
404I----
VLKIR
405A----
TCSPYIA
406F----
FY
407G----
G
408G----
G
409C----
CVA
410V----
VIA
411F----
YFW
412S----
ASPDEFGIKLNQRTV
413Y----
YPW
414V----
MVIPSF
415G----
GP
416C----
CKADEFGILNPQRSTV
417H----
YVCRESHADFGIKLNPQT
418N----
NDEGAFIKLPQRSTV
419K----
GKAELSTVCDFHIMNPQRY
420C----
TRVCAEGKLSDFHIMNPQY
421A----
MATEGKLSVCDFHINPQRY
422Y----
YVIMH
423W----
WF
424V----
VIL
425P----
P
426R----
RIV
427A----
AIL
428S----
KSYW
429A----
SA
430N----
SNICVKD
431I----
VI
432G----
GSAK
433C----
ASGLRCDEFIKNPQTV
434N----
IERTVNGS
435H----
HYIGF
436T----
TSGD
437G----
GDS
438V----
VAIC
439V----
VTIF
440G----
GFADEIKLPRSTV
441E----
TSCKED
442G----
GNAKW
443S----
CSVTAI
444E----
VTEIK
445G----
GVTAQ
446L----
LIEKTSC
447N----
NWET
448D----
DTEKN
449N----
KANDE
450L----
LVIN
451L----
VLCITM
452E----
EKRQADGILPSTV
453I----
FIYA
454L----
L
455Q----
EYINQS
456K----
RKELMQ
457E----
DAETFGIKLNPQRSV
458K----
QYRKADEFGILNPSTV
459V----
VHRADEFGIKLNPQST
460N----
QSNGA
461I----
ILAEGKSTVCDFHMNPQRY
462N----
NHR
463I----
FKIV
464V----
VCD
465G----
GAQN
466D----
DNEQ
467F----
FLT
468K----
HVLAKRDEFGINPQST
469L----
LDQVFAEGIKNPRST
470N----
NTRADEFGIKLPQSV
471E----
EPD
472E----
TELQVADFGIKNPRS
473I----
VCLRIADEFGKNPQST
474A----
AGLVDEFIKNPQRST
475I----
IVAT
476I----
ILFVADEGKNPQRST
477L----
LIAEGKSTVCDFHMNPQRY
478A----
ASEGKLTVCDFHIMNPQRY
479S----
SGINAEKLTVCDFHMPQRY
480F----
LFTAEGKSVCDHIMNPQRY
481S----
STDAEGKLVCFHIMNPQRY
482A----
AGCSTEKLVDFHIMNPQRY
483S----
SDTNAEGKLVCFHIMPQRY
484T----
TVIPAEGKLSCDFHMNQRY
485S----
SKDECAFGILNPQRTV
486A----
ATDEKFGILNPQRSV
487F----
FTVILADEGKNPQRS
488V----
VREWIADFGKLNPQST
489E----
EDHQAFGIKLNPRSTV
490T----
LTSKADEFGINPQRV
491V----
LVRQCIADEFGKNPST
492K----
KDLQRAEFGINPSTV
493G----
GLNS
494L----
LCVA
495D----
DTHNAEFGIKLPQRSV
496Y----
YNDRLFAEGIKPQSTV
497K----
KAGVDEFILNPQRST
498A----
SKVYATDEFGILNPQR
499F----
YFHLVADEGIKNPQRST
500K----
KREADFGILNPQSTV
501Q----
DQKPTVAEFGILNRS
502I----
LIYVADEFGKNPQRST
503V----
LVRADEFGIKNPQST
504E----
EDVATFGIKLNPQRS
505S----
NSHDPAEFGIKLQRTV
506C----
CRILY
507G----
GLVDAEIKPRST
508N----
NDAYEGIKLPRSTV
509F----
FYNVW
510K----
KNSVAI
511V----
VILM
512T----
TMRADEFGIKLNPQSV
513K----
RLIKAMNDEFGPQSTV
514G----
GADEFIKLNPQRSTV
515K----
KDPSRAEFGILNQTV
516A----
FYKAPDEGILNQRSTV
517K----
IPSKVMADEFGLNQRT
518K----
KLRDETAGSVCFHIMNPQY
519G----
GDENLAKSTVCFHIMPQRY
520A----
ATVLDEGKSCFHIMNPQRY
521W----
IWLFADEGKNPQRSTV
522N----
NPTADEFGIKLQRSV
523I----
IVTADEFGKLNPQRS
524G----
GDAEFIKLNPQRSTV
525E----
QAEFDGIKLNPRSTV
526Q----
QFNMAYEDGIKLPRSTV
527K----
AHPKRGDEFILNQSTV
528S----
SPTFAVDEGIKLNQR
529I----
ILFCV
530L----
LNIT
531S----
ATVDES
532P----
PGDNA
533L----
LFVY
534Y----
VIDYCNAEFGKLPQRST
535A----
AGLV
536F----
FYL
537A----
TPHCVKA
538S----
GKSVD
539E----
EQRYV
540A----
ASRDEFGIKLNPQTV
541A----
AFDEGIKLNPQRSTV
542R----
KGCTRADEFILNPQSV
543V----
KVWIPADEFGLNQRST
544V----
VIYCWADEFGKLNPQRST
545R----
RAGHKS
546S----
AST
547I----
ILEVS
548F----
FAIVPL
549S----
SACYRT
550R----
RKCSE
551T----
TKNSVA
552L----
LFKC
553E----
EDAKN
554T----
ATSLH
555A----
AFCLVY
556Q----
NRDGLKAQ
557N----
DHVN
558S----
SFGT
559V----
LIVN
560R----
RDIVPSL
561V----
VDTMPS
562L----
LFE
563Q----
QESIRYAGLDFKNPTV
564K----
REVQKALDGIPSTCFHMNY
565A----
AFRSVGLDEIKNPQTY
566A----
APGFELSVDHIKMNQRTY
567I----
IYVPAEGLSDFHKMNQRT
568T----
TDFHYAEGLSVIKMNPQR
569I----
ILYFDTAEGKNPRSV
570L----
LPTMADEGIKNRSV
571D----
DCNSAEGIKLPRTV
572G----
GDSLAEIKNPRTV
573I----
VILFMADEGKNPRST
574S----
SVATNDEGIKLPR
575Q----
QPDESNAGIKLRTV
576Y----
FRQYADEGIKLNPSTV
577S----
SFVTADEGIKLNPR
578L----
ELYGQADIKNPRSTV
579R----
LKRYE
580L----
LVI
581I----
IVLCSF
582D----
DKA
583A----
CASLPM
584M----
AMQGICV
585M----
VAKLQMDEFGINPRSTY
586F----
FLYHKADEGINPQRSTV
587T----
TFMALDEGIKNPQRSVY
588S----
SCGLADEIKPRTVFHMNQY
589D----
DILAMGSEFHKNPQRTVY
590L----
LMFSAGDEHIKNPQRTVY
591A----
VALGFSDEHIKMNPQRTY
592T----
TMNLAEGSVDFIKPQRCHWY
593N----
NDSFLAEGKTVCHIMPQRY
594N----
SGRMNLAEVDFIKPQTCHWY
595L----
VCRLYADEGIKPSTFHMNQ
596V----
VSEIFMADGKLNPRT
597V----
VAYDIEGKLNPRST
598M----
MALTSDEGIKNPRV
599A----
ATSRDEGIKLNPV
600Y----
YLADEGIKNPRSTV
601I----
FVILT
602T----
TFEVLDAGIKNPRS
603G----
GMSHEVADIKLNPRT
604G----
GKRHYADEILNPSTV
605V----
VLDI
606V----
VLTNE
607Q----
QRKHL
608L----
LFVQYK
609T----
TAFLSVI
610S----
TADKSGNM
611Q----
QKETYDL
612W----
FWYKQAEGLSV
613L----
VLMFTAEGS
614T----
SKTDLVAEG
615N----
NTKSAEGLV
616I----
VITWML
617F----
LFATI
618G----
GALNTS
619T----
TKSAI
620V----
VCFMTLA
621Y----
AVQSLY
622E----
DVSWETN
623K----
AKRMV
624L----
LFVS
625K----
KSAFR
626P----
PAHSK
627V----
VLFIA
628L----
LGFTV
629D----
EDHNGITQV
630W----
WAGT
631L----
VCLAI
632E----
VLEYFM
633E----
AREIKYS
634K----
KAVQT
635F----
LISVTYFADEGKNPR
636K----
ETKSLRADGINPV
637E----
AESNDGIKLPRTV
638G----
GTWDAEIKLNPRSV
639V----
FAIVML
640E----
EDGSYKNAILPRTV
641F----
FLIADEGKPRSTV
642L----
ALIVDEGKPRST
643R----
KVRSLNADEGIPT
644D----
DGNAEIKLPRSTV
645G----
AGMLSDEFIKNPQRTVY
646W----
WFAGLSDEIKMNPQRTVY
647E----
ELKGTASDFIMNPQRVY
648I----
ILCGADEKPRSTV
649V----
LFYPIVADEGKRST
650K----
KRQLADEGIPSTV
651F----
FVLAYI
652I----
LVAFI
653S----
SNVFMIL
654T----
TAKHSERLDFGINPQVY
655C----
GAKQNRCLDEPSTVFHIMY
656A----
ALGVQDEIKNPRST
657C----
YFLNCADEGIKPRSTV
658E----
VFDTEAGIKLNPRS
659I----
YAVINDEGKLPRST
660V----
VTFI
661G----
ASKVG
662G----
GQNCAV
663Q----
GQAKL
664I----
FIVY
665V----
VQIRP
666T----
VTAFSD
667C----
VFALYC
668A----
ARINSGVT
669K----
KDQAEG
670E----
ENHSVIKY
671I----
VLSI
672K----
SKPLNV
673E----
EDKSNTQ
674S----
LKSCI
675V----
VLCF
676Q----
KQHRY
677T----
QNTSVACI
678F----
FVLT
679F----
LFVCMI
680K----
DKIHG
681L----
LIKVD
682V----
LFVGM
683N----
NSKLTADEGIPRV
684K----
KTSADEGILPRV
685F----
AFCIGDEKLPRSTV
686L----
MLF
687A----
KEQSA
688L----
LVMIKC
689C----
LCGV
690A----
HILRTA
691D----
TDRV
692S----
SQNRDKT
693I----
VIM
694I----
SICKLT
695I----
WILKV
696G----
ASDGEKLTV
697G----
GMAEKLSTV
698A----
SATCPLEGKV
699K----
KVNTAEGLS
700L----
LVIAEGKST
701K----
SKRDGPVYAELT
702A----
ASTEKL
703L----
ILVDT
704N----
NYILAES
705L----
LSTYVGR
706G----
GRN
707E----
RETLDNVAGS
708T----
TVEYKSAGL
709F----
FAYVLSCG
710V----
LVIY
711T----
AFLIKNCT
712H----
FHQSTVGP
713S----
SNRAPK
714K----
SKTGIR
715G----
GNTQALS
716L----
LTVRYAEGS
717Y----
YRLIADEFGKNPQSTV
718R----
RFTEYCADGIKLNPQSV
719K----
VQEIKLAGSDFNPRTCHMWY
720C----
CVSAGLDEFIKNPQRTY
721V----
LVIQTADEFGKNPRS
722K----
SRLTQVKAGDEFHIMNPY
723S----
GTCQPSLADEFIKNRVY
724R----
KRASLDEFGINPQTVY
725E----
KEDAQSLFGINPRTVY
726E----
QEKRDLVAFGINPSTY
727T----
LTRPFSYAEGV
728G----
GDQNAELSV
729L----
LFVYAEGS
730L----
LVITAEGS
731M----
LMIHAEGSV
732P----
PSAEGLV
733L----
GLKCVSQAE
734K----
KDQENGRALSV
735A----
AQYFCSL
736P----
KPNEGSAL
737K----
KQSML
738E----
KEQD
739I----
VIPTQA
740I----
YTLIEG
741F----
FGVYECIDALST
742L----
LFIVAEGST
743E----
EVDKNAFGILPQRST
744G----
GAQSL
745E----
DESLKTAFGINPQRV
746T----
TSFGLIAEV
747L----
LHDISQEVMAGT
748P----
DPAEGLSTV
749T----
TAPVFKSEGL
750E----
VSDKYQTENAFGILPR
751V----
LIAVTNFDEGKPQRSY
752L----
NLTAMSVQG
DISORDER predicted by DISOPRED
753T----
TSDACKGL
DISORDER predicted by DISOPRED
754E----
ETSDNAGL
DISORDER predicted by DISOPRED
755E----
VESKLADFGINPQRTY
DISORDER predicted by DISOPRED
756V----
VASILDEFGKNPQRTY
DISORDER predicted by DISOPRED
757V----
VEDITYAGKLNPRS
DISORDER predicted by DISOPRED
758L----
VLCTF
DISORDER predicted by DISOPRED
759K----
VEKL
DISORDER predicted by DISOPRED
760T----
STDVHLN
DISORDER predicted by DISOPRED
761G----
GDETS
DISORDER predicted by DISOPRED
762D----
EQSVND
DISORDER predicted by DISOPRED
763L----
LICMVD
DISORDER predicted by DISOPRED
764Q----
ETGDFQL
DISORDER predicted by DISOPRED
765P----
PAGNQVSL
DISORDER predicted by DISOPRED
766L----
LVCFTADEGIKNPRS
DISORDER predicted by DISOPRED
767E----
EKGLADINPRSTV
DISORDER predicted by DISOPRED
768Q----
EDQTYSAL
DISORDER predicted by DISOPRED
769P----
PSEDTHL
DISORDER predicted by DISOPRED
770T----
VTLNSIADEGKPR
DISORDER predicted by DISOPRED
771S----
VSDFNMPTAEGIKLR
772E----
EGSDHAIKLPRTV
773A----
AVFHLSYCDEGIKPRT
774V----
VCTGSPADEIKLR
775E----
EDKPNQSAGLV
776A----
PVAGSL
777P----
PAKMDEFGILNQRSTVY
778L----
KLIVTAGS
779V----
VSTI
780G----
GAVYF
781T----
DTENQ
782P----
KYPLG
783V----
VIC
784C----
CILS
785I----
IVLK
786N----
NVSAIP
787G----
DGSEPK
788L----
KNLSI
789M----
LMVSF
790L----
FYLV
791L----
MVLER
792E----
RAEGKS
793I----
KTILSVAEG
794K----
KEACD
795D----
DGCEIN
796T----
DEGKVST
797E----
EDKFQ
798K----
KFYQLGT
799Y----
YF
800C----
PCMYLAEGSVDFIKNQRTHW
801A----
AVPREGLST
802L----
LVYFKAEGST
803A----
VCSFYA
804P----
PDTKGI
805N----
NGDSI
806M----
GVHLM
807M----
VGKMLH
808V----
VAGNI
809T----
LVTD
810N----
NLPGSKD
811N----
TNDKQ
812T----
LQTVAIC
813F----
FACVW
814T----
RWGLTS
815L----
LRVF
816K----
KVRDLP
817G----
GPDQC
818G----
GCAQLS
819A----
AMG
820P----
PGV
821T----
SRVKPTI
822K----
KRC
823V----
V
824T----
TEANKV
825F----
F
826G----
GNK
827D----
DEG
828D----
DKEQV
829T----
TQKNEP
830V----
VT
831I----
KHVNLIRW
832E----
ETK
833V----
IV
834Q----
PAQTI
835G----
SAGN
836Y----
TYVLM
837K----
RKVM
838S----
STKNI
839V----
VI
840N----
KSNTR
841I----
IVF
842T----
TFSEMDIN
843F----
YF
844E----
DEAN
845L----
LIV
846D----
DHC
847E----
EAPKSNV
848R----
VTRDG
849I----
LFVI
850D----
DN
851K----
ATKSD
852V----
IVL
853L----
L
854N----
NSGD
855E----
KSET
856K----
KAVSE
857C----
CLM
858S----
SAGR
859A----
TEVPA
860Y----
FY
861T----
TEQV
862V----
V
863E----
ED
864L----
KDSEL
865G----
GDTS
866T----
VTL
867E----
TEDLKSP
868V----
VLMI
869N----
EDTKN
870E----
ED
871F----
FL
872A----
AVYL
873C----
DCA
874V----
V
875V----
VI
876A----
KALQICV
877D----
DEK
878A----
AEQ
879V----
VI
880I----
EVILYS
881K----
EKSTDN
882T----
TLKRA
883L----
L
884Q----
SQTVN
885P----
PKDS
886V----
LCV
887S----
KLSP
888E----
ERDA
889L----
LGIEV
890L----
LGYEM
891T----
TADRPYN
892P----
KPINQV
893L----
VDMPLAEGIKNQRST
894G----
GSCDRAEIKLNPQTV
895I----
AIF
896D----
DFLN
897L----
LV
898D----
EDQN
899E----
DKER
900W----
FLW
901S----
ISAELNV
902M----
DVETMG
903A----
ANDVST
904T----
PTYESV
905Y----
CVLFY
906Y----
YF
907L----
LVC
908F----
FY
909D----
DNS
910E----
EADQK
911S----
ADEGS
912G----
GY
913E----
ED
914F----
ECKALF
915K----
VAKISN
916L----
LWIFM
917A----
ASM
918S----
SP
919H----
RKTNEH
920M----
ML
921Y----
YTI
922C----
CF
DISORDER predicted by DISOPRED
923S----
SAT
DISORDER predicted by DISOPRED
924F----
FLIV
DISORDER predicted by DISOPRED
925Y----
NYTSEHA
DISORDER predicted by DISOPRED
926P----
PADI
DISORDER predicted by DISOPRED
927P----
PVE
DISORDER predicted by DISOPRED
928D----
DEVI
DISORDER predicted by DISOPRED
929E----
EDCA
DISORDER predicted by DISOPRED
930D----
DEV
DISORDER predicted by DISOPRED
931E----
EDVAGIKLNPQRST
DISORDER predicted by DISOPRED
932E----
EMDIAFGKLNPQRSTVY
DISORDER predicted by DISOPRED
933E----
EVSCDAFGIKLNPQRTY
DISORDER predicted by DISOPRED
934G----
SDEACGFIKLNPQRTVY
DISORDER predicted by DISOPRED
935D----
DEWAL
DISORDER predicted by DISOPRED
936C----
CAIDEYL
DISORDER predicted by DISOPRED
937E----
EVIRDC
DISORDER predicted by DISOPRED
938E----
AEDSYC
DISORDER predicted by DISOPRED
939E----
EADVFGIKLNPQRST
DISORDER predicted by DISOPRED
940E----
ETDAFGIKLNPQRSV
DISORDER predicted by DISOPRED
941F----
VEISDFAGKLNPQRT
DISORDER predicted by DISOPRED
942E----
EVIDTMAFGKLNPQRS
DISORDER predicted by DISOPRED
943P----
PDEGYAFIKLNQRSTV
DISORDER predicted by DISOPRED
944S----
LAEVQSTDFGIKNPR
DISORDER predicted by DISOPRED
945T----
DVTSECAFGIKLNPQR
DISORDER predicted by DISOPRED
946Q----
EDQCTAFGIKLNPRSV
DISORDER predicted by DISOPRED
947Y----
HNDVEIYAFGKLPQRST
DISORDER predicted by DISOPRED
948E----
EQLSTMADFGIKNPRV
DISORDER predicted by DISOPRED
949Y----
YIHLVGASDEFKMNPQRT
DISORDER predicted by DISOPRED
950G----
GENAVDLSFIKMPQRTY
DISORDER predicted by DISOPRED
951T----
TEDIAGLSFKMNPQRVY
DISORDER predicted by DISOPRED
952E----
EDSIAFGKLNPQRTV
DISORDER predicted by DISOPRED
953D----
DEAFGIKLNPQRSTV
DISORDER predicted by DISOPRED
954D----
DLEAFGIKNPQRSTV
DISORDER predicted by DISOPRED
955Y----
YENAGLDIKPRSTVCFHMQ
DISORDER predicted by DISOPRED
956Q----
EKQALGSTVDFINPRCHMWY
DISORDER predicted by DISOPRED
957G----
GADLEKSTVFINPQRCHMWY
DISORDER predicted by DISOPRED
958K----
LPFKAEGSTVDINQRCHMWY
DISORDER predicted by DISOPRED
959P----
PALEGKSTVDFINQRCHMWY
DISORDER predicted by DISOPRED
960L----
LAEGKSTVDFINPQRCHMWY
DISORDER predicted by DISOPRED
961E----
ESAGLDIKNPRTVCFHMQY
DISORDER predicted by DISOPRED
962F----
FATWGLDEIKNPRSVCHMQY
DISORDER predicted by DISOPRED
963G----
GAELDIKNPRSTVCFHMQY
DISORDER predicted by DISOPRED
964A----
ADLEGSVFHIKMNPQRTY
DISORDER predicted by DISOPRED
965T----
SEVATGLDFHIKMNPQRY
DISORDER predicted by DISOPRED
966S----
STVDAEFGIKLNPQR
DISORDER predicted by DISOPRED
967A----
EAVSGLDFHIKMNPQRTY
DISORDER predicted by DISOPRED
968A----
ATSVEGL
DISORDER predicted by DISOPRED
969L----
VLPAEGS
DISORDER predicted by DISOPRED
970Q----
EQILVRHAGS
DISORDER predicted by DISOPRED
971P----
EPVQTLADFGIKNRSY
DISORDER predicted by DISOPRED
972E----
AEMTGLSV
DISORDER predicted by DISOPRED
973E----
EDSAGLV
DISORDER predicted by DISOPRED
974E----
DETAQGLSV
DISORDER predicted by DISOPRED
975Q----
QESPVAGL
DISORDER predicted by DISOPRED
976E----
EDVQAGLS
DISORDER predicted by DISOPRED
977E----
EDPLAGSV
DISORDER predicted by DISOPRED
978D----
DQSVAEGL
DISORDER predicted by DISOPRED
979W----
WPVTGQAELS
DISORDER predicted by DISOPRED
980L----
LVEAGS
DISORDER predicted by DISOPRED
981D----
DEGSVLAFIKNPQRTY
DISORDER predicted by DISOPRED
982D----
DAIEGLSV
DISORDER predicted by DISOPRED
983D----
DEIKATFGLNPQRSV
DISORDER predicted by DISOPRED
984S----
SIAGTDEFKLNPQRV
DISORDER predicted by DISOPRED
985Q----
EQTDAGLSV
DISORDER predicted by DISOPRED
986Q----
VQEPIAGL
DISORDER predicted by DISOPRED
987T----
SVCEGKTAL
DISORDER predicted by DISOPRED
988V----
VDETPIAGKLNQRS
DISORDER predicted by DISOPRED
989G----
AESPGDIKLNQRTV
DISORDER predicted by DISOPRED
990Q----
QEATHPDGIKLNRSV
DISORDER predicted by DISOPRED
991Q----
QETSDKVAGL
DISORDER predicted by DISOPRED
992D----
DEPGVLAIKRST
DISORDER predicted by DISOPRED
993G----
GEASWIVDKLNPQRT
DISORDER predicted by DISOPRED
994S----
ARVDTQESGIKLNP
DISORDER predicted by DISOPRED
995E----
ENWLQHSFADGIKPRTV
DISORDER predicted by DISOPRED
996D----
DEQLIAGKNPRSTV
DISORDER predicted by DISOPRED
997N----
NAIQEKLCDGSTV
DISORDER predicted by DISOPRED
998Q----
KQESLDAGIPRTV
DISORDER predicted by DISOPRED
999T----
TVNSAYEGLDFHIKMPQR
DISORDER predicted by DISOPRED
1000T----
STCDEIKPAGLVFHMNQRY
DISORDER predicted by DISOPRED
1001T----
TIAEPSVGLDFHKMNQRY
DISORDER predicted by DISOPRED
1002I----
VELSACMIDGKPRTFHNQY
DISORDER predicted by DISOPRED
1003Q----
NKESIQLADFGPRTVY
DISORDER predicted by DISOPRED
1004T----
TPEKRDLAFGINQSVY
DISORDER predicted by DISOPRED
1005I----
IEVDKTLAFGNPQRSY
DISORDER predicted by DISOPRED
1006V----
VACQIPDEGKLRST
DISORDER predicted by DISOPRED
1007E----
EDVQF
DISORDER predicted by DISOPRED
1008V----
VKTYPIADEFGLNQRS
DISORDER predicted by DISOPRED
1009Q----
DPQSKNELAGIRTV
DISORDER predicted by DISOPRED
1010P----
PVASDEFGIKLNQRT
DISORDER predicted by DISOPRED
1011Q----
QAKRDNVEFGILPST
DISORDER predicted by DISOPRED
1012L----
VLNQTCRWFADEGIKPS
DISORDER predicted by DISOPRED
1013E----
EDSTVHAGLFIKNPQRY
DISORDER predicted by DISOPRED
1014M----
LMDAIKEVQFGNPRSTY
DISORDER predicted by DISOPRED
1015E----
EKPLRTSADFGINQVY
DISORDER predicted by DISOPRED
1016L----
LAVPIEGSDFHKMNQRTY
DISORDER predicted by DISOPRED
1017T----
TSPLRVKADEG
DISORDER predicted by DISOPRED
1018P----
PRAKQSVELGT
DISORDER predicted by DISOPRED
1019V----
VEFILPAYDGKNQRST
DISORDER predicted by DISOPRED
1020V----
VKRAPYILTDEFGNQS
DISORDER predicted by DISOPRED
1021Q----
KQNPEVDAGILRST
DISORDER predicted by DISOPRED
1022T----
TAESQDGIKLPRV
DISORDER predicted by DISOPRED
1023I----
CEGVIKALDPRST
DISORDER predicted by DISOPRED
1024E----
EVKPDGQAILRST
DISORDER predicted by DISOPRED
1025V e 70.0 6wey_A
VKDLRTAEGIPS
DISORDER predicted by DISOPRED
1026N e 23.6 6wey_A
NSKPLDETAGIRV
DISORDER predicted by DISOPRED
1027S e 48.4 6wey_A
SPQKFADEGILRTV
DISORDER predicted by DISOPRED
1028F b 13.4 6wey_A precipitant
FLKRY
DISORDER predicted by DISOPRED
1029S e 64.1 6wey_A precipitant
LYKSPQETACV
1030GSe 84.5 6wey_A precipitant
GERISVKN
1031Y b 15.7 6wey_A metal CL precipitant
YFHSAQ
1032LEe 42.1 6wey_A metal CL precipitant
LKATDVEIGNPQRS
1033KEe 54.7 6wey_A metal CL
KTRDNVECHAGILPQS
1034LSb 9.6 6wey_A
ILMACVDEGKST
1035TSe 31.8 6wey_A precipitant
TNSAVKLDEG
1036DSe 64.2 6wey_A precipitant
DGPESKNIQ
1037NSe 27.3 6wey_A
NRDPKCHS
1038VEb 0.0 6wey_A
VILFQ
1039YEb 11.3 6wey_A precipitant
HATCVRYKDIQ
1040IEb 0.0 6wey_A precipitant
FILVH
1041KEb 17.5 6wey_A precipitant
VIYKQREFLM
1042NEe 40.6 6wey_A precipitant
KQVLCIENHFR
1043A b 13.4 6wey_A compound APR AMP precipitant
GARSVI
1044D e 36.4 6wey_A compound APR AMP precipitant
DK
1045IHb 5.3 6wey_A compound APR AMP precipitant
IAVF
1046VHb 11.3 6wey_A
TVILMDSKAEG
1047EHe 38.7 6wey_A
QKEDSTAGHNRFILPV
1048EHb 4.0 6wey_A
VEPDLIAGKSTCFHMNQRY
1049AHb 0.9 6wey_A
AVLFPIRSDEGKTCHMNQY
1050KHe 42.9 6wey_A
RKQNPVTSLADEGICFHMY
1051KHe 68.4 6wey_A
KGRDELCSTANQHFIPVY
1052VHb 2.7 6wey_A
VLIFCAYMT
1053K e 56.1 6wey_A precipitant
EKSGADPNRTLV
1054P b 0.0 6wey_A precipitant
APVFCSDEKTYGILNQR
1055TSe 22.7 6wey_A compound NHE precipitant
DETCASMFGIKLNPQRV
1056VEb 7.3 6wey_A compound NHE precipitant
VAFCI
1057VEb 0.0 6wey_A
IVL
1058VEb 0.0 6wey_A
VIN
1059NEb 0.0 6wey_A
N
1060AEb 19.6 6wey_A compound APR AMP CMP precipitant
APSV
1061A b 0.0 6wey_A compound APR CMP precipitant
AVS
1062N e 33.3 6wey_A compound APR CMP precipitant
NT
1063VTe 32.0 6wey_A
ESGPLNTVARI
1064YTe 43.9 6wey_A
HSNDYKQRVGTA
1065L b 0.0 6wey_A
LMG
1066K e 56.6 6wey_A compound APR CMP precipitant
LKASMQGERTHI
1067H b 3.7 6wey_A compound APR precipitant
HGPDAM
1068G e 71.4 6wey_A compound APR CMP precipitant
GAVIMY
1069GSe 61.9 6wey_A compound APR CMP precipitant
GSAI
1070GHe 63.1 6wey_A compound APR AMP CMP precipitant
GQ
1071VHe 29.3 6wey_A compound APR AMP CMP precipitant
VIL
1072AHb 3.6 6wey_A compound APR CMP precipitant
ADC
1073GHb 19.0 6wey_A precipitant
GKRSALQY
1074AHe 31.2 6wey_A precipitant
ALVS
1075LHb 0.0 6wey_A
IL
1076NHb 12.7 6wey_A
HDAVNSYFP
1077KHe 76.4 6wey_A precipitant
RKVDACEI
1078AHb 14.3 6wey_A
AKFLMYNST
1079TTb 2.6 6wey_A
ATGCSFY
1080NTe103.0 6wey_A precipitant
GKNPTE
1081NTe 51.5 6wey_A
PGEFKYASLNQ
1082AHe 31.2 6wey_A
AEKDSQVILMGT
1083MHb 0.0 6wey_A
LFIVM
1084QHb 11.2 6wey_A precipitant
QLTAIVDS
1085VHe 81.3 6wey_A
EKALSVNQRYDT
1086EHe 20.1 6wey_A
EALDQRWYC
1087SHb 0.0 6wey_A
SCTVLAEG
1088DHe 48.8 6wey_A
DKNRAEQSLTMY
1089DHe 58.0 6wey_A precipitant
DEQRANKTLVGS
1090YHb 12.6 6wey_A precipitant
YIVMLFHCWAEGKST
1091IHe 22.8 6wey_A
VIRLDAEFGKNPQST
1092AHe 67.0 6wey_A
KSQARGTELNDIPV
1093THe 71.4 6wey_A precipitant
KQRNALSEIFTDGPV
1094NHe 66.1 6wey_A precipitant
NQHYKSRAEGVFDILPT
1095G e 26.2 6wey_A precipitant
GKACL
1096P e 44.2 6wey_A precipitant
PEKVSGRATD
1097L b 12.4 6wey_A precipitant
CLIVQF
1098K e 78.3 6wey_A precipitant
PQKAHELSTGNR
1099VTe 23.3 6wey_A
VPTAGLS
1100GTb 9.5 6wey_A
GT
1101G e 21.4 6wey_A precipitant
EDGHNKACSTQR
1102SEe 21.1 6wey_A precipitant
ASGCVIRHK
1103CEb 6.0 6wey_A precipitant
VARYCILKT
1104VEe 54.0 6wey_A compound NHE precipitant
ILVMEAKRF
1105LEb 19.7 6wey_A
TLSVFI
1106SEe 32.8 6wey_A
KPSETAGQI
1107G b 0.0 6wey_A
GACS
1108HTe 30.9 6wey_A precipitant
GHFEDYNK
1109NTe 62.4 6wey_A
KNGLRQVSEDTA
1110LTb 1.1 6wey_A precipitant
LPKVCAF
1111A b 7.1 6wey_A precipitant
AGPCSIL
1112KSe 57.1 6wey_A precipitant
KDHRETICLS
1113HEe 37.7 6wey_A compound NHE precipitant
HYAQKNTGRSF
1114CEb 0.0 6wey_A
VICL
1115LEb 0.6 6wey_A
ILFVM
1116HEb 0.0 6wey_A
HNR
1117VEb 0.0 6wey_A
AVTI
1118V b 1.3 6wey_A
V
1119G b 1.2 6wey_A
GA
1120P b 0.0 6wey_A
P
1121N b 15.8 6wey_A
RDNIVGKE
1122VGe 29.3 6wey_A precipitant
WAKYFGHNTLRVSC
1123NGe 70.9 6wey_A
GRNSHPADMTEQ
1124KGe 78.3 6wey_A precipitant
KDGANREHTILQSV
1125GTe 84.5 6wey_A
GNSHDVFKQEWY
1126E e 30.7 6wey_A
EDQHSANRGT
1127D e 53.1 6wey_A
DEVAGKLPRSCH
1128IGe 46.2 6wey_A precipitant
AVEIDLPYKSFHRTG
1129QGe 74.0 6wey_A precipitant
EQAKLNSGVYR
1130LGe 48.9 6wey_A
LKQVRFTI
1131LHb 0.0 6wey_A precipitant
LVIAEKY
1132KHe 37.3 6wey_A
KAERSCVDHIQT
1133SHe 35.9 6wey_A
RASEDNQKFV
1134AHb 0.0 6wey_A
ACVYSI
1135YHb 0.0 6wey_A
YFINLVWK
1136EHe 26.1 6wey_A precipitant
KRQELSTADN
1137NGb 13.9 6wey_A precipitant
NASHLIEVKRTD
1138FGb 0.0 6wey_A
AFIVLYDNKMCS
1139NGb 8.5 6wey_A precipitant
NKLARDYEFGTH
1140QGe 65.8 6wey_A compound NHE precipitant
KNGEQVASHRPDT
1141HSb 12.6 6wey_A compound NHE precipitant
YHCDQKWEFILNAGS
1142ESe 71.9 6wey_A compound NHE metal MG precipitant
DGKTREQAPNS
1143VEb 14.0 6wey_A
SIVTLCKNDE
1144LEb 0.0 6wey_A
VILPKACGM
1145LEb 0.0 6wey_A
ALVTFS
1146AEb 0.0 6wey_A
TFIMVASCLK
1147P b 4.7 6wey_A compound APR AMP
PTS
1148L b 5.6 6wey_A compound APR AMP CMP precipitant
LAMNVICST
1149LTb 0.6 6wey_A compound APR CMP precipitant
ILV
1150STb 2.3 6wey_A compound APR CMP precipitant
SG
1151A e 23.2 6wey_A compound APR AMP CMP precipitant
TASVCL
1152GTe 77.4 6wey_A compound APR AMP CMP precipitant
G
1153ITe101.8 6wey_A compound APR AMP CMP precipitant
IVA
1154FSb 9.1 6wey_A compound APR AMP CMP precipitant
FY
1155G e 32.1 6wey_A precipitant
GSQADKCH
1156A b 5.4 6wey_A precipitant
VYFAGWCIDEKLNPQRST
1157D e 58.0 6wey_A precipitant
PDKNSTREIALFGQVY
1158PHb 16.3 6wey_A
PKAIRSTVLFEGDHMNQY
1159IHe 31.0 6wey_A precipitant
EALDQIRTPGKSVCFHMNY
1160HHe 32.5 6wey_A precipitant
EVRAFNQTDILHYGKPS
1161SHb 0.8 6wey_A
SAPHTEVCDGIKLR
1162LHb 0.0 6wey_A
LAFVIY
1163RHe 21.3 6wey_A precipitant
EKRTLNADGQCP
1164VHb 16.7 6wey_A precipitant
IYVLATMDHRSP
1165CHb 0.0 6wey_A
ACLSM
1166VHb 8.7 6wey_A
VLIFTAM
1167DHe 49.4 6wey_A
DAGENRSKQLV
1168THb 0.0 6wey_A
TVANEKISDQ
1169V b 1.3 6wey_A
VITCMAFLNR
1170R e 64.4 6wey_A precipitant
RKDSLTVANHQEY
1171TSe 26.0 6wey_A precipitant
TEKALRCSQY
1172NEe 29.1 6wey_A precipitant
QNKTEDRP
1173VEb 0.0 6wey_A
VITCE
1174YEb 14.3 6wey_A precipitant
YIALSFRKNMVEGT
1175LEb 0.0 6wey_A
LVFICADEGKNPQRST
1176AEb 8.0 6wey_A compound APR AMP precipitant
VAYQSFC
1177VEb 4.7 6wey_A compound AMP precipitant
CVLSRAFT
1178F e 60.8 6wey_A compound APR AMP precipitant
YNLFRQD
1179D e 59.3 6wey_A metal MG precipitant
DNSTLGK
1180KHe 58.0 6wey_A
KEQADMR
1181NHe 93.9 6wey_A precipitant
EDTRKQSNPAH
1182LHe 37.1 6wey_A compound APR AMP precipitant
LVDAMNEFI
1183YHb 17.4 6wey_A precipitant
YFVIMNT
1184DHe 40.1 6wey_A
DQNEVCGSKAR
1185KHe 55.7 6wey_A
RKNVFQDSIH
1186LHb 0.6 6wey_A
LVFIDAG
1187VHb 16.7 6wey_A
LVEAK
1188SHe 37.5 6wey_A
TSNAKLGEQM
1189SHe 23.4 6wey_A precipitant
QSVDGITN
1190FHb 5.7 6wey_A
FYLMVS
1191LHe 75.8 6wey_A
VLDTRFAEGS
1192ETe 83.9 6wey_A
EDYSNAGLTV
1193MSe 27.1 6wey_A
VTGQLSMNADEK
DISORDER predicted by DISOPRED
1194K e 87.7 6wey_A
AQDLSYPK
DISORDER predicted by DISOPRED
1195S e136.7 6wey_A
KGSQNT
DISORDER predicted by DISOPRED
1196E----
EPITQV
DISORDER predicted by DISOPRED
1197K----
KRQE
DISORDER predicted by DISOPRED
1198Q----
QAENPSVDFGIKLRT
DISORDER predicted by DISOPRED
1199V----
VITLSADEGKPR
DISORDER predicted by DISOPRED
1200E----
EISTVADGKLNPR
DISORDER predicted by DISOPRED
1201Q----
QLEPADGIKNRSTV
DISORDER predicted by DISOPRED
1202K----
KENQHADGILPRSTV
DISORDER predicted by DISOPRED
1203I----
VFLMPINADEGKRST
DISORDER predicted by DISOPRED
1204A----
VAKSCGPL
DISORDER predicted by DISOPRED
1205E----
ESKGAT
DISORDER predicted by DISOPRED
1206I----
IVNALS
DISORDER predicted by DISOPRED
1207P----
PLIQDK
DISORDER predicted by DISOPRED
1208K----
KCLWIVEN
DISORDER predicted by DISOPRED
1209E----
EKRQVAN
DISORDER predicted by DISOPRED
1210E----
EVDAKP
DISORDER predicted by DISOPRED
1211V----
PVTEA
DISORDER predicted by DISOPRED
1212K----
KEVP
DISORDER predicted by DISOPRED
1213P----
PDELAFGIKNQRSTVY
DISORDER predicted by DISOPRED
1214F----
FNTDYK
DISORDER predicted by DISOPRED
1215I----
VLRIT
DISORDER predicted by DISOPRED
1216T----
TNEKV
DISORDER predicted by DISOPRED
1217E----
DQENVH
DISORDER predicted by DISOPRED
1218S----
EASGKP
DISORDER predicted by DISOPRED
1219K----
KNRCQ
DISORDER predicted by DISOPRED
1220P----
PVSFKL
DISORDER predicted by DISOPRED
1221S----
SCEV
DISORDER predicted by DISOPRED
1222V----
VLEA
DISORDER predicted by DISOPRED
1223E----
EFPASV
DISORDER predicted by DISOPRED
1224Q----
FQSLEK
DISORDER predicted by DISOPRED
1225R----
RDEKPLAFGINQSTVY
DISORDER predicted by DISOPRED
1226K----
KIPVLADEFGNQRSTY
DISORDER predicted by DISOPRED
1227Q----
TEPQVDLAFGIKNRSY
DISORDER predicted by DISOPRED
1228D----
YDVGLAEFIKNPQRST
DISORDER predicted by DISOPRED
1229D----
DGVKLAEFINPQRSTY
DISORDER predicted by DISOPRED
1230K----
EKAVPLDFGINQRSTY
DISORDER predicted by DISOPRED
1231K e 58.5 2wct_A
KQLADEFGINPRSTVY
DISORDER predicted by DISOPRED
1232IEe 22.8 2wct_A
IFLADEGKNPQRSTVY
DISORDER predicted by DISOPRED
1233KEe 67.5 2wct_A
KEY
DISORDER predicted by DISOPRED
1234AEe 22.3 2wct_A
AGSD
DISORDER predicted by DISOPRED
1235CEe 34.0 2wct_A
CTLR
DISORDER predicted by DISOPRED
1236V b 11.1 2wct_A
VIFT
DISORDER predicted by DISOPRED
1237E e 74.1 2wct_A
KEVDP
DISORDER predicted by DISOPRED
1238ESe 72.9 2wct_A
ESD
DISORDER predicted by DISOPRED
1239VSe 72.0 2wct_A
VSM
DISORDER predicted by DISOPRED
1240TSe 78.6 2wct_A
TYVN
1241T e 21.4 2wct_A
TNDQ
1242T b 18.8 2wct_A
STQV
1243LHe 31.5 2wct_A
L
1244EHe 68.3 2wct_A
EQP
1245EHe 48.2 2wct_A
ESV
1246THb 4.5 2wct_A
TVA
1247KTe 50.5 2wct_A
KERSF
1248FTe 86.1 2wct_A
FDAL
1249LTe 52.2 2wct_A
LV
1250T b 8.4 2wct_A
TGRS
1251E e 49.7 2wct_A
EHNQS
1252N e 28.8 2wct_A
KDNR
1253LEb 11.8 2wct_A
LVI
1254LEb 0.0 2wct_A
LQIV
1255LEb 0.0 2wct_A
LK
1256YEb 0.5 2wct_A
FAY
1257IEb 0.9 2wct_A
AIVL
1258D e 24.7 2wct_A
DQ
1259ISe 46.2 2wct_A homo
IAV
1260NSe 70.9 2wct_A homo
NDA
1261GSb 4.8 2wct_A
GWM
1262N e 65.1 2wct_A
DNAKQ
1263LBb 3.4 2wct_A
ALCI
1264H b 15.7 2wct_A
YLHN
1265PHe 51.3 2wct_A
PAQH
1266DHb 12.3 2wct_A
DTNA
1267SHb 0.8 2wct_A
SDA
1268AHe 42.9 2wct_A
AQWK
1269THe 58.8 2wct_A
NRAGT
1270LTb 12.1 2wct_A
LMFA
1271V b 15.2 2wct_A
VL
1272SSe 80.2 2wct_A
RNQS
DISORDER predicted by DISOPRED
1273DSe102.4 2wct_A
KGD
DISORDER predicted by DISOPRED
1274I e 36.7 2wct_A
EFI
DISORDER predicted by DISOPRED
1275D e 69.1 2wct_A
DS
DISORDER predicted by DISOPRED
1276I e 21.7 2wct_A
MDI
1277T e 40.6 2wct_A
ESTF
1278FTb 15.3 2wct_A
FY
1279LTb 4.5 2wct_A
LI
1280KTe 64.8 2wct_A
ELK
1281KSe 76.4 2wct_A
KA
1282DSe 68.5 2wct_A homo
DK
1283A e 30.4 2wct_A homo
AG
1284PSe 83.7 2wct_A homo
P
1285Y b 8.3 2wct_A homo
YL
1286I e 67.6 2wct_A homo
IQM
1287VTe 36.7 2wct_A homo
V
1288GTb 6.0 2wct_A
G
1289D e 32.7 2wct_A
D
1290VEe 32.7 2wct_A
V
1291VEb 12.3 2wct_A
ILV
1292QEe 50.6 2wct_A
LTQS
1293EEe 44.5 2wct_A
SQE
1294GTe 81.0 2wct_A
G
1295VTe 42.6 2wct_A
DHV
1296LEb 12.3 2wct_A
ISL
1297TEb 1.9 2wct_A
TL
1298AEb 0.0 2wct_A
AC
1299VEb 0.0 2wct_A
V
1300VEb 0.0 2wct_A
VI
DISORDER predicted by DISOPRED
1301I b 1.8 2wct_A
IG
DISORDER predicted by DISOPRED
1302P b 1.6 2wct_A
P
1303T e 25.0 2wct_A
DATS
1304KTe 30.2 2wct_A homo
KA
1305KTe 59.9 2wct_A homo
KR
DISORDER predicted by DISOPRED
1306ATe 71.4 2wct_A homo
AS
DISORDER predicted by DISOPRED
1307GTe 69.0 2wct_A homo
GK
1308G b 9.5 2wct_A
GQ
DISORDER predicted by DISOPRED
1309T e 37.7 2wct_A
TD
DISORDER predicted by DISOPRED
1310THe 27.9 2wct_A
TV
DISORDER predicted by DISOPRED
1311EHe 60.3 2wct_A
ES
DISORDER predicted by DISOPRED
1312MHe 30.9 2wct_A homo
ML
DISORDER predicted by DISOPRED
1313LHb 0.0 2wct_A
L
DISORDER predicted by DISOPRED
1314AHb 6.2 2wct_A
SA
DISORDER predicted by DISOPRED
1315KHe 57.3 2wct_A homo
KR
DISORDER predicted by DISOPRED
1316AHb 3.6 2wct_A
A
DISORDER predicted by DISOPRED
1317LHb 0.0 2wct_A
LM
1318RTe 47.6 2wct_A
KNR
1319KTe 60.8 2wct_A
KAE
1320VSb 2.7 2wct_A
VY
1321P e 55.8 2wct_A
P
1322TSe 63.3 2wct_A
VLT
1323DSe 30.9 2wct_A
DASGLEIKNPRTVCFHMQY
1324NEe 37.2 2wct_A
ENAGLSDIKPRTVCFHMQY
1325YEb 1.3 2wct_A
YV
1326IEb 0.6 2wct_A
IV
1327TEb 0.0 2wct_A
T
1328T b 3.2 2wct_A
TP
1329Y b 5.2 2wct_A
YL
1330PSb 0.0 2wct_A
PV
1331GSb 6.0 2wct_A
GS
1332Q b 18.9 2wct_A
QA
1333GSe 31.0 2wct_A
G
1334LSb 7.3 2wct_A
CIL
1335NSe 42.0 2wct_A
AFN
1336GSb 15.5 2wct_A
G
1337Y b 0.4 2wct_A
Y
1338T b 16.9 2wct_A
TL
1339VHb 13.5 2wct_A
LIV
1340EHe 59.3 2wct_A
ER
1341EHe 26.6 2wct_A
E
1342AHb 0.0 2wct_A
A
1343KHe 28.8 2wct_A
K
1344THe 53.2 2wct_A
T
1345VHb 1.8 2wct_A
ARV
1346LHb 0.0 2wct_A
LV
1347KHe 53.8 2wct_A
KLR
1348KHe 64.6 2wct_A
KV
1349CSb 2.0 2wct_A
CV
1350KSe 75.0 2wct_A
KV
1351SSb 0.0 2wct_A
SN
1352AEe 20.5 2wct_A
ASV
1353FEb 0.5 2wct_A
FQ
1354YEb 7.4 2wct_A
YD
1355IEb 0.0 2wct_A
VI
1356L b 18.0 2wct_A
LY
1357P e 62.8 2wct_A
PK
1358S e 75.0 2wct_A
S
1359ISe 27.1 2w2g_B
LEIK
1360I e 25.0 2w2g_B
TIA
1361S e 93.0 2w2g_B
PIS
1362N----
NV
1363E----
DEA
1364K----
KI
1365Q----
EPQ
1366E e 70.9 2wct_A
EQ
1367IGe 63.2 2wct_A
ISLV
1368LGe 84.3 2wct_A
LV
1369GGb 17.9 2wct_A
GTD
1370TEb 9.7 2wct_A
TFV
1371VEb 19.3 2wct_A
VS
1372S e 25.8 2wct_A
SY
1373W e 27.5 2wct_A
WDM
1374N e 45.5 2wct_A
NGS
1375LHb 12.9 2wct_A
LF
1376RHe 65.6 2wct_A
RS
1377EHe 33.7 2wct_A
EGA
1378MHb 0.0 2wct_A
MA
1379LHb 0.0 2wct_A
LIV
1380AHe 33.9 2wct_A
ARN
1381HHb 16.2 2wct_A
HKF
1382AHb 0.0 2wct_A
AG
1383EHe 37.2 2wct_A
KE
1384EHe 74.4 2wct_A
ED
1385THe 39.0 2wct_A
TYK
1386R e 40.7 2wct_A
GR
1387K e 22.2 2wct_A
KFL
1388LEb 0.0 2wct_A
LT
1389MEb 0.0 2wct_A
MVI
1390PEb 1.6 2wct_A
PFL
1391VEb 1.2 2wct_A
IV
1392CEb 4.0 2wct_A
CV
1393VTb 17.9 2wct_A
TIMVL
1394ETe 40.7 2wct_A homo
DE
1395T e 26.0 2wct_A homo
YVNQT
1396KHe 85.0 2wct_A homo
SPKR
1397AHe 67.0 2wct_A
A
1398IHb 17.0 2wct_A
NIFL
1399VHb 7.7 2wct_A
MVLTA
1400SHe 33.9 2wct_A
KSA
1401THe 44.8 2wct_A
TVFL
DISORDER predicted by DISOPRED
1402IHb 0.0 2wct_A
LI
DISORDER predicted by DISOPRED
1403QHe 38.8 2wct_A
KRQH
1404RHe 60.5 2wct_A
RNGT
DISORDER predicted by DISOPRED
1405KHe 47.6 2wct_A
KRAGLDEFINPQSTVY
DISORDER predicted by DISOPRED
1406YSb 7.0 2wct_A
GYALDEFIKNPQRSTV
DISORDER predicted by DISOPRED
1407KTe 73.6 2wct_A
VKAGLDEFINPQRSTY
1408GTe 81.0 2wct_A
DGALEFIKNPQRSTVY
DISORDER predicted by DISOPRED
1409I b 10.5 2wct_A
IFYLT
1410K e 64.2 2wct_A
TKS
1411I e 28.7 2wct_A
KPIV
1412Q e 50.5 2wct_A
KQ
1413ESe 50.3 2wct_A
EFIT
1414GEb 16.7 2wct_A
GQL
1415VEe 38.6 2wct_A
TILV
1416VEb 10.0 2wct_A
VF
1417DEe 51.9 2wct_A
DS
1418YSe 43.9 2wct_A
YSLAEGKTVDFINPQRCHMW
1419GSe 50.0 2wct_A
G
1420ASb 0.0 2wct_A
VYA
1421REe 20.6 2wct_A
REQKS
1422FEb 0.0 2wct_A
FY
1423YEb 3.8 2wct_A
YF
1424FEb 0.5 2wct_A
FLGC
1425YEb 4.3 2wct_A
Y
1426T b 9.7 2wct_A
TS
1427SSe 43.8 2wct_A homo
SRA
1428KSe 92.9 2wct_A homo
KDR
1429TSb 11.6 2wct_A
DEKT
1430T e 62.8 2wct_A
PTA
1431VHb 5.3 2wct_A
LV
1432AHb 10.7 2wct_A
ATHD
1433SHe 34.4 2wct_A
DSE
1434LHb 0.0 2wct_A
IVL
1435IHb 2.3 2wct_A
ISL
1436NHe 61.0 2wct_A precipitant
TKQAN
1437THe 40.1 2wct_A
AKDQT
1438LHb 0.0 2wct_A
LA
1439NHb 8.5 2wct_A precipitant
N
1440DHe 78.9 2wct_A
SKAGDL
1441LHe 37.1 2wct_A
LCADEFGIKNPQRSTV
1442NTe 53.9 2wct_A
NGSLADEKTVCFHIMPQRY
1443E e 23.1 2wct_A
ERVKP
1444T e 49.6 2wct_A
PGT
1445LEb 0.6 2wct_A
LI
1446VEb 0.0 2wct_A
VIC
1447TEb 0.0 2wct_A
TAMS
1448M e 27.5 2wct_A
MI
1449P b 3.9 2wct_A
P
1450LTb 0.0 2wct_A
IFL
1451GTb 0.0 2wct_A
G
1452YBe 35.7 2wct_A
YF
1453VTe 71.3 2wct_A homo
VI
1454TTe 24.7 2wct_A homo
TVS
1455HTe 23.6 2wct_A homo
HN
1456GSe 75.0 2wct_A homo
G
1457LBe 21.5 2wct_A homo
LQF
1458N e 45.5 2wct_A homo
DNT
1459LHb 13.5 2wct_A
L
1460EHe 38.7 2wct_A
AEI
1461EHe 35.2 2wct_A homo
QEV
1462AHb 0.0 2wct_A
AS
1463AHb 0.0 2wct_A
AG
1464RHe 20.2 2wct_A
RVSNQ
1465YHb 2.0 2wct_A
CYSVQ
1466MHb 5.3 2wct_A
MV
1467RTe 34.0 2wct_A
RK
1468STe 24.2 2wct_A
SGRKQ
1469L b 14.0 2wct_A
LVI
1470K e 57.3 2wct_A precipitant
KTN
1471VSb 2.7 2wct_A
VA
1472P e 57.4 2wct_A
P
1473AEe 26.8 2wct_A
YAH
1474TEb 14.7 2wct_A
VT
1475VEb 8.7 2wct_A
VC
1476SEb 1.6 2wct_A
LSV
1477V b 2.7 2wct_A
VL
1478SSe 68.0 2wct_A
ASP
1479SSe 35.9 2wct_A
SN
1480PHe 73.6 2wct_A
KPE
1481DHe 75.3 2wct_A
DES
1482AHb 10.7 2wct_A
QAS
1483VHb 18.0 2wct_A
VIADEFGKLNPQRST
1484THe 69.5 2wct_A
PTADEFGIKLNQRSV
1485AHe 37.0 2wct_A
ILATDEFGKNPQRSV
1486YHb 0.9 2wct_A
YLMADEFGIKNPQRSTV
1487NHb 10.3 2wct_A
NRE
1488GHe 34.5 2wct_A
GAS
1489YHe 33.5 2wct_A
YDI
1490LHb 16.9 2wct_A
LVF
1491THe 71.4 2wct_A
TNMLADEGKSVCFHIPQRY
1492SSe 57.8 2wct_A
SLADEGKTVCFHIMNPQRY
DISORDER predicted by DISOPRED
1493S e 62.5 2wct_A
SAGE
1494S b 16.4 2wct_A
SDIV
1495K----
KQTV
1496T----
TN
1497P----
PAS
1498E----
EVS
1499E----
EQT
1500H----
DHASY
1501F----
F
1502I----
IV
1503E----
ENVK
1504T----
TDHN
1505I----
VIT
1506S----
SLRIT
1507L----
LTAS
1508A----
NA
1509G----
G
1510S----
GSAM
1511Y----
YAGLDEFIKNPQRSTV
1512K----
RHNK
1513D----
DSC
1514W----
W
1515S----
HSD
1516Y----
LYV
1517S----
SLVT
1518G----
GQE
1519Q----
QTDE
1520S----
LRTDS
1521T----
TICL
1522Q----
VETRQ
1523L----
LKV
1524G----
GDN
1525I----
VRIADEFGKLNPQST
1526E----
KES
1527F----
FLIY
1528L----
LC
1529K----
KHN
1530R----
RW
1531G----
GS
1532D----
DNG
1533K----
QKT
1534S----
TYISV
1535V----
IVL
1536Y----
CY
1537Y----
YHF
1538T----
TAKGLDEFINPQRSVY
1539S----
DSGTE
1540N----
SND
1541P----
PTVKADEFGILNQRS
1542T----
FNIKTV
1543T----
YLEFTQ
1544F----
FYV
1545H----
VHA
1546L----
LKIV
1547D----
DNTK
1548G----
GDS
1549E----
EFKDTVQ
1550V----
VAI
1551I----
LSAVFI
1552T----
PTSKL
1553F----
FPLV
1554D----
DSAE
1555N----
DTKQSN
1556L----
LVI
1557K----
RKSE
1558T----
ARSTK
1559L----
LYFAC
1560L----
LRY
1561S----
ATSK
1562L e115.5 6wuu_B
LYSANDEGIKPQRTV
1563R e 96.4 6wuu_B
RLAKFDEGINPQSTV
1564E e 79.4 6wuu_B homo
ESADQGIKLNPRTV
1565V e 72.0 6wuu_B homo
AVTSQDEGIKLNPR
1566R e 47.4 6wuu_B homo
KRNQADEGILPSTV
1567TEe 52.6 6wuu_B homo
TVKNLP
1568IEb 7.0 6wuu_B homo
IV
1569KEe 57.1 6wuu_B homo
KDETQ
1570VEb 0.0 6wuu_B
VI
1571FEe 27.8 6wuu_B homo
LFYKVAGS
1572TEb 2.6 6wuu_B
VLTCAGS
1573TEb 0.0 6wuu_B metal CL
T
1574VSb 0.0 6wuu_B metal CL
VEIQ
1575DSb 6.2 6wuu_B metal CL
D
1576NSe 57.6 6wuu_B precipitant
GNQT
1577ISe 62.0 6wuu_B
VIRT
1578NSe 42.4 6wuu_B metal CL ZN homo
NSK
1579L e 43.3 6wuu_B precipitant
FVYL
1580HEe 25.7 6wuu_B metal CL ZN homo precipitant
RHKST
1581TEe 53.2 6wuu_B
TSDAN
1582QEe 37.2 6wuu_B metal MG precipitant
VCIQRH
1583VEe 54.7 6wuu_B homo
VCILTEKFS
1584VEb 0.7 6wuu_B
VL
1585DEe 22.8 6wuu_B
NSEDKTAP
1586MTb 13.5 6wuu_B homo
TSMPENVD
1587STe 48.4 6wuu_B
GSATDK
1588MSe 30.9 6wuu_B
EKQDMTAN
1589T b 16.2 6wuu_B homo
TSVN
1590YSb 0.0 6wuu_B
YFL
1591GTe 28.6 6wuu_B homo
GRE
1592QTe 63.3 6wuu_B homo
QKASV
1593QTe 29.1 6wuu_B homo
QTSIADEGKLNPRV
1594FTb 16.3 6wuu_B homo
LFIV
1595GSe 21.4 6wuu_B homo
G
1596PSe 41.1 6wuu_B homo
PSVQNTDAC
1597TEb 0.0 6wuu_B
VTCI
1598YEb 16.5 6wuu_B homo
FYALSV
1599LEb 15.2 6wuu_B
CLVYDAFEGIKNPQRST
1600DTe 92.6 6wuu_B
DKNEAL
1601GTe 45.2 6wuu_B
GDNAL
1602AEe 48.2 6wuu_B precipitant
AKVIHTS
1603DEe 51.2 6wuu_B homo precipitant
DNKRVI
1604V b 8.0 6wuu_B
VILWNAG
1605TTe 22.7 6wuu_B homo
TSKADEFGILNPQRV
1606KTe 83.5 6wuu_B homo
KDNGVAEFILPQRST
DISORDER predicted by DISOPRED
1607ISe 40.4 6wuu_B homo
VAILTKNFHG
DISORDER predicted by DISOPRED
1608K e 57.5 6wuu_B
KRINVFTLAG
DISORDER predicted by DISOPRED