#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57003 298 40 YP_009725311.1()
QUERYSEQ
SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1SSe 48.4 7jyy_A precipitant
AS
DISORDER predicted by DISOPRED
2SGe 64.1 7jyy_A
SATK
DISORDER predicted by DISOPRED
3QGe 21.9 7jyy_A
ASQN
DISORDER predicted by DISOPRED
4AGb 0.0 7jyy_A precipitant
DEA
5WGe 64.9 7jyy_A compound ADE precipitant
W
6QSe 41.3 7jyy_A metal CL precipitant
KQTN
7PSe 20.2 7jyy_A precipitant
PC
8GEb 2.4 7jyy_A precipitant
G
9VEb 5.3 7jyy_A metal CL
YLVH
10AEe 25.0 7jyy_A metal CL
SANTV
11M b 1.9 7jyy_A
M
12P e 46.5 7jyy_A metal CL precipitant
P
13NHe 58.8 7jyy_A compound ADN MGP metal CL precipitant
SVNEATGQ
14LHe 71.9 7jyy_A metal CL
LI
15YHb 18.7 7jyy_A
YF
16KHb 10.8 7jyy_A precipitant
K
17MTe 68.6 7jyy_A
VYIMLT
18Q e 42.3 7jyy_A
QL
19R e 73.5 7jyy_A metal CL
NREQ
20M e 29.5 7jyy_A
MSVCA
21L e 84.8 7jyy_A
CPNVL
22L e 32.6 7jyy_A
LM
23E e 68.8 7jyy_A
E
24K e 67.5 7jyy_A nucleotide
PRK
25C b 6.0 7jyy_A nucleotide compound GTA GTG V9G
CV
26D e 70.4 7jyy_A nucleotide compound GTA GTG V9G
NDSLEM
27L b 9.6 7jyy_A nucleotide compound GTA GTG V9G
LI
28QTe 81.6 7jyy_A metal CL
KYWPAQH
29NTb 13.3 7jyy_A metal CL NA
N
30YTe 67.0 7jyy_A nucleotide compound GTA GTG V9G
Y
31GTe 59.5 7jyy_A compound GTA GTG precipitant
GK
32D e 57.4 7jyy_A metal CL precipitant
QAKDVES
33S e 89.8 7jyy_A nucleotide metal CL precipitant
GPSNAQ
34A b 17.9 7jyy_A nucleotide metal CL precipitant
IVAQPL
35T e 77.9 7jyy_A metal CL precipitant
TKPFRNV
36L e 29.2 7jyy_A nucleotide metal CL
LMI
37P e 20.9 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC
P
38KTe 96.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA metal CL precipitant
QSTDKNR
39GTe 97.6 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA precipitant
GP
40I e 39.8 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA precipitant
IVCT
41M e 38.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA compound BDF metal CL precipitant
MHLTAGSDEFIKNPQRVY
42MHe 29.5 7jyy_A nucleotide metal CL precipitant
MIFLTADEGKNPQRSVY
43NHe 27.9 7jyy_A nucleotide compound SAM SAH SFG V9G metal CL precipitant
N
44VHe 24.7 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
VIF
45AHb 0.9 7jyy_A
AVQ
46KHb 6.1 7jyy_A nucleotide compound GTA GTG V9G precipitant
K
47YHb 1.3 7jyy_A compound SAM SAH SFG
Y
48THb 5.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
TDM
49QHb 0.0 7jyy_A
Q
50LHb 0.0 7jyy_A
LIM
51CHb 0.0 7jyy_A
C
52QHb 14.3 7jyy_A metal CL
QTD
53YHb 12.6 7jyy_A precipitant
YFADEGIKLNPQRSTV
54LHb 1.7 7jyy_A
LIF
55NTe 30.3 7jyy_A metal CL NA precipitant
NQFS
56TTe 64.3 7jyy_A compound ADN precipitant
TSADEK
57LSb 17.4 7jyy_A compound MGP 8NK ADN BDF metal NA CL precipitant
TCILADEFGKNPQRSVY
58T e 39.6 7jyy_A compound MGP 8NK ADN BDF metal CL precipitant
THDS
59L b 2.8 7jyy_A metal NA
LVMI
60A b 2.7 7jyy_A metal NA
AKC
61V b 0.7 7jyy_A
VI
62P b 0.8 7jyy_A
PA
63YTe 67.8 7jyy_A
HVARY
64NTe 64.8 7jyy_A
NKH
65M b 0.5 7jyy_A
MGAST
66REb 3.2 7jyy_A metal CL precipitant
RLH
67VEb 0.0 7jyy_A
VI
68IEb 1.2 7jyy_A
LWMIH
69HEb 0.0 7jyy_A
H
70FEb 0.0 7jyy_A
LFVY
71GSb 10.7 7jyy_A compound SAM SAH SFG
G
72A b 4.5 7jyy_A compound SAM SAH SFG
AN
73G b 19.0 7jyy_A compound SAM SAH SFG
GA
74S e 28.9 7jyy_A nucleotide compound SAM SAH SFG
SGC
75DTe 99.4 7jyy_A hetero K4LC41_9BETC nucleotide
DNEIVA
76KTe 59.0 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA nucleotide metal CL precipitant
KDSY
77GSe 34.5 7jyy_A
GEDAFIKLNPQRSTV
78VBe 38.0 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
VCYI
79A b 5.4 7jyy_A
ASC
80PHb 7.8 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA compound SAM SAH SFG
P
81GHb 3.6 7jyy_A compound SAM SAH SFG
G
82THb 0.0 7jyy_A
TDS
83AHe 31.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
AITVS
84VHb 1.3 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
V
85LHb 0.0 7jyy_A
L
86RHe 35.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA metal NA
RKS
87QHe 57.7 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA metal NA
QRS
88WHb 0.4 7jyy_A hetero K4LC41_9BETC metal NA
WFY
89LSb 5.1 7jyy_A hetero K4LC41_9BETC metal NA
LF
90P b 14.0 7jyy_A hetero K4LC41_9BETC
PDALEFGIKNQRSTVY
91TTe100.0 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
KAQTLEDHPS
92GTe 70.2 7jyy_A
DGEA
93T b 4.5 7jyy_A
ATCHS
94LEe 28.1 7jyy_A
LIVY
95LEb 0.6 7jyy_A
LVIADEFGKNPQRST
96VEb 1.3 7jyy_A
VYIT
97DEb 0.0 7jyy_A
DSH
98SEb 2.3 7jyy_A compound SFG SAH SAM
NWYST
99DEb 17.3 7jyy_A compound SAM SAH SFG
D
100LSe 62.9 7jyy_A compound SAM SAH SFG
LIVS
101NSe 64.8 7jyy_A compound SAM SAH SFG metal CL
NKRVYC
102D e 78.4 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA metal CL
DEPY
103F b 6.2 7jyy_A hetero K4LC41_9BETC
YFVC
104VBe 74.7 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
VALDEFGIKNPQRSTY
105S e 23.4 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
SALDEFGIKNPQRTVY
106D e 63.6 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
DALEFGIKNPQRSTVY
107ASb 12.5 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
ASLDEGIKNPRTVCFHMQY
108DSe 51.9 7jyy_A
DVHLAEGIKNPRSTCFMQY
109SEe 46.1 7jyy_A
SFAIVDYEGKLNPQRT
110TEe 33.1 7jyy_A
TSADEFGIKLNPQRV
111LEb 11.2 7jyy_A metal CL
LYVIADEFGKNPQRST
112IEe 36.8 7jyy_A metal NA CL precipitant
LFTIVYADEGKNPQRS
113GSe 20.2 7jyy_A compound SAM SAH SFG precipitant
GESALVDFHIKMNPQRTY
114D e 51.2 7jyy_A compound SAM SAH SFG
DSNAEFGIKLPQRTV
115CGb 4.0 7jyy_A compound SAM SAH SFG
CIK
116AGe 51.8 7jyy_A
ANPIVHEMST
117TGe 22.7 7jyy_A precipitant
TSVFK
118VEb 2.7 7jyy_A precipitant
LVYFMADEGIKPST
119HEe 45.0 7jyy_A precipitant
HYPDRKFAEGILSTV
120TEb 9.7 7jyy_A precipitant
LPTFVCISADEGK
121ASe 68.8 7jyy_A metal CL precipitant
NEDGAVSTIKLP
122NSb 3.6 7jyy_A metal CL precipitant
DCNQFHAEGIKLPSTV
123K e 39.6 7jyy_A precipitant
KQREH
124WEb 0.0 7jyy_A
WFPV
125DEb 1.9 7jyy_A
DNK
126LEb 1.1 7jyy_A
LF
127IEb 0.0 7jyy_A
ILV
128IEb 0.0 7jyy_A
IVLF
129SEb 0.0 7jyy_A
S
130D b 12.3 7jyy_A nucleotide compound SAM SAH SFG
D
131M b 10.6 7jyy_A compound SAM SAH SFG
MVIL
132Y e 28.7 7jyy_A nucleotide compound SAM SAH GTA SFG GTG V9G metal CL precipitant
Y
133D e 26.5 7jyy_A precipitant
DNA
134PGe 80.6 7jyy_A nucleotide compound GTA GTG V9G
PGSALVDEFHIKMNQRTY
135KGe 67.9 7jyy_A
RVKDLSCNTI
136TGb 10.4 7jyy_A compound GTA precipitant
TSRIL
137KGe 69.3 7jyy_A nucleotide compound GTA GTG V9G precipitant
KSALDEFGINPQRTVY
138NSe 67.3 7jyy_A
NSHAFVLDEGIKPQRTY
139V e 54.7 7jyy_A nucleotide compound GTA GTG
VICGLTADEFKNPQRS
140T e 68.2 7jyy_A
SDGTVLAEFIKNPQR
141KSe 58.0 7jyy_A metal CL
EGIKLDAFNPQRSTV
142E e 70.9 7jyy_A
EVDAYSTFGIKLNPQR
143N b 14.5 7jyy_A
NLIADEFGKPQRSTV
144D e 53.1 7jyy_A
VEDTNGQAFIKLPRS
145S b 11.7 7jyy_A precipitant
SDGVATEFIKLNPQR
146K e 23.6 7jyy_A metal CL precipitant
KNHLADEGIPRSTVCFMQY
147E e 71.4 7jyy_A metal CL precipitant
DEAVLGIKPRSTCFHMNQY
148GSe 53.6 7jyy_A metal CL precipitant
GDLVAEFIKNPQRSTY
149FHb 13.4 7jyy_A compound SAM SAH SFG precipitant
FVRLADEGIKNPQSTY
150FHb 1.4 7jyy_A precipitant
FTCLADEGIKNPQRSVY
151THe 45.5 7jyy_A metal CL
TSIVPLADEFGKNQRY
152YHb 17.0 7jyy_A metal CL precipitant
YLADEFGIKNPQRSTV
153IHb 0.0 7jyy_A
LIAVDEFGKNPQRSTY
154CHb 6.7 7jyy_A
CNLSTADEFGIKPQRVY
155GHe 20.2 7jyy_A
GEHNSYLADFIKPQRTV
156FHb 2.9 7jyy_A
FYLVMADEGIKNPQRST
157IHb 0.0 7jyy_A
ICML
158QHe 54.1 7jyy_A metal NA
RKQVTCN
159QHe 59.2 7jyy_A metal CL precipitant
NEHDQS
160KHe 24.1 7jyy_A metal CL precipitant
KNRH
161LEb 1.7 7jyy_A
L
162AEb 0.0 7jyy_A
ARS
163LEb 17.4 7jyy_A
LI
164GEb 0.0 7jyy_A metal NA
G
165GEb 1.2 7jyy_A metal NA
G
166SEb 3.1 7jyy_A metal NA
ST
167VEb 1.3 7jyy_A
VIFA
168AEb 0.0 7jyy_A
AMIV
169IEb 0.0 7jyy_A
IFWV
170KEb 6.6 7jyy_A nucleotide compound GTA GTG V9G SAM precipitant
K
171IEb 0.0 7jyy_A
ITMLV
172T b 7.8 7jyy_A nucleotide compound GTA GTG V9G metal NA CL precipitant
T
173ESb 11.1 7jyy_A nucleotide compound GTA GTG V9G metal NA precipitant
E
174HSe 23.0 7jyy_A nucleotide compound GTA GTG V9G metal NA CL precipitant
FHTSY
175SSb 0.8 7jyy_A nucleotide compound GTA V9G
S
176W b 0.4 7jyy_A
WRI
177N b 1.2 7jyy_A precipitant
NDSHAEFGIKLPQRTV
178AHb 2.7 7jyy_A precipitant
AKILEV
179DHe 51.9 7jyy_A precipitant
QDEKSY
180LHb 0.0 7jyy_A
LV
181YHb 0.0 7jyy_A
YSN
182KHe 36.8 7jyy_A
EKQDAS
183LHb 3.9 7jyy_A
LIFV
184MHb 0.0 7jyy_A
MIVTA
185GTb 0.0 7jyy_A
GKQS
186HTb 13.1 7jyy_A metal CL precipitant
YRKHD
187FEb 0.0 7jyy_A
FC
188AEb 18.8 7jyy_A compound MGP 8NK
ASEGN
189WEe 32.7 7jyy_A compound MGP 8NK ADN BDF precipitant
WFYAS
190WEb 1.6 7jyy_A precipitant
WV
191TEb 0.6 7jyy_A
TKHQ
192AEb 0.0 7jyy_A
VAFMLCI
193FEb 0.0 7jyy_A
FV
194VEb 0.7 7jyy_A
CTV
195TEb 1.3 7jyy_A
TAF
196NGb 0.6 7jyy_A
NSAG
197VGb 1.3 7jyy_A
VA
198NGb 17.0 7jyy_A nucleotide compound GTA V9G GTG metal NA MG precipitant
N
199ATb 0.0 7jyy_A
TAYS
200STb 4.7 7jyy_A
S
201SSe 21.1 7jyy_A nucleotide compound GTA GTG V9G precipitant
S
202SSb 13.3 7jyy_A nucleotide compound GTA GTG V9G precipitant
S
203E b 4.0 7jyy_A nucleotide compound GTA GTG V9G precipitant
E
204AEb 0.0 7jyy_A
AGVT
205FEb 0.0 7jyy_A
F
206LEb 0.0 7jyy_A
LV
207IEb 0.0 7jyy_A
IVFL
208GEb 0.0 7jyy_A
GC
209CEb 0.7 7jyy_A compound MGP 8NK ADN BDF
IVAC
210NEb 0.6 7jyy_A compound MGP 8NK metal NA
NGH
211YEb 5.7 7jyy_A metal NA
YFW
212L b 10.1 7jyy_A
LTI
213GSe 42.9 7jyy_A precipitant
GN
214KSe 50.5 7jyy_A precipitant
KADPEVRTS
215P e 48.1 7jyy_A precipitant
PSFTLYIDAEGV
216RSe 49.4 7jyy_A precipitant
KRCGAIN
217ESe 31.7 7jyy_A precipitant
EAVQDTF
218Q e 78.1 7jyy_A
EKGIQVLN
219I b 3.5 7jyy_A metal CL precipitant
IVL
220D e 42.6 7jyy_A metal NA CL
DSA
221GHb 3.6 7jyy_A
G
222YHe 56.5 7jyy_A compound ADE
NKYWG
223VHb 14.7 7jyy_A metal CL
TVIQA
224MHb 6.3 7jyy_A metal CL
MLIV
225HHb 0.0 7jyy_A
H
226AHb 0.9 7jyy_A
A
227NHb 0.0 7jyy_A
NI
228YHb 0.0 7jyy_A
YI
229IHb 0.6 7jyy_A
IVLC
230FHe 33.5 7jyy_A
F
231WHb 1.2 7jyy_A
W
232RHb 2.0 7jyy_A
R
233NHe 25.5 7jyy_A
N
234THe 41.6 7jyy_A
STC
235NSe 32.7 7jyy_A
TN
236P e 33.3 7jyy_A metal CL
IPVYMLT
237I b 1.8 7jyy_A
MWIL
238Q e 28.6 7jyy_A metal CL precipitant
NQAST
239L b 18.0 7jyy_A precipitant
LGMT
240S b 3.1 7jyy_A precipitant
SG
241S b 7.8 7jyy_A precipitant
AYSHT
242YGe 48.7 7jyy_A precipitant
YN
243SGb 11.7 7jyy_A
S
244LGb 11.2 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
LVI
245FGe 68.9 7jyy_A
FLY
246D e 62.3 7jyy_A
D
247M e 30.4 7jyy_A hetero R1AB_SARS2 K4LC41_9BETC R1AB_CVHSA R1A_CVHSA
LMTV
248STe 68.0 7jyy_A hetero R1AB_SARS2 R1AB_CVHSA R1A_CVHSA
SAPQ
249KTe 79.2 7jyy_A metal CL NA
KR
250F b 2.9 7jyy_A metal NA
F
251PSe 60.5 7jyy_A hetero K4LC41_9BETC metal NA precipitant
PKNSDEQ
252L b 8.4 7jyy_A precipitant
LC
253K e 77.4 7jyy_A precipitant
KR
254L e 44.9 7jyy_A
LHCV
255R e 42.3 7jyy_A metal CL
KANR
256G e 25.0 7jyy_A
GAN
257T b 7.8 7jyy_A
TA
258AEe 48.2 7jyy_A
PAVL
259VEe 32.7 7jyy_A
VI
260MEe 34.8 7jyy_A
VMLI
261S e 62.5 7jyy_A
NSQT
262L e 23.0 7jyy_A
L
263K e 73.1 7jyy_A
KR
264ETe 93.0 7jyy_A
EDPTA
265GTe 95.2 7jyy_A
SDKEGN
266QTe 47.4 7jyy_A
QEDS
267I e 25.1 7jyy_A precipitant
ILVK
268N e 50.9 7jyy_A metal CL precipitant
NTS
269DHe 84.0 7jyy_A metal CL precipitant
DE
270MHe 63.3 7jyy_A
LMV
271IHb 12.9 7jyy_A
VI
272LHb 11.8 7jyy_A precipitant
LIYF
273SHe 41.4 7jyy_A
SGN
274LHe 28.7 7jyy_A
L
275LHb 0.0 7jyy_A
LIV
276SHe 32.8 7jyy_A compound MGP 8NK metal MG
KRES
277KTe 51.4 7jyy_A precipitant
KQSNCAR
278GTb 0.0 7jyy_A
G
279R e 59.7 7jyy_A metal CL precipitant
KR
280LEb 2.2 7jyy_A
L
281IEb 0.0 7jyy_A
LI
282IEb 5.3 7jyy_A
IVL
283RSb 3.6 7jyy_A precipitant
R
284E e 59.8 7jyy_A metal CL precipitant
DNEG
285N e 60.0 7jyy_A precipitant
NTV
286N e 53.9 7jyy_A metal CL precipitant
GDNR
287R e 81.8 7jyy_A
KRTNAV
288V e 32.0 7jyy_A
LVETCI
289V e 42.7 7jyy_A
LVSCIN
290IEb 19.9 7jyy_A
FVNGSI
291SEe 46.1 7jyy_A
FSVT
292SEe 20.3 7jyy_A metal NA precipitant
SGT
293D e 51.9 7jyy_A metal NA precipitant
DN
294V e 81.3 7jyy_A
HSVI
295L e 86.0 7jyy_A
LF
DISORDER predicted by DISOPRED
296V e 84.0 7jyy_A
VI
DISORDER predicted by DISOPRED
297N e 66.7 7jyy_A
NS
DISORDER predicted by DISOPRED
298N e138.2 7jyy_A
NS
DISORDER predicted by DISOPRED