[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
57771 73 0 P0DTD3(Y14_SARS2) RecName: Full=Uncharacterized protein 14;
QUERYSEQ
MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
DISORDER predicted by DISOPRED
2L----
L
3Q----
PQ
4S----
SP
5C----
C
6Y----
Y
7N----
N
8F----
F
9L----
L
10K----
K
11E----
E
12Q----
Q
13H----
H
14C----
C
15Q----
Q
16K----
K
17A----
A
18S----
S
19T----
T
20Q----
Q
21K----
KR
22G----
GE
23A----
A
24E----
E
25A----
A
26A----
A
27V----
V
28K----
K
29P----
P
30L----
L
31L----
L
32V----
AV
33P----
PL
34H----
H
35H----
H
36V----
V
37V----
V
38A----
A
39T----
VT
40V----
IV
41Q----
Q
42E----
E
43I----
I
44Q----
Q
45L----
L
46Q----
LQ
47A----
A
48A----
A
49V----
V
50G----
G
51E----
E
52L----
IL
53L----
L
54L----
LQ
55L----
L
56E----
E
57W----
W
58L----
L
59A----
A
60M----
EM
61A----
AV
62V----
V
63M----
KM
64L----
L
65L----
PL
66L----
SL
67L----
RL
68C----
YC
69C----
C
70C----
C
71L----
72T----
73D----