[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200916.fasta
           550,177 sequences; 147,959,631 total letters



Query= sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6
PE=1 SV=1

Length=212
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  4cni_D D INTERLEUKIN-6                                               353    2e-123
  4cni_C C INTERLEUKIN-6                                               353    2e-123
  4j4l_D D Interleukin-6                                               341    9e-119
  1il6_A A INTERLEUKIN-6                                               341    2e-118
  2il6_A A INTERLEUKIN-6                                               341    2e-118
  1p9m_B B Interleukin-6                                               333    2e-115
  1alu_A A INTERLEUKIN-6                                               321    1e-110
  5fuc_B B INTERLEUKIN-6                                               308    8e-106
  5fuc_A A INTERLEUKIN-6                                               306    3e-105
  4o9h_A A Interleukin-6                                               307    5e-105
  4j4l_C C Interleukin-6                                               295    1e-100
  4ni9_B A Interleukin-6                                               287    4e-97 
  4ni7_A A Interleukin-6                                               285    3e-96 
  4zs7_A A Interleukin-6                                               280    2e-94 
  4ni9_C C Interleukin-6                                               276    4e-93 
  2l3y_A A Interleukin-6                                               152    3e-44 
  1i1r_B B VIRAL IL-6                                                 77.0    3e-16 
  1cd9_A A PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)            32.3    1.5   
  1cd9_C C PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)            32.3    1.7   
  2d9q_A A CSF3                                                       32.3    1.7   
  5zo6_A X Granulocyte colony-stimulating factor                      32.0    1.7   
  5gw9_B B Granulocyte colony-stimulating factor                      31.6    2.2   
  5gw9_A A Granulocyte colony-stimulating factor                      31.6    2.2   
  5gw9_D D Granulocyte colony-stimulating factor                      31.6    2.2   
  5gw9_C C Granulocyte colony-stimulating factor                      31.6    2.2   


> 4cni_D D INTERLEUKIN-6
Length=171 Score = 353 bits (906), Expect = 2e-123, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%) Query 42 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC 101 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC Sbjct 1 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC 60 Query 102 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL 161 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL Sbjct 61 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL 120 Query 162 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 121 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 171
> 4cni_C C INTERLEUKIN-6
Length=171 Score = 353 bits (906), Expect = 2e-123, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%) Query 42 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC 101 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC Sbjct 1 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC 60 Query 102 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL 161 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL Sbjct 61 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL 120 Query 162 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 121 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 171
> 4j4l_D D Interleukin-6
Length=168 Score = 341 bits (875), Expect = 9e-119, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF Sbjct 3 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 62 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 63 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 122 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 123 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 168
> 1il6_A A INTERLEUKIN-6
Length=185 Score = 341 bits (875), Expect = 2e-118, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF Sbjct 20 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 79 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 80 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 139 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 140 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 185
> 2il6_A A INTERLEUKIN-6
Length=185 Score = 341 bits (875), Expect = 2e-118, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF Sbjct 20 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 79 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 80 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 139 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 140 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 185
> 1p9m_B B Interleukin-6
Length=186 Score = 333 bits (854), Expect = 2e-115, Method: Compositional matrix adjust. Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNK CESSKEALAENNLNLPKMAEKDGCFQSGF Sbjct 21 LTSSERIDKQIRYILDGISALRKETCNKXXXCESSKEALAENNLNLPKMAEKDGCFQSGF 80 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 81 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 140 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 141 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 1alu_A A INTERLEUKIN-6
Length=186 Score = 321 bits (823), Expect = 1e-110, Method: Compositional matrix adjust. Identities = 157/166 (95%), Positives = 157/166 (95%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNKSNMCE NLNLPKMAEKDGCFQSGF Sbjct 21 LTSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXNLNLPKMAEKDGCFQSGF 80 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 81 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 140 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 141 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 5fuc_B B INTERLEUKIN-6
Length=166 Score = 308 bits (789), Expect = 8e-106, Method: Compositional matrix adjust. Identities = 160/164 (98%), Positives = 160/164 (98%), Gaps = 0/164 (0%) Query 49 SSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE 108 SSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE Sbjct 3 SSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE 62 Query 109 ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPD 168 ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAK ITTPD Sbjct 63 ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKXXXXITTPD 122 Query 169 PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 123 PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 166
> 5fuc_A A INTERLEUKIN-6
Length=166 Score = 306 bits (785), Expect = 3e-105, Method: Compositional matrix adjust. Identities = 150/165 (91%), Positives = 151/165 (92%), Gaps = 0/165 (0%) Query 48 TSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN 107 +SSERIDKQIRYILDGISALRKETCNKSNMCE NLPKMAEKDGCFQSGFN Sbjct 2 SSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXXXNLPKMAEKDGCFQSGFN 61 Query 108 EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP 167 EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA DAITTP Sbjct 62 EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAXXXDAITTP 121 Query 168 DPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 DPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 122 DPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 166
> 4o9h_A A Interleukin-6
Length=186 Score = 307 bits (786), Expect = 5e-105, Method: Compositional matrix adjust. Identities = 152/166 (92%), Positives = 152/166 (92%), Gaps = 0/166 (0%) Query 47 LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGF 106 LTSSERIDKQIRYILDGISALRKETCNKSN NLNLPKMAEKDGCFQSGF Sbjct 21 LTSSERIDKQIRYILDGISALRKETCNKSNXXXXXXXXXXXXNLNLPKMAEKDGCFQSGF 80 Query 107 NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 166 NEETCLVKIITGLLEFEVYLEYLQNR SSEEQARAVQMSTKVLIQFLQKKAKNLDAITT Sbjct 81 NEETCLVKIITGLLEFEVYLEYLQNRXXSSEEQARAVQMSTKVLIQFLQKKAKNLDAITT 140 Query 167 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 141 PDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 4j4l_C C Interleukin-6
Length=168 Score = 295 bits (755), Expect = 1e-100, Method: Compositional matrix adjust. Identities = 153/167 (92%), Positives = 153/167 (92%), Gaps = 0/167 (0%) Query 46 PLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSG 105 LTSSERIDKQIRYILDGISALRKETCNKSNMCE NLNLPKMAEKDGCFQSG Sbjct 2 SLTSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXNLNLPKMAEKDGCFQSG 61 Query 106 FNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAIT 165 FNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKN T Sbjct 62 FNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNXXXXT 121 Query 166 TPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 TPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 122 TPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 168
> 4ni9_B A Interleukin-6
Length=186 Score = 287 bits (734), Expect = 4e-97, Method: Compositional matrix adjust. Identities = 144/171 (84%), Positives = 144/171 (84%), Gaps = 0/171 (0%) Query 42 PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC 101 PHRQPLTSSERIDKQIRYILDGISALRKET NLNLPKMAEKDGC Sbjct 16 PHRQPLTSSERIDKQIRYILDGISALRKETXXXXXXXXXXXXXXXXXNLNLPKMAEKDGC 75 Query 102 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL 161 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA Sbjct 76 FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAXXX 135 Query 162 DAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 136 XXXXXXXPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 4ni7_A A Interleukin-6
Length=186 Score = 285 bits (728), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 151/169 (89%), Positives = 151/169 (89%), Gaps = 0/169 (0%) Query 44 RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQ 103 RQPLTSSERIDKQIRYILDGISALRKETCNKS NLNLPKMAEKDGCFQ Sbjct 18 RQPLTSSERIDKQIRYILDGISALRKETCNKSXXXXXXXXXXXXXNLNLPKMAEKDGCFQ 77 Query 104 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDA 163 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA Sbjct 78 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAXXXXX 137 Query 164 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 138 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 4zs7_A A Interleukin-6
Length=171 Score = 280 bits (715), Expect = 2e-94, Method: Compositional matrix adjust. Identities = 139/162 (86%), Positives = 139/162 (86%), Gaps = 0/162 (0%) Query 51 ERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEET 110 ERIDKQIRYILDGISALRKETCNKSN NLPKMAEKDGCFQSGFNEET Sbjct 10 ERIDKQIRYILDGISALRKETCNKSNXXXXXXXXXXXXXXNLPKMAEKDGCFQSGFNEET 69 Query 111 CLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPT 170 CLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLD DPT Sbjct 70 CLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDXXXXXDPT 129 Query 171 TNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 TNASLLTKLQ WLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 130 TNASLLTKLQXXXXWLQDMTTHLILRSFKEFLQSSLRALRQM 171
> 4ni9_C C Interleukin-6
Length=186 Score = 276 bits (707), Expect = 4e-93, Method: Compositional matrix adjust. Identities = 148/169 (88%), Positives = 148/169 (88%), Gaps = 0/169 (0%) Query 44 RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQ 103 RQPLTSSERIDKQIRYILDGISALRKET NNLNLPKMAEKDGCFQ Sbjct 18 RQPLTSSERIDKQIRYILDGISALRKETXXXXXXXXXXXXXXXXNNLNLPKMAEKDGCFQ 77 Query 104 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDA 163 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA Sbjct 78 SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAXXXXX 137 Query 164 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Sbjct 138 ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 186
> 2l3y_A A Interleukin-6
Length=190 Score = 152 bits (383), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 74/185 (40%), Positives = 123/185 (66%), Gaps = 3/185 (2%) Query 28 APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAE 87 + V G+ ++D P+R P+ ++ ++ I ++L I +RKE CN ++ C ++ +ALAE Sbjct 7 SQVRRGDFTED-TTPNR-PVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAE 64 Query 88 NNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRF-ESSEEQARAVQMS 146 NNL LP++ DGC+Q+G+N+E CL+KI +GLLE+ YLEY++N ++ +++AR +Q Sbjct 65 NNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRD 124 Query 147 TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSL 206 T+ LI ++ K+L I P P +NA L KL++Q +WL+ T IL+S +EFL+ +L Sbjct 125 TETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTL 184 Query 207 RALRQ 211 R+ RQ Sbjct 185 RSTRQ 189
> 1i1r_B B VIRAL IL-6
Length=181 Score = 77.0 bits (188), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 41/155 (26%), Positives = 76/155 (49%), Gaps = 0/155 (0%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +++ ++L I ++ C ++ +C+ E A +L LP + + D C GFNE +CL K Sbjct 14 QRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKK 73 Query 115 IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNAS 174 + G EFEV ++L F S +++ TK L +Q++ L P + Sbjct 74 LADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRG 133 Query 175 LLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL 209 LL +LQ W++ + +L + ++F ++R L Sbjct 134 LLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVL 168
> 1cd9_A A PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
Length=175 Score = 32.3 bits (72), Expect = 1.5, Method: Compositional matrix adjust. Identities = 31/160 (19%), Positives = 63/160 (39%), Gaps = 9/160 (6%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 20 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 78 Query 115 IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNA- 173 + +GL ++ L+ L+ +Q+ + ++ + L PT A Sbjct 79 LHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAM 138 Query 174 -SLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 212 + + Q + + L+ + FL+ S R LR + Sbjct 139 PAFASAFQRRAGGV------LVASHLQSFLEVSYRVLRHL 172
> 1cd9_C C PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
Length=175 Score = 32.3 bits (72), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 20 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 78 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 79 LHSGLFLYQGLLQALEG 95
> 2d9q_A A CSF3
Length=174 Score = 32.3 bits (72), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 19 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 77 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 78 LHSGLFLYQGLLQALEG 94
> 5zo6_A X Granulocyte colony-stimulating factor
Length=166 Score = 32.0 bits (71), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 13 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 71 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 72 LHSGLFLYQGLLQALEG 88
> 5gw9_B B Granulocyte colony-stimulating factor
Length=163 Score = 31.6 bits (70), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 10 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 68 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 69 LHSGLFLYQGLLQALEG 85
> 5gw9_A A Granulocyte colony-stimulating factor
Length=163 Score = 31.6 bits (70), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 10 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 68 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 69 LHSGLFLYQGLLQALEG 85
> 5gw9_D D Granulocyte colony-stimulating factor
Length=163 Score = 31.6 bits (70), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 10 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 68 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 69 LHSGLFLYQGLLQALEG 85
> 5gw9_C C Granulocyte colony-stimulating factor
Length=163 Score = 31.6 bits (70), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%) Query 55 KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK 114 +Q+R I +AL+++ C +C + L ++L +P A C CL + Sbjct 10 EQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQLAGCLSQ 68 Query 115 IITGLLEFEVYLEYLQN 131 + +GL ++ L+ L+ Sbjct 69 LHSGLFLYQGLLQALEG 85 Lambda K H a alpha 0.316 0.130 0.363 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 8918896422 Database: unitmol_20200916.fasta Posted date: Sep 16, 2020 2:18 PM Number of letters in database: 147,959,631 Number of sequences in database: 550,177 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40