[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo
sapiens OX=9606 GN=IL6R PE=1 SV=1

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  1n26_A A IL-6 Receptor alpha chain                                   624    0.0   
  1p9m_C C Interleukin-6 receptor alpha chain                          424    1e-146
  5fuc_C C INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RE...   414    2e-142
  5fuc_D D INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RE...   409    2e-140
  2arw_A A Interleukin-6 receptor alpha chain                          221    8e-69 
  6o4p_A A Interleukin-11 receptor subunit alpha                       103    2e-23 
  6o4p_B B Interleukin-11 receptor subunit alpha                       103    2e-23 
  1uc6_A A Ciliary Neurotrophic Factor Receptor alpha                 69.7    5e-13 
  1f42_A A INTERLEUKIN-12 BETA CHAIN                                  60.8    5e-09 
  3duh_A A Interleukin-12 subunit beta                                60.1    9e-09 
  5mzv_A A Interleukin-12 subunit beta                                59.7    1e-08 
  3hmx_A A Interleukin-12 subunit beta                                58.2    4e-08 
  4grw_B B Interleukin-12 subunit beta                                58.2    4e-08 
  3qwr_A A Interleukin-12 subunit beta                                57.8    4e-08 
  5mj3_A A Interleukin-12 subunit beta                                57.8    5e-08 
  3d87_B B Interleukin-12 subunit p40                                 57.4    6e-08 
  3d87_D D Interleukin-12 subunit p40                                 57.0    9e-08 
  5mxa_B A Interleukin-12 subunit beta                                55.8    2e-07 
  1bqu_B B PROTEIN (GP130)                                            53.9    3e-07 
  1pvh_A A Interleukin-6 receptor beta chain                          53.9    3e-07 
  1pvh_C C Interleukin-6 receptor beta chain                          53.9    3e-07 
  3l5h_A A Interleukin-6 receptor subunit beta                        55.8    4e-07 
  1bqu_A A PROTEIN (GP130)                                            53.9    4e-07 
  1i1r_A A INTERLEUKIN-6 RECEPTOR BETA CHAIN                          54.7    5e-07 
  3duh_B B Interleukin-12 subunit beta                                54.7    5e-07 
  1p9m_A A Interleukin-6 receptor beta chain                          54.3    6e-07 
  5njd_E E Interleukin-12 subunit beta                                53.9    8e-07 
  5njd_C C Interleukin-12 subunit beta                                53.9    1e-06 
  4grw_D D Interleukin-12 subunit beta                                53.5    1e-06 
  1f45_A A INTERLEUKIN-12 BETA CHAIN                                  52.8    2e-06 
  5njd_A A Interleukin-12 subunit beta                                52.8    2e-06 
  5njd_I I Interleukin-12 subunit beta                                52.8    2e-06 
  5mj4_A A Interleukin-12 subunit beta                                52.4    3e-06 
  5njd_G G Interleukin-12 subunit beta                                52.4    3e-06 
  5njd_K K Interleukin-12 subunit beta                                52.4    3e-06 
  3d85_D D Interleukin-12 subunit p40                                 50.4    1e-05 
  1bj8_A A GP130                                                      46.6    3e-05 
  3ew3_B B Prolactin receptor                                         48.1    3e-05 
  3npz_B B Prolactin receptor                                         48.1    3e-05 
  3ncb_B B Prolactin receptor                                         46.6    1e-04 
  3n0p_B B Prolactin receptor                                         46.6    1e-04 
  3mzg_B B Prolactin receptor                                         46.6    1e-04 
  3n06_B B Prolactin receptor                                         46.6    1e-04 
  3npz_C C Prolactin receptor                                         46.6    1e-04 
  3nce_B B Prolactin receptor                                         45.8    2e-04 
  3ncf_B B Prolactin receptor                                         45.8    2e-04 
  3ncc_B B Prolactin receptor                                         45.8    2e-04 
  6uib_B B Interleukin-12 subunit beta                                46.2    2e-04 
  3d48_B R Prolactin receptor                                         45.1    4e-04 
  4i18_E R Prolactin receptor                                         43.9    8e-04 
  1f6f_B B PROLACTIN RECEPTOR                                         43.5    0.001 
  4i18_F C Prolactin receptor                                         42.0    0.004 
  6sff_A A Interleukin-12 subunit beta                                42.4    0.004 
  6sp3_B B Interleukin-12 subunit beta                                42.0    0.006 
  6smc_B B Interleukin-12 subunit beta                                42.0    0.006 
  6smc_A A Interleukin-12 subunit beta                                42.0    0.006 
  6smc_C C Interleukin-12 subunit beta                                42.0    0.006 
  6sp3_A A Interleukin-12 subunit beta                                42.0    0.007 
  3ew3_C C Prolactin receptor                                         40.8    0.010 
  1bp3_B B PROTEIN (PROLACTIN RECEPTOR)                               40.4    0.012 
  2lfg_A A Prolactin receptor                                         37.0    0.059 
  6smc_D D Interleukin-12 subunit beta                                38.5    0.081 
  2djs_A A Ephrin type-B receptor 1                                   35.4    0.15  
  6ani_D L Coltuximab Fab light chain                                 36.2    0.29  
  6ani_F M Coltuximab Fab light chain                                 36.2    0.31  
  5uix_B L DH576 Fab light chain                                      36.2    0.33  
  4hs8_C L antibody hu5B3.v2 Fab light chain                          35.8    0.39  
  1p2c_A A light chain anti-lysozyme antibody F10.6.6                 35.8    0.39  
  2q76_C C Fab F10.6.6 fragment Light Chain                           35.8    0.39  
  2q76_A A Fab F10.6.6 fragment Light Chain                           35.8    0.39  
  1p2c_D D light chain anti-lysozyme antibody F10.6.6                 35.8    0.40  
  6pis_F M ANTIBODY FAB FRAGMENT LIGHT CHAIN                          35.4    0.48  
  6pis_C L ANTIBODY FAB FRAGMENT LIGHT CHAIN                          35.4    0.48  
  1x5l_A A Ephrin type-A receptor 8                                   33.9    0.65  
  5oj6_B B MAM domain-containing glycosylphosphatidylinositol anc...  35.8    0.72  
  5kte_C L Fab Light Chain                                            34.7    0.89  
  6d9w_C L Fab Light Chain                                            34.7    0.89  
  1mlc_A A IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)                         34.7    0.95  
  1mlc_C C IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)                         34.7    0.95  
  1mlb_A A IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)                         34.7    0.95  
  5u8q_D L Fv 24-60 light chain                                       33.1    0.97  
  5u8r_C L Fv 24-60 light chain                                       33.1    1.0   
  5oj2_A A MAM domain-containing glycosylphosphatidylinositol anc...  35.0    1.1   
  1v7n_E N Monoclonal TN1 Fab Light Chain                             33.9    1.5   
  1v7n_C M Monoclonal TN1 Fab Light Chain                             33.9    1.5   
  1v7m_D M Monoclonal TN1 Fab Light Chain                             33.9    1.5   
  1v7m_A L Monoclonal TN1 Fab Light Chain                             33.9    1.5   
  5oj2_B B MAM domain-containing glycosylphosphatidylinositol anc...  34.7    1.5   
  2a0l_C C 33H1 Fv fragment                                           32.3    1.5   
  2a0l_E E 33H1 Fv fragment                                           32.3    1.5   
  1dqq_A A ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)              33.9    1.6   
  1dqq_C C ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)              33.9    1.6   
  1ndg_A A antibody kappa light chain                                 33.9    1.6   
  1dqj_A A ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)              33.9    1.6   
  1dqm_A L ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)              33.9    1.6   
  1xgu_A A antibody kappa light chain                                 33.9    1.6   
  1nby_A A antibody kappa light chain                                 33.9    1.6   
  1ndm_A A antibody kappa light chain                                 33.9    1.6   
  1nbz_A A antibody kappa light chain                                 33.9    1.6   
  6gc2_A L Light Chain                                                34.3    1.6   
  1cd9_B B PROTEIN (G-CSF RECEPTOR)                                   33.9    1.6   
  2zkh_A L Monoclonal TN1 FAB light chain                             33.9    1.6   
  1xgt_A A antibody kappa light chain                                 33.9    1.7   
  1xgr_A A antibody kappa light chain                                 33.9    1.7   
  1xgq_A A antibody kappa light chain                                 33.9    1.7   
  1xgp_A A antibody kappa light chain                                 33.9    1.7   
  6df0_A L 4G10-4D5 Antibody Light chain                              33.9    1.7   
  1v7n_A L Monoclonal TN1 Fab Light Chain                             33.9    1.8   
  1v7n_G O Monoclonal TN1 Fab Light Chain                             33.9    1.8   
  6df1_A L Anti-phosphotyrosine antibody 4G10-4D5 heavy chain         33.9    1.9   
  6v4p_D D Abciximab, light chain                                     33.5    2.1   
  25c8_A L IGG 5C8                                                    33.5    2.3   
  35c8_A L IGG 5C8                                                    33.5    2.3   
  15c8_A L IGG 5C8 FAB (LIGHT CHAIN)                                  33.5    2.3   
  4ffv_C C 11A19 Fab light chain                                      33.5    2.4   
  4ffv_E L 11A19 Fab light chain                                      33.5    2.4   
  1bm3_A L IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN                   33.5    2.4   
  1opg_A L OPG2 FAB (LIGHT CHAIN)                                     33.5    2.4   
  6u6u_B L BI00655130 Fab light chain                                 33.5    2.5   
  6djp_D D 8B8 light chain Fab                                        33.1    2.7   
  5opy_B L Light chain of LM609 Fab (antigen-binding fragment)        33.1    2.8   
  1ors_A A 33H1 Fab light chain                                       33.1    2.8   
  6avq_D L LM609 Fab light chain                                      33.1    2.8   
  6avr_D L Fab LM609 light chain                                      33.1    2.8   
  6avu_D L Fab LM609 light chain                                      33.1    2.8   
  2brr_B L MN20B9.34 ANTI-P1.4 ANTIBODY, FAB LIGHT CHAIN              33.1    2.9   
  6k7o_I L h128-3 Fab light chain                                     33.1    2.9   
  6k7o_G G h128-3 Fab light chain                                     33.1    2.9   
  6k7o_C C h128-3 Fab light chain                                     33.1    2.9   
  6k7o_E E h128-3 Fab light chain                                     33.1    2.9   
  2brr_D X MN20B9.34 ANTI-P1.4 ANTIBODY, FAB LIGHT CHAIN              33.1    2.9   
  5gir_B L Light chain of Fab fragment                                33.1    3.5   
  5gir_D B Light chain of Fab fragment                                33.1    3.5   
  5gis_B L Light chain of Fab fragment                                33.1    3.5   
  3iu3_B B Light chain of Fab fragment of Basiliximab                 32.7    3.6   
  3iu3_F L Light chain of Fab fragment of Basiliximab                 32.7    3.6   
  1rvf_E L FAB 17-IA                                                  31.6    3.6   
  6df2_A L Anti-phosphotyrosine antibody c310-4D5 heavy chain         33.1    3.8   
  6df2_D A Anti-phosphotyrosine antibody c310-4D5 heavy chain         33.1    3.8   
  1mim_A L CHIMERIC SDZ CHI621                                        32.7    3.8   
  5nj6_C L Fab3949 L                                                  32.7    3.9   
  1fnl_A A LOW AFFINITY IMMUNOGLOBULIN GAMMA FC REGION RECEPTOR I...  32.3    3.9   
  1orq_A A 6E1 Fab light chain                                        32.7    4.0   
  3w2d_B L Monoclonal Antibody 3E2 Fab figment light chain            32.7    4.1   
  3iu3_D D Light chain of Fab fragment of Basiliximab                 32.7    4.2   
  1pgr_F F PROTEIN (G-CSF RECEPTOR)                                   32.7    4.2   
  1ken_I U influenza virus infectivity neutralizing antibody (lig...  32.7    4.3   
  1ken_G L influenza virus infectivity neutralizing antibody (lig...  32.7    4.3   
  1e4k_C C LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III          32.3    4.6   
  1t83_C C Low affinity immunoglobulin gamma Fc region receptor I...  32.3    4.6   
  1t89_C C Low affinity immunoglobulin gamma Fc region receptor I...  32.3    4.6   
  5yc5_C C Low affinity immunoglobulin gamma Fc region receptor I...  32.3    4.6   
  1e4j_A A LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III          32.3    4.6   
  1x5h_A A Neogenin                                                   31.6    5.0   
  4kkl_F F Fab, light chain                                           32.3    5.2   
  4ene_D D light chain of Fab fragment                                32.3    5.2   
  4ene_F F light chain of Fab fragment                                32.3    5.2   
  4kka_D D Fab, light chain                                           32.3    5.2   
  4kkc_D D Fab, light chain                                           32.3    5.2   
  4kkc_F F Fab, light chain                                           32.3    5.2   
  1otu_F F Fab fragment (Light chain)                                 32.3    5.2   
  3det_F F Fab fragment, Light chain                                  32.3    5.2   
  4kjw_F F Fab, light chain                                           32.3    5.2   
  4kjw_D D Fab, light chain                                           32.3    5.2   
  3ejy_D D Fab fragment, Light chain                                  32.3    5.2   
  4kkb_F F Fab, light chain                                           32.3    5.2   
  2h2s_D D FAB fragment, light chain                                  32.3    5.2   
  3ejy_F F Fab fragment, Light chain                                  32.3    5.2   
  2htk_F F Fab fragment, Light chain                                  32.3    5.2   
  6k5d_D D Fab fragment, light chain                                  32.3    5.2   
  6adc_F F antibody Fab fragment, light chain                         32.3    5.2   
  3ejz_D D Fab fragment, Light chain                                  32.3    5.2   
  2ht4_D D Fab fragment, Light chain                                  32.3    5.2   
  3det_D D Fab fragment, Light chain                                  32.3    5.2   
  4fg6_F F Fab fragment (Light chain)                                 32.3    5.2   
  4lou_F F Fab light chain                                            32.3    5.2   
  2ht2_D D Fab fragment, light chain                                  32.3    5.2   
  2ht2_F F Fab fragment, light chain                                  32.3    5.2   
  1ott_D D Fab fragment (Light chain)                                 32.3    5.2   
  1ott_F F Fab fragment (Light chain)                                 32.3    5.2   
  6k5d_F F Fab fragment, light chain                                  32.3    5.2   
  2exw_D D Fab Fragment (Light Chain)                                 32.3    5.2   
  2exy_F F Fab Fragment (Light Chain)                                 32.3    5.2   
  2exy_D D Fab Fragment (Light Chain)                                 32.3    5.2   
  4kkl_D D Fab, light chain                                           32.3    5.2   
  4mqx_F F ERIC                                                       32.3    5.2   
  4mqx_D D ERIC                                                       32.3    5.2   
  6k5f_D D Fab fragment, light chain                                  32.3    5.2   
  6k5f_F F Fab fragment, light chain                                  32.3    5.2   
  6ad8_F F antibody Fab fragment light chain                          32.3    5.2   
  2hlf_D D Fab Fragment, Light chain                                  32.3    5.2   
  1otu_D D Fab fragment (Light chain)                                 32.3    5.2   
  5hd8_D D FAB FRAGMENT (LIGHT CHAIN)                                 32.3    5.2   
  2htk_D D Fab fragment, Light chain                                  32.3    5.2   
  4kjq_F F Fab, light chain                                           32.3    5.2   
  2htl_D D Fab fragment, Light chain                                  32.3    5.2   
  6ad7_D D antibody Fab fragment light chain                          32.3    5.2   
  1ots_F F Fab fragment (light chain)                                 32.3    5.2   
  6k5i_F F Fab fragment, light chain                                  32.3    5.2   
  2htl_F F Fab fragment, Light chain                                  32.3    5.2   
  4kk8_F F Fab, light chain                                           32.3    5.2   
  4fg6_D D Fab fragment (Light chain)                                 32.3    5.2   
  6adc_D D antibody Fab fragment, light chain                         32.3    5.2   
  6ad7_F F antibody Fab fragment light chain                          32.3    5.2   
  2fed_F F Fab fragment, light chain                                  32.3    5.2   
  2fed_D D Fab fragment, light chain                                  32.3    5.2   
  6ad8_D D antibody Fab fragment light chain                          32.3    5.2   
  4kkb_D D Fab, light chain                                           32.3    5.2   
  4kk8_D D Fab, light chain                                           32.3    5.2   
  4kka_F F Fab, light chain                                           32.3    5.2   
  4kk6_D D Fab, light chain                                           32.3    5.2   
  2r9h_D D Fab fragment                                               32.3    5.2   
  2r9h_F F Fab fragment                                               32.3    5.2   
  2fee_F L Fab fragment, light chain                                  32.3    5.2   
  1ots_D D Fab fragment (light chain)                                 32.3    5.2   
  2ht3_F F Fab fragment, Light chain                                  32.3    5.2   
  2ez0_D D Fab Fragment (Light Chain)                                 32.3    5.2   
  4kk5_F F Fab, light chain                                           32.3    5.2   
  4kk5_D D Fab, light chain                                           32.3    5.2   
  3ejz_F F Fab fragment, Light chain                                  32.3    5.2   
  2h2p_D D FAB fragment, light chain                                  32.3    5.2   
  2hlf_F F Fab Fragment, Light chain                                  32.3    5.2   
  4kjp_D D light chain of Fab fragment                                32.3    5.2   
  4kjp_F F light chain of Fab fragment                                32.3    5.2   
  4kjq_D D Fab, light chain                                           32.3    5.2   
  5hd8_F F FAB FRAGMENT (LIGHT CHAIN)                                 32.3    5.2   
  2ht3_D D Fab fragment, Light chain                                  32.3    5.2   
  6ada_F F antibody Fab fragment, light chain                         32.3    5.2   
  2h2s_F F FAB fragment, light chain                                  32.3    5.2   
  2fec_D O Fab fragment, light chain                                  32.3    5.2   
  2fec_F L Fab fragment, light chain                                  32.3    5.2   
  4lou_D D Fab light chain                                            32.3    5.2   
  2ez0_F F Fab Fragment (Light Chain)                                 32.3    5.2   
  6adb_F F antibody Fab fragment, light chain                         32.3    5.2   
  4kk9_F F Fab, light chain                                           32.3    5.2   
  4kk9_D D Fab, light chain                                           32.3    5.2   
  2exw_F F Fab Fragment (Light Chain)                                 32.3    5.2   
  2fee_D O Fab fragment, light chain                                  32.3    5.2   
  2h2p_F F FAB fragment, light chain                                  32.3    5.2   
  6adb_D D antibody Fab fragment, light chain                         32.3    5.2   
  6ada_D D antibody Fab fragment, light chain                         32.3    5.2   
  2ht4_F F Fab fragment, Light chain                                  32.3    5.2   
  4kk6_F F Fab, light chain                                           32.3    5.2   
  6k5i_D D Fab fragment, light chain                                  32.3    5.2   
  6k5a_D D Fab fragment, light chain                                  32.3    5.2   
  6k5a_F F Fab fragment, light chain                                  32.3    5.2   
  1bql_A L HYHEL-5 FAB (LIGHT CHAIN)                                  32.3    5.5   
  2iff_A L IGG1 HYHEL-5 FAB (LIGHT CHAIN)                             32.3    5.5   
  1yqv_A L HyHEL-5 Antibody Light Chain                               32.3    5.5   
  1pgr_B B PROTEIN (G-CSF RECEPTOR)                                   32.3    5.6   
  1gl4_B B BASEMENT MEMBRANE-SPECIFIC HEPARAN SULFATE PROTEOGLYCA...  30.8    5.9   
  6m87_F I Fab 10A6 light chain                                       32.3    5.9   
  6m87_C C Fab 10A6 light chain                                       32.0    6.0   
  6m87_E G Fab 10A6 light chain                                       32.0    6.0   
  6m87_G K Fab 10A6 light chain                                       32.0    6.2   
  6ewb_F F Fab light chain                                            32.0    6.6   
  6ewb_L L Fab light chain                                            32.0    6.9   
  4f9p_C D 103.2 anti-BTN3A1 antibody fragment                        32.0    6.9   
  4f9p_D C 103.2 anti-BTN3A1 antibody fragment                        32.0    7.0   
  6m87_A A Fab 10A6 light chain                                       32.0    7.1   
  6m87_D E Fab 10A6 light chain                                       32.0    7.1   
  1ob1_D D ANTIBODY, HEAVY CHAIN                                      32.0    7.4   
  1ob1_A A ANTIBODY, HEAVY CHAIN                                      32.0    7.4   
  6ewb_I I Fab light chain                                            32.0    7.5   
  1pgr_D D PROTEIN (G-CSF RECEPTOR)                                   32.0    7.7   
  1pgr_H H PROTEIN (G-CSF RECEPTOR)                                   32.0    7.7   
  4xph_B L Antibody fragment light chain                              31.6    7.9   
  6jhs_D D FAB Light Chain                                            31.6    8.0   
  4hs6_C A MRCT10.v362 Fab light chain                                31.6    8.2   
  4hs6_D L MRCT10.v362 Fab light chain                                31.6    8.2   
  6ewb_K K Fab light chain                                            31.6    8.2   
  4xp9_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN     31.6    8.2   
  1psk_A L ANTIBODY                                                   31.6    8.3   
  4xpt_B L antibody fragment light chain                              31.6    8.5   
  4xnx_B L antibody fragment light chain                              31.6    8.5   
  4xp1_B L Antibody fragment light chain                              31.6    8.5   
  4xnu_B L antibody fragment light chain                              31.6    8.5   
  4xpb_B L Antibody fragment heavy chain-protein, 9D5-heavy chain     31.6    8.5   
  5w1k_S S CR1-28 Fab light chain                                     31.6    8.5   
  5w1k_K K CR1-28 Fab light chain                                     31.6    8.5   
  5w1k_A A CR1-28 Fab light chain                                     31.6    8.5   
  5w1k_F F CR1-28 Fab light chain                                     31.6    8.5   
  5l9d_B L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN        31.6    8.6   
  5vta_E L Fab light chain                                            31.6    8.6   
  6ca7_A L PCT64_13C light chain                                      31.6    8.7   
  5l88_B L Anti-afamin antibody N14, Fab fragment, light chain        31.6    8.8   
  1f6f_C C PROLACTIN RECEPTOR                                         31.6    9.0   
  5lgh_B L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN        31.6    9.0   
  5l7x_B L Mouse Antibody Fab Fragment, IgG1-kappa Light Chain        31.6    9.0   
  4xp5_B L Antibody fragment heavy chain-protein, 9D5-heavy chain     31.6    9.0   
  4xp6_B L Antibody fragment heavy chain-protein, 9D5-heavy chain     31.6    9.0   
  6ch9_F R BG18 Light Chain                                           31.6    9.1   
  6chb_R R BG18 Light Chain                                           31.6    9.1   
  6chb_L L BG18 Light Chain                                           31.6    9.1   
  6chb_D K BG18 Light Chain                                           31.6    9.1   
  5ud9_B L Light chain                                                31.6    9.1   
  4xpf_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN     31.6    9.2   
  4xp4_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN     31.6    9.2   
  4m48_B L 9D5 antibody, light chain                                  31.6    9.2   
  4xpg_B L antibody fragment light chain                              31.6    9.2   
  4xpa_B L Antibody fragment heavy chain-protein, 9D5-heavy chain     31.6    9.2   
  5vta_F E Fab light chain                                            31.6    9.3   
  4ffw_C C Fab light chain                                            31.6    9.8   


> 1n26_A A IL-6 Receptor alpha chain
Length=325 Score = 624 bits (1609), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 20 LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR 79 LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR Sbjct 1 LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR 60 Query 80 RLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST 139 RLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST Sbjct 61 RLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST 120 Query 140 PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG 199 PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG Sbjct 121 PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG 180 Query 200 SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA 259 SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA Sbjct 181 SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA 240 Query 260 ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES 318 ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES Sbjct 241 ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES 299
> 1p9m_C C Interleukin-6 receptor alpha chain
Length=201 Score = 424 bits (1089), Expect = 1e-146, Method: Compositional matrix adjust. Identities = 201/201 (100%), Positives = 201/201 (100%), Gaps = 0/201 (0%) Query 115 EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF 174 EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF Sbjct 1 EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF 60 Query 175 SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL 234 SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL Sbjct 61 SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL 120 Query 235 SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA 294 SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA Sbjct 121 SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA 180 Query 295 QEEFGQGEWSEWSPEAMGTPW 315 QEEFGQGEWSEWSPEAMGTPW Sbjct 181 QEEFGQGEWSEWSPEAMGTPW 201
> 5fuc_C C INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6
RECEPTOR Length=231 Score = 414 bits (1063), Expect = 2e-142, Method: Compositional matrix adjust. Identities = 197/200 (99%), Positives = 197/200 (99%), Gaps = 0/200 (0%) Query 117 PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC 176 PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS AEDFQEPCQYSQESQKFSC Sbjct 26 PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSXAEDFQEPCQYSQESQKFSC 85 Query 177 QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV 236 QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG GILQPDPPANITVTAVARNPRWLSV Sbjct 86 QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGAGILQPDPPANITVTAVARNPRWLSV 145 Query 237 TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQE 296 TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH VIHDAWSGLRHVVQLRAQE Sbjct 146 TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHAVIHDAWSGLRHVVQLRAQE 205 Query 297 EFGQGEWSEWSPEAMGTPWT 316 EFGQGEWSEWSPEAMGTPWT Sbjct 206 EFGQGEWSEWSPEAMGTPWT 225
> 5fuc_D D INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6
RECEPTOR Length=231 Score = 409 bits (1051), Expect = 2e-140, Method: Compositional matrix adjust. Identities = 196/205 (96%), Positives = 196/205 (96%), Gaps = 0/205 (0%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRK DFQEPCQYSQESQ Sbjct 22 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKXXXXXXXDFQEPCQYSQESQ 81 Query 173 KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR 232 KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG GILQPDPPANITVTAVARNPR Sbjct 82 KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGAGILQPDPPANITVTAVARNPR 141 Query 233 WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL 292 WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH VIHDAWSGLRHVVQL Sbjct 142 WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHAVIHDAWSGLRHVVQL 201 Query 293 RAQEEFGQGEWSEWSPEAMGTPWTE 317 RAQEEFGQGEWSEWSPEAMGTPWTE Sbjct 202 RAQEEFGQGEWSEWSPEAMGTPWTE 226
> 2arw_A A Interleukin-6 receptor alpha chain
Length=126 Score = 221 bits (563), Expect = 8e-69, Method: Compositional matrix adjust. Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%) Query 212 GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK 271 GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK Sbjct 2 GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK 61 Query 272 DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT 313 DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT Sbjct 62 DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT 103
> 6o4p_A A Interleukin-11 receptor subunit alpha
Length=349 Score = 103 bits (258), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 96/303 (32%), Positives = 131/303 (43%), Gaps = 26/303 (9%) Query 25 CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLL 83 CP GV PG SV L CPGV D V W +P P +G+G L+L Sbjct 4 CPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVSWFRDGEPKLLQGPD--SGLGHELVL 59 Query 84 RSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL 142 D G Y C G GTV L + PP P +SC + + N C W P L Sbjct 60 AQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC-QAADYENFSCTWSPSQISGL 118 Query 143 TTKAVLLVRK--------FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS--SFYIVSM 192 T+ + RK SP+ PC V G S Y +++ Sbjct 119 PTRYLTSYRKKTVXXXXXXXXSPSTG-PWPC----PQDPLGAARCVVHGAEFWSQYRINV 173 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FYRL 251 + +G+ ++ IL+PDPP + V +V PR L +W P SW S + L Sbjct 174 TEVNPLGAS-TRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLL 232 Query 252 RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM 311 +F L+YR + ++T L+ VI DA +GL H V++ A++ G WS WSPEA Sbjct 233 KFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAW 290 Query 312 GTP 314 GTP Sbjct 291 GTP 293
> 6o4p_B B Interleukin-11 receptor subunit alpha
Length=349 Score = 103 bits (257), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 97/305 (32%), Positives = 129/305 (42%), Gaps = 30/305 (10%) Query 25 CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLL 83 CP GV PG SV L CPGV D V W +P P +G+G L+L Sbjct 4 CPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVSWFRDGEPKLLQGPD--SGLGHELVL 59 Query 84 RSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL 142 D G Y C G GTV L + PP P +SC + + N C W P L Sbjct 60 AQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC-QAADYENFSCTWSPSQISGL 118 Query 143 TTKAVLLVRK------------FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV 190 T+ + RK P Q+P ++ C + E S + I Sbjct 119 PTRYLTSYRKKTVXXXXXXXXXXSTGPWPCPQDPLGAAR------CVVHGAEFWSQYRIN 172 Query 191 SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FY 249 V S + Q IL+PDPP + V +V PR L +W P SW S + Sbjct 173 VTEVNPLGASTRLLDVSLQS--ILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHF 230 Query 250 RLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE 309 L+F L+YR + ++T L+ VI DA +GL H V++ A++ G WS WSPE Sbjct 231 LLKFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLPHAVRVSARDFLDAGTWSTWSPE 288 Query 310 AMGTP 314 A GTP Sbjct 289 AWGTP 293
> 1uc6_A A Ciliary Neurotrophic Factor Receptor alpha
Length=109 Score = 69.7 bits (169), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 7/110 (6%) Query 211 CGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWM 269 G ++PDPP N+ V NPR L VTWQ P +W + + L+F LRYR W Sbjct 3 LGSVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRP---LILDQWQ 59 Query 270 VKDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE 317 +L + I DA++G +++Q+ A++ G WS+WS A TPWTE Sbjct 60 HVELSNGTAHTITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAAHATPWTE 108
> 1f42_A A INTERLEUKIN-12 BETA CHAIN
Length=306 Score = 60.8 bits (146), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 120/303 (40%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGXXXXXGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQGKSKRXXXXRVFTDKTSATVICRK----NASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 3duh_A A Interleukin-12 subunit beta
Length=314 Score = 60.1 bits (144), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 119/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 22 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 72 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 73 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 132 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + ++ +YS E Q+ S A P + S Sbjct 133 TFSVKSSRGSSDPQGVTCGAATLSAEXXXXXXXEY----EYSVECQEDS---ACPAAEES 185 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 186 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 244 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + + D VI + +RAQ+ + WS Sbjct 245 PHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 300 Query 305 EWS 307 EW+ Sbjct 301 EWA 303
> 5mzv_A A Interleukin-12 subunit beta
Length=328 Score = 59.7 bits (143), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 120/303 (40%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQGKXXREKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 3hmx_A A Interleukin-12 subunit beta
Length=306 Score = 58.2 bits (139), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 118/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRXXXSISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 4grw_B B Interleukin-12 subunit beta
Length=328 Score = 58.2 bits (139), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 118/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGXXXPQGVTCGAATLSAERVRXXNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQGXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 3qwr_A A Interleukin-12 subunit beta
Length=306 Score = 57.8 bits (138), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 118/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERXRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQXXXXXXKKDRVFTDKTSATVI----CRKXXSISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 5mj3_A A Interleukin-12 subunit beta
Length=306 Score = 57.8 bits (138), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 118/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQGXXXXEKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 3d87_B B Interleukin-12 subunit p40
Length=306 Score = 57.4 bits (137), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 117/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQXXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 3d87_D D Interleukin-12 subunit p40
Length=306 Score = 57.0 bits (136), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 69/303 (23%), Positives = 116/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVXXXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 5mxa_B A Interleukin-12 subunit beta
Length=328 Score = 55.8 bits (133), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 68/303 (22%), Positives = 118/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + R + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KXSRQVEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQGKXXXXKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 1bqu_B B PROTEIN (GP130)
Length=215 Score = 53.9 bits (128), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 94/213 (44%), Gaps = 29/213 (14%) Query 112 VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQ 166 +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 6 LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-------- 56 Query 167 YSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQPDPPANI 222 + SC + S+ Y V++ V +++G S F ++P+PP N+ Sbjct 57 --KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNL 110 Query 223 TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVI 279 +V L +TW +P S L++ ++YR + + T++ +D + + Sbjct 111 SVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTV 168 Query 280 HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG 312 D +V ++R +E G+G WS+WS EA G Sbjct 169 QDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG 201
> 1pvh_A A Interleukin-6 receptor beta chain
Length=201 Score = 53.9 bits (128), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 94/213 (44%), Gaps = 29/213 (14%) Query 112 VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQ 166 +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 2 LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-------- 52 Query 167 YSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQPDPPANI 222 + SC + S+ Y V++ V +++G S F ++P+PP N+ Sbjct 53 --KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNL 106 Query 223 TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVI 279 +V L +TW +P S L++ ++YR + + T++ +D + + Sbjct 107 SVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTV 164 Query 280 HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG 312 D +V ++R +E G+G WS+WS EA G Sbjct 165 QDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG 197
> 1pvh_C C Interleukin-6 receptor beta chain
Length=201 Score = 53.9 bits (128), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 94/213 (44%), Gaps = 29/213 (14%) Query 112 VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQ 166 +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 2 LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-------- 52 Query 167 YSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQPDPPANI 222 + SC + S+ Y V++ V +++G S F ++P+PP N+ Sbjct 53 --KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNL 106 Query 223 TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVI 279 +V L +TW +P S L++ ++YR + + T++ +D + + Sbjct 107 SVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTV 164 Query 280 HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG 312 D +V ++R +E G+G WS+WS EA G Sbjct 165 QDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG 197
> 3l5h_A A Interleukin-6 receptor subunit beta
Length=589 Score = 55.8 bits (133), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 57/230 (25%), Positives = 103/230 (45%), Gaps = 31/230 (13%) Query 106 VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAED 160 + ++ +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 95 ITIISXLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-- 151 Query 161 FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQP 216 + SC + S+ Y V++ V +++G S F ++P Sbjct 152 --------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKP 199 Query 217 DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL--- 273 +PP N++V L +TW +P S L++ ++YR + + T++ +D Sbjct 200 NPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTAST 257 Query 274 QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE--SRSP 321 + + D +V ++R +E G+G WS+WS EA G + + S++P Sbjct 258 RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAP 307
> 1bqu_A A PROTEIN (GP130)
Length=215 Score = 53.9 bits (128), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 94/213 (44%), Gaps = 29/213 (14%) Query 112 VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQ 166 +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 6 LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-------- 56 Query 167 YSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQPDPPANI 222 + SC + S+ Y V++ V +++G S F ++P+PP N+ Sbjct 57 --KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNL 110 Query 223 TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVI 279 +V L +TW +P S L++ ++YR + + T++ +D + + Sbjct 111 SVINSXXLSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTV 168 Query 280 HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG 312 D +V ++R +E G+G WS+WS EA G Sbjct 169 QDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG 201
> 1i1r_A A INTERLEUKIN-6 RECEPTOR BETA CHAIN
Length=303 Score = 54.7 bits (130), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 55/224 (25%), Positives = 99/224 (44%), Gaps = 29/224 (13%) Query 106 VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAED 160 + ++ +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 96 ITIISGLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-- 152 Query 161 FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQP 216 + SC + S+ Y V++ V +++G S F ++P Sbjct 153 --------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKP 200 Query 217 DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL--- 273 +PP N++V L +TW +P S L++ ++YR + + T++ +D Sbjct 201 NPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTAST 258 Query 274 QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE 317 + + D +V ++R +E G+G WS+WS EA G + + Sbjct 259 RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYED 302
> 3duh_B B Interleukin-12 subunit beta
Length=314 Score = 54.7 bits (130), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 117/303 (39%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 22 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 72 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 73 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 132 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 133 TFSVKSSRGSSDPQGVTCGAATLSAEXXXXXNKEY----EYSVECQEDS---ACPAAEES 185 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 186 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWST 244 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + D VI + +RAQ+ + WS Sbjct 245 PHSYFSLTFCVQVQGKXXXXKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 300 Query 305 EWS 307 EW+ Sbjct 301 EWA 303
> 1p9m_A A Interleukin-6 receptor beta chain
Length=299 Score = 54.3 bits (129), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 55/219 (25%), Positives = 97/219 (44%), Gaps = 29/219 (13%) Query 106 VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAED 160 + ++ +PPE+P+ LSC + CEW G R T + T K+ KF + A Sbjct 96 ITIISGLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA-- 152 Query 161 FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQP 216 + SC + S+ Y V++ V +++G S F ++P Sbjct 153 --------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKP 200 Query 217 DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL--- 273 +PP N++V L +TW +P S L++ ++YR + + T++ +D Sbjct 201 NPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTAST 258 Query 274 QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG 312 + + D +V ++R +E G+G WS+WS EA G Sbjct 259 RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG 297
> 5njd_E E Interleukin-12 subunit beta
Length=328 Score = 53.9 bits (128), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 68/303 (22%), Positives = 116/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + R + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLXXX-RQVEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQXXXXXXXXXRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 5njd_C C Interleukin-12 subunit beta
Length=328 Score = 53.9 bits (128), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 116/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQGXXXXXXXXRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 4grw_D D Interleukin-12 subunit beta
Length=328 Score = 53.5 bits (127), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 116/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRXXNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQGXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 1f45_A A INTERLEUKIN-12 BETA CHAIN
Length=306 Score = 52.8 bits (125), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 68/303 (22%), Positives = 114/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCXX 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 + +L D P + L C K+ C W Sbjct 71 XXXXXSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + ++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAEXXXXXXXEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRXXXSISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 5njd_A A Interleukin-12 subunit beta
Length=328 Score = 52.8 bits (125), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 116/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKXXXQ-VEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQXXXXXEKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 5njd_I I Interleukin-12 subunit beta
Length=328 Score = 52.8 bits (125), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 115/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPXXXXXQ-VEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQXXXXXXXXXRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 5mj4_A A Interleukin-12 subunit beta
Length=306 Score = 52.4 bits (124), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 115/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + ++ +YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERXXXXXXEY----EYSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KXXXXVEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 5njd_G G Interleukin-12 subunit beta
Length=328 Score = 52.4 bits (124), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 67/303 (22%), Positives = 115/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPXXXXXQ-VEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 5njd_K K Interleukin-12 subunit beta
Length=328 Score = 52.4 bits (124), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 68/303 (22%), Positives = 115/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 42 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 92 Query 99 AGRPAG--------------TVHLLVD--VPPEEPQLSCFRKSPLSNVVCEW-------- 134 G + +L D P + L C K+ C W Sbjct 93 GGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL 152 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ +YS E Q+ S A P + S Sbjct 153 TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEES 205 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + R + V+W+ P +W++ Sbjct 206 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPXXXX-RQVEVSWEYPDTWST 264 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 265 PHSYFSLTFCVQVQXXXXXEKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 320 Query 305 EWS 307 EW+ Sbjct 321 EWA 323
> 3d85_D D Interleukin-12 subunit p40
Length=306 Score = 50.4 bits (119), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 66/303 (22%), Positives = 114/303 (38%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG+ V LTC PE++ + W L S G G+ L ++ + D+G Y+C++ Sbjct 20 PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHK 70 Query 99 AGRPAG--------------TVHLLVDVPPEEPQ--LSCFRKSPLSNVVCEW-------- 134 G + +L D + L C K+ C W Sbjct 71 GGEVLSHSLLLLHKKEDGIWSTDILKDQKXXXNKTFLRCEAKNYSGRFTCWWLTTISTDL 130 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + ++++ YS E Q+ S A P + S Sbjct 131 TFSVKSSRGSSDPQGVTCGAATLSAERVRXXNKEYE----YSVECQEDS---ACPAAEES 183 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A T +F I++PDPP N+ + + + + V+W+ P +W++ Sbjct 184 LPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWST 242 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + D VI + +RAQ+ + WS Sbjct 243 PHSYFSLTFCVQVQGXXXXXXKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS 298 Query 305 EWS 307 EW+ Sbjct 299 EWA 301
> 1bj8_A A GP130
Length=109 Score = 46.6 bits (109), Expect = 3e-05, Method: Composition-based stats. Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 5/107 (5%) Query 214 LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL 273 ++P+PP N++V L +TW +P S L++ ++YR + + T++ +D Sbjct 4 VKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDT 61 Query 274 ---QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE 317 + + D +V ++R +E G+G WS+WS EA G + + Sbjct 62 ASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYED 108
> 3ew3_B B Prolactin receptor
Length=221 Score = 48.1 bits (113), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 16/205 (8%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PP +P++ R C W P + L T L K E C + S Sbjct 4 PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSG 59 Query 173 KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVAR 229 SC + YI+++ + +GS S I++P+PP N+T V + Sbjct 60 PNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKD 119 Query 230 NPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSG 285 +L V W P + ++ + +E+R + E ++ W + H + D + G Sbjct 120 KKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPG 176 Query 286 LRHVVQLRAQEEFGQGEWSEWSPEA 310 +++VQ R + + G WS WS E+ Sbjct 177 QKYLVQTRCKPD--HGYWSRWSQES 199
> 3npz_B B Prolactin receptor
Length=220 Score = 48.1 bits (113), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 16/205 (8%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PP +P++ R C W P + L T L K E C + S Sbjct 3 PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSG 58 Query 173 KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVAR 229 SC + YI+++ + +GS S I++P+PP N+T V + Sbjct 59 PNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKX 118 Query 230 NPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSG 285 +L V W P + ++ + +E+R + E ++ W + H + D + G Sbjct 119 XKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPG 175 Query 286 LRHVVQLRAQEEFGQGEWSEWSPEA 310 +++VQ R + + G WS WS E+ Sbjct 176 QKYLVQTRCKPD--HGYWSRWSQES 198
> 3ncb_B B Prolactin receptor
Length=210 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--HGYWSAWSP 196
> 3n0p_B B Prolactin receptor
Length=210 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--HGYWSAWSP 196
> 3mzg_B B Prolactin receptor
Length=210 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--HGYWSAWSP 196
> 3n06_B B Prolactin receptor
Length=210 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--HGYWSAWSP 196
> 3npz_C C Prolactin receptor
Length=220 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 48/205 (23%), Positives = 81/205 (40%), Gaps = 16/205 (8%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PP +P++ R C W P + L T L K E C + S Sbjct 3 PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSG 58 Query 173 KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVAR 229 SC + YI+++ + +GS S I++P+PP N+T V Sbjct 59 PNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQXXX 118 Query 230 NPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSG 285 +L V W P + ++ + +E+R + E + W + H + D + G Sbjct 119 KKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEXXE---EWEIHFTGHQTQFKVFDLYPG 175 Query 286 LRHVVQLRAQEEFGQGEWSEWSPEA 310 +++VQ R + + G WS WS E+ Sbjct 176 QKYLVQTRCKPD--HGYWSRWSQES 198
> 3nce_B B Prolactin receptor
Length=210 Score = 45.8 bits (107), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--AGYWSAWSP 196
> 3ncf_B B Prolactin receptor
Length=210 Score = 45.8 bits (107), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--AGYWSAWSP 196
> 3ncc_B B Prolactin receptor
Length=210 Score = 45.8 bits (107), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--AGYWSAWSP 196
> 6uib_B B Interleukin-12 subunit beta
Length=316 Score = 46.2 bits (108), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 65/303 (21%), Positives = 112/303 (37%), Gaps = 55/303 (18%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY- 97 PG+ V LTC + W L S G G+ L ++ + D+G Y+C+ Sbjct 24 PGEMVVLTC---DXXXXXXXXWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHX 74 Query 98 -------------RAGRPAGTVHLLVDVPPEEPQ--LSCFRKSPLSNVVCEW-------- 134 + + +L D + L C K+ C W Sbjct 75 XXXXXXHSLLLLHKKEDGIWSTDILKDQXXXXNKTFLRCEAKNYSGRFTCWWLTTISTDL 134 Query 135 --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS 186 G +T A L + +++ YS E Q+ S A P + S Sbjct 135 TFSVKSSRGSSDPQGVTCGAATLSAERVXXXXXEYE----YSVECQEDS---ACPAAEES 187 Query 187 FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS 246 I M A + T +F I++PDPP N+ + + +N R + V+W+ P +W++ Sbjct 188 LPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWST 246 Query 247 --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS 304 S++ L F ++ + + + D VI + +RAQ+ + WS Sbjct 247 PHSYFSLTFCVQVQGKSKXXKKDRVFTDKTSATVI----CRKXXSISVRAQDRYYSSSWS 302 Query 305 EWS 307 EW+ Sbjct 303 EWA 305
> 3d48_B R Prolactin receptor
Length=211 Score = 45.1 bits (105), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 46/202 (23%), Positives = 75/202 (37%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + L T L + E C Sbjct 3 LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG 58 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + +GS FS I+QPDPP + V Sbjct 59 GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKXXX 118 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 +L + W P + ++ L +E+R + E++ + Q I G Sbjct 119 XXXPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSXXPGQ 177 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 178 KYLVQVRCKPD--HGYWSAWSP 197
> 4i18_E R Prolactin receptor
Length=211 Score = 43.9 bits (102), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 46/201 (23%), Positives = 74/201 (37%), Gaps = 12/201 (6%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PP +P++ R C W P + T L + E C Sbjct 3 PPGKPEIFKCRSPNKETFTCWWRPGTDGGXXTNYSLTYHR----EGETLMHECPDYITGG 58 Query 173 KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP 231 SC YI+ + + +GS FS I+QPDPP + V Sbjct 59 PNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPED 118 Query 232 R--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR 287 R +L + W P + ++ L +E+R + E++ + Q I G + Sbjct 119 RKPYLWIKWSPPTLIXXKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQK 177 Query 288 HVVQLRAQEEFGQGEWSEWSP 308 ++VQ+R + + G WS WSP Sbjct 178 YLVQVRCKPD--HGYWSAWSP 196
> 1f6f_B B PROLACTIN RECEPTOR
Length=210 Score = 43.5 bits (101), Expect = 0.001, Method: Compositional matrix adjust. Identities = 46/202 (23%), Positives = 80/202 (40%), Gaps = 16/202 (8%) Query 116 EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFS 175 +P++ R C W P + L T L K E C + S S Sbjct 6 KPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSGPNS 61 Query 176 CQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVARNPR 232 C + YI+++ + +GS S I++P+PP N+T V Sbjct 62 CFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKXXXXKKT 121 Query 233 WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGLRH 288 +L V W P + ++ + +E+R + E ++ W + H + D + G ++ Sbjct 122 YLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPGQKY 178 Query 289 VVQLRAQEEFGQGEWSEWSPEA 310 +VQ R + + G WS WS E+ Sbjct 179 LVQTRCKPD--HGYWSRWSQES 198
> 4i18_F C Prolactin receptor
Length=211 Score = 42.0 bits (97), Expect = 0.004, Method: Compositional matrix adjust. Identities = 45/201 (22%), Positives = 73/201 (36%), Gaps = 12/201 (6%) Query 113 PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ 172 PP +P++ R C W P + L T L + E C Sbjct 3 PPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITGG 58 Query 173 KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP 231 SC YI+ + + +GS FS I+QPDPP + V Sbjct 59 PNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKXXXX 118 Query 232 R--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR 287 +L + W P + ++ L +E+R + E++ + Q I + Sbjct 119 XXPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSXXXXXK 177 Query 288 HVVQLRAQEEFGQGEWSEWSP 308 ++VQ+R + + G WS WSP Sbjct 178 YLVQVRCKPD--HGYWSAWSP 196
> 6sff_A A Interleukin-12 subunit beta
Length=344 Score = 42.4 bits (98), Expect = 0.004, Method: Compositional matrix adjust. Identities = 55/243 (23%), Positives = 93/243 (38%), Gaps = 36/243 (15%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSL--- 142 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 143 --TTKAVLLVRKFQNSPAEDFQEPCQYSQ---ESQKFSCQ--LAVPEGDSSFYIVSMCVA 195 ++ + R A E Q E SCQ + P + + I A Sbjct 153 IKSSSSXXDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEA 212 Query 196 SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRF 253 + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ L+F Sbjct 213 RQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKXSQ--VEVSWEYPDSWSTPHSYFSLKF 270 Query 254 ELR 256 +R Sbjct 271 FVR 273
> 6sp3_B B Interleukin-12 subunit beta
Length=344 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 54/246 (22%), Positives = 93/246 (38%), Gaps = 42/246 (17%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-- 143 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 144 ---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ--LAVPEGDSSFYIVSM 192 ++AV ++ Q E SCQ + P + + I Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLD---QRDYEKYSVSCQEDVTCPTAEETLPIELA 209 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYR 250 A + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ Sbjct 210 LEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFS 267 Query 251 LRFELR 256 L+F +R Sbjct 268 LKFFVR 273
> 6smc_B B Interleukin-12 subunit beta
Length=344 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 54/246 (22%), Positives = 93/246 (38%), Gaps = 42/246 (17%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-- 143 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 144 ---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ--LAVPEGDSSFYIVSM 192 ++AV ++ Q E SCQ + P + + I Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLD---QRDYEKYSVSCQEDVTCPTAEETLPIELA 209 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYR 250 A + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ Sbjct 210 LEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFS 267 Query 251 LRFELR 256 L+F +R Sbjct 268 LKFFVR 273
> 6smc_A A Interleukin-12 subunit beta
Length=344 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 54/246 (22%), Positives = 93/246 (38%), Gaps = 42/246 (17%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-- 143 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 144 ---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ--LAVPEGDSSFYIVSM 192 ++AV ++ Q E SCQ + P + + I Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLD---QRDYEKYSVSCQEDVTCPTAEETLPIELA 209 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYR 250 A + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ Sbjct 210 LEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFS 267 Query 251 LRFELR 256 L+F +R Sbjct 268 LKFFVR 273
> 6smc_C C Interleukin-12 subunit beta
Length=344 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 54/246 (22%), Positives = 93/246 (38%), Gaps = 42/246 (17%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-- 143 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 144 ---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ--LAVPEGDSSFYIVSM 192 ++AV ++ Q E SCQ + P + + I Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLD---QRDYEKYSVSCQEDVTCPTAEETLPIELA 209 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYR 250 A + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ Sbjct 210 LEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFS 267 Query 251 LRFELR 256 L+F +R Sbjct 268 LKFFVR 273
> 6sp3_A A Interleukin-12 subunit beta
Length=344 Score = 42.0 bits (97), Expect = 0.007, Method: Compositional matrix adjust. Identities = 55/243 (23%), Positives = 90/243 (37%), Gaps = 36/243 (15%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK 145 G HLL+ + L C + C W + L Sbjct 93 GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 146 AVLLV-----RKFQNSPAEDFQEPCQYSQ---ESQKFSCQ--LAVPEGDSSFYIVSMCVA 195 R A E Q E SCQ + P + + I A Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEA 212 Query 196 SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRF 253 + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ L+F Sbjct 213 RQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFSLKF 270 Query 254 ELR 256 +R Sbjct 271 FVR 273
> 3ew3_C C Prolactin receptor
Length=221 Score = 40.8 bits (94), Expect = 0.010, Method: Compositional matrix adjust. Identities = 47/204 (23%), Positives = 77/204 (38%), Gaps = 16/204 (8%) Query 114 PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK 173 P +P++ R C W P L T L K E C + S Sbjct 5 PGKPEIHKCRSPDKETFTCWWNPGXXXXLPTNYSLTYSK----EGEKTTYECPDYKTSGP 60 Query 174 FSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVARN 230 SC + YI+++ + +GS S I++P+PP N+T V Sbjct 61 NSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKXXXXX 120 Query 231 PRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGL 286 +L V W P + +E+R + E ++ W + H + D + G Sbjct 121 KTYLWVKWSPPTIXXXXXXXXTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPGQ 177 Query 287 RHVVQLRAQEEFGQGEWSEWSPEA 310 +++VQ R + + G WS WS E+ Sbjct 178 KYLVQTRCKPD--HGYWSRWSQES 199
> 1bp3_B B PROTEIN (PROLACTIN RECEPTOR)
Length=211 Score = 40.4 bits (93), Expect = 0.012, Method: Compositional matrix adjust. Identities = 45/202 (22%), Positives = 73/202 (36%), Gaps = 12/202 (6%) Query 112 VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 +PP +P++ R C W P + T L + E C Sbjct 2 LPPGKPEIFKCRSPNKETFTCWWRPGTDGXXXTNYSLTYHR----EGETLMHECPDYITG 57 Query 172 QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN 230 SC YI+ + + S FS I+QPDPP + V Sbjct 58 GPNSCHFGKQYTSMWRTYIMMVNATNXXXSSFSDELYVDVTYIVQPDPPLELAVEVKQPE 117 Query 231 PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 R +L + W P + ++ L +E+R + E++ + Q I G Sbjct 118 DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSLHPGQ 176 Query 287 RHVVQLRAQEEFGQGEWSEWSP 308 +++VQ+R + + G WS WSP Sbjct 177 KYLVQVRCKPD--HGYWSAWSP 196
> 2lfg_A A Prolactin receptor
Length=113 Score = 37.0 bits (84), Expect = 0.059, Method: Composition-based stats. Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 7/100 (7%) Query 213 ILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTW 268 I+QPDPP + V R +L + W P + ++ L +E+R + E++ + Sbjct 3 IVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIH 62 Query 269 MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 Q I G +++VQ+R + + G WS WSP Sbjct 63 FAGQ-QTEFKILSLHPGQKYLVQVRCKPD--HGYWSAWSP 99
> 6smc_D D Interleukin-12 subunit beta
Length=344 Score = 38.5 bits (88), Expect = 0.081, Method: Compositional matrix adjust. Identities = 53/246 (22%), Positives = 92/246 (37%), Gaps = 42/246 (17%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR 98 PG++V LTC E ED+ T R GS G+ L + + D+G Y+C++ Sbjct 42 PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK 92 Query 99 AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-- 143 HLL+ + L C + C W + L Sbjct 93 XXETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN 152 Query 144 ---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ--LAVPEGDSSFYIVSM 192 ++AV ++ Q E SCQ + P + + I Sbjct 153 IKSSSSSPDSRAVTCGMASLSAEKVTLD---QRDYEKYSVSCQEDVTCPTAEETLPIELA 209 Query 193 CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYR 250 A + + +F I++PDPP N+ + + + + V+W+ P SW++ S++ Sbjct 210 LEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFS 267 Query 251 LRFELR 256 L+F +R Sbjct 268 LKFFVR 273
> 2djs_A A Ephrin type-B receptor 1
Length=108 Score = 35.4 bits (80), Expect = 0.15, Method: Compositional matrix adjust. Identities = 21/78 (27%), Positives = 38/78 (49%), Gaps = 2/78 (3%) Query 227 VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL 286 V+ R ++++W P N L +E+RY + F + M + + I G+ Sbjct 17 VSATMRSITLSWPQPEQPNGII--LDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGM 74 Query 287 RHVVQLRAQEEFGQGEWS 304 +VVQ+RA+ G G++S Sbjct 75 VYVVQVRARTVAGYGKFS 92
> 6ani_D L Coltuximab Fab light chain
Length=211 Score = 36.2 bits (82), Expect = 0.29, Method: Compositional matrix adjust. Identities = 32/130 (25%), Positives = 53/130 (41%), Gaps = 39/130 (30%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW------------------- 74 ++++ PG+ VT+TC + +HW +KP G+ P RW Sbjct 10 IMSASPGERVTMTCSASSGVN--YMHWYQQKP--GTSPRRWIYDTSKLASGVPARFSGSG 65 Query 75 AGMGRRLLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSCF 122 +G L + S++ D+ Y C++ G G L + PP + QL Sbjct 66 SGTDYSLTISSMEPEDAATYYCHQRGSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL--- 122 Query 123 RKSPLSNVVC 132 KS ++VVC Sbjct 123 -KSGTASVVC 131
> 6ani_F M Coltuximab Fab light chain
Length=211 Score = 36.2 bits (82), Expect = 0.31, Method: Compositional matrix adjust. Identities = 32/130 (25%), Positives = 53/130 (41%), Gaps = 39/130 (30%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW------------------- 74 ++++ PG+ VT+TC + +HW +KP G+ P RW Sbjct 10 IMSASPGERVTMTCSASSGVNY--MHWYQQKP--GTSPRRWIYDTSKLASGVPARFSGSG 65 Query 75 AGMGRRLLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSCF 122 +G L + S++ D+ Y C++ G G L + PP + QL Sbjct 66 SGTDYSLTISSMEPEDAATYYCHQRGSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL--- 122 Query 123 RKSPLSNVVC 132 KS ++VVC Sbjct 123 -KSGTASVVC 131
> 5uix_B L DH576 Fab light chain
Length=214 Score = 36.2 bits (82), Expect = 0.33, Method: Compositional matrix adjust. Identities = 25/83 (30%), Positives = 37/83 (45%), Gaps = 18/83 (22%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR-- 79 L++ GD VT+TC + DN ++W +KP PSR++G G Sbjct 11 LSASVGDRVTITCQASQDIDNY-LNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGT 69 Query 80 --RLLLRSVQLHDSGNYSCYRAG 100 L + S+Q D G Y C + G Sbjct 70 SFTLTISSLQPEDIGTYYCQKYG 92
> 4hs8_C L antibody hu5B3.v2 Fab light chain
Length=218 Score = 35.8 bits (81), Expect = 0.39, Method: Compositional matrix adjust. Identities = 26/85 (31%), Positives = 41/85 (48%), Gaps = 20/85 (24%) Query 35 LTSLPGDSVTLTCPGVEPEDNATV---HWVLRKP---------AAGSH----PSRWAGMG 78 L++ GD VT+TC E DN + +W +KP +A +H PSR++G G Sbjct 11 LSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYSASNHASGVPSRFSGSG 70 Query 79 R----RLLLRSVQLHDSGNYSCYRA 99 L + S+Q D Y C+++ Sbjct 71 SGTDFTLTISSLQPEDFATYYCHQS 95
> 1p2c_A A light chain anti-lysozyme antibody F10.6.6
Length=212 Score = 35.8 bits (81), Expect = 0.39, Method: Compositional matrix adjust. Identities = 30/110 (27%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYTSQSMSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++G G L + P +S F Sbjct 69 TDFTLSINSVETEDFGVYFCQQSGSWPRTFGGGTKLDIKRADAAPTVSIF 118
> 2q76_C C Fab F10.6.6 fragment Light Chain
Length=212 Score = 35.8 bits (81), Expect = 0.39, Method: Compositional matrix adjust. Identities = 30/110 (27%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYTSQSMSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++G G L + P +S F Sbjct 69 TDFTLSINSVETEDFGVYFCQQSGSWPRTFGGGTKLDIKRADAAPTVSIF 118
> 2q76_A A Fab F10.6.6 fragment Light Chain
Length=212 Score = 35.8 bits (81), Expect = 0.39, Method: Compositional matrix adjust. Identities = 30/110 (27%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYTSQSMSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++G G L + P +S F Sbjct 69 TDFTLSINSVETEDFGVYFCQQSGSWPRTFGGGTKLDIKRADAAPTVSIF 118
> 1p2c_D D light chain anti-lysozyme antibody F10.6.6
Length=212 Score = 35.8 bits (81), Expect = 0.40, Method: Compositional matrix adjust. Identities = 30/110 (27%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYTSQSMSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++G G L + P +S F Sbjct 69 TDFTLSINSVETEDFGVYFCQQSGSWPRTFGGGTKLDIKRADAAPTVSIF 118
> 6pis_F M ANTIBODY FAB FRAGMENT LIGHT CHAIN
Length=213 Score = 35.4 bits (80), Expect = 0.48, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 18/85 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR-- 79 L+ PGD VT+TC + N +HW +KP PSR++G G Sbjct 11 LSVSPGDKVTITCKASQ-NINQYLHWYQQKPEEAPKLLIYGASNLQTGIPSRFSGSGYGT 69 Query 80 --RLLLRSVQLHDSGNYSCYRAGRP 102 L + S+ D G Y C + P Sbjct 70 DFSLTINSLDSEDVGTYFCQQGYTP 94
> 6pis_C L ANTIBODY FAB FRAGMENT LIGHT CHAIN
Length=213 Score = 35.4 bits (80), Expect = 0.48, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 18/85 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR-- 79 L+ PGD VT+TC + N +HW +KP PSR++G G Sbjct 11 LSVSPGDKVTITCKASQ-NINQYLHWYQQKPEEAPKLLIYGASNLQTGIPSRFSGSGYGT 69 Query 80 --RLLLRSVQLHDSGNYSCYRAGRP 102 L + S+ D G Y C + P Sbjct 70 DFSLTINSLDSEDVGTYFCQQGYTP 94
> 1x5l_A A Ephrin type-A receptor 8
Length=111 Score = 33.9 bits (76), Expect = 0.65, Method: Compositional matrix adjust. Identities = 22/82 (27%), Positives = 39/82 (48%), Gaps = 4/82 (5%) Query 234 LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQL 292 +S+ WQ+P N L +E++Y E+ K ++ +K + + G R+V Q+ Sbjct 27 VSLLWQEPEQPNGII--LEYEIKY-YEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQV 83 Query 293 RAQEEFGQGEWSEWSPEAMGTP 314 RA+ G G +S+ G P Sbjct 84 RARTSAGCGRFSQAMEVETGKP 105
> 5oj6_B B MAM domain-containing glycosylphosphatidylinositol anchor
protein 1 Length=910 Score = 35.8 bits (81), Expect = 0.72, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 79/213 (37%), Gaps = 56/213 (26%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY- 97 PGD+VT+ C + V W + G P G L + +++ DSG Y+C Sbjct 236 PGDNVTMQCSLTGGDPQPEVLW---SHSPGPLPPNSLVQGGNLTIWRIRVEDSGYYNCTA 292 Query 98 --RAGRPA-GTVHLLV------------DVPPE--------EPQLSCFRKS-PLSNVVCE 133 G PA TV+LLV DV E + +LSC + P VV Sbjct 293 INNVGNPAKKTVNLLVRSMKNATFQITPDVIKESETIQLGQDLKLSCHVDAVPQEKVVYS 352 Query 134 WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC 193 W P + +L+ R N P E +C L + + S Y +C Sbjct 353 WYKNGKPXXXSDRLLITR---NDP------------ELPPVTCSLEIIDLRFSDYGTYLC 397 Query 194 VASSVGSKFSKTQTFQGCGILQPDPPANITVTA 226 VA TFQG I PD + +++ Sbjct 398 VA-----------TFQGAPI--PDLSVEVNISS 417
> 5kte_C L Fab Light Chain
Length=213 Score = 34.7 bits (78), Expect = 0.89, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K ++ PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYVSQSSSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIF 118
> 6d9w_C L Fab Light Chain
Length=213 Score = 34.7 bits (78), Expect = 0.89, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K ++ PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYVSQSSSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIF 118
> 1mlc_A A IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)
Length=214 Score = 34.7 bits (78), Expect = 0.95, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K ++ PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYVSQSSSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIF 118
> 1mlc_C C IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)
Length=214 Score = 34.7 bits (78), Expect = 0.95, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K ++ PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYVSQSSSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIF 118
> 1mlb_A A IGG1-KAPPA D44.1 FAB (LIGHT CHAIN)
Length=214 Score = 34.7 bits (78), Expect = 0.95, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K ++ PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYVSQSSSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIF 118
> 5u8q_D L Fv 24-60 light chain
Length=108 Score = 33.1 bits (74), Expect = 0.97, Method: Compositional matrix adjust. Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 18/83 (22%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQTISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRA 99 L + SV+ D G Y C ++ Sbjct 70 TDFTLSINSVETEDFGMYFCQQS 92
> 5u8r_C L Fv 24-60 light chain
Length=108 Score = 33.1 bits (74), Expect = 1.0, Method: Compositional matrix adjust. Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 18/83 (22%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQTISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRA 99 L + SV+ D G Y C ++ Sbjct 70 TDFTLSINSVETEDFGMYFCQQS 92
> 5oj2_A A MAM domain-containing glycosylphosphatidylinositol anchor
protein 1 Length=970 Score = 35.0 bits (79), Expect = 1.1, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 80/213 (38%), Gaps = 56/213 (26%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY- 97 PGD+VT+ C + V W + G P G L + +++ DSG Y+C Sbjct 236 PGDNVTMQCSLTGGDPQPEVLW---SHSPGPLPPNSLVQGGNLTIWRIRVEDSGYYNCTA 292 Query 98 --RAGRPA-GTVHLLV------------DVPPE--------EPQLSCFRKS-PLSNVVCE 133 G PA TV+LLV DV E + +LSC + P VV Sbjct 293 INNVGNPAKKTVNLLVRSMKNATFQITPDVIKESETIQLGQDLKLSCHVDAVPQEKVVYS 352 Query 134 WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC 193 W P+ + +L+ R N P E +C L + + S Y +C Sbjct 353 WYKNGKPARFSDRLLITR---NDP------------ELPPVTCSLEIIDLRFSDYGTYLC 397 Query 194 VASSVGSKFSKTQTFQGCGILQPDPPANITVTA 226 VA TFQG I PD + +++ Sbjct 398 VA-----------TFQGAPI--PDLSVEVNISS 417
> 1v7n_E N Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.5, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 1v7n_C M Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.5, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 1v7m_D M Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.5, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 1v7m_A L Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.5, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 5oj2_B B MAM domain-containing glycosylphosphatidylinositol anchor
protein 1 Length=970 Score = 34.7 bits (78), Expect = 1.5, Method: Compositional matrix adjust. Identities = 55/213 (26%), Positives = 79/213 (37%), Gaps = 56/213 (26%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY- 97 PGD+VT+ C + V W + G P G L + +++ DSG Y+C Sbjct 236 PGDNVTMQCSLTGGDPQPEVLW---SHSPGPLPPNSLVQGGNLTIWRIRVEDSGYYNCTA 292 Query 98 --RAGRPA-GTVHLLV------------DVPPE--------EPQLSCFRKS-PLSNVVCE 133 G PA TV+LLV DV E + +LSC + P VV Sbjct 293 INNVGNPAKKTVNLLVRSMKNATFQITPDVIKESETIQLGQDLKLSCHVDAVPQEKVVYS 352 Query 134 WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC 193 W P+ + L+ R N P E +C L + + S Y +C Sbjct 353 WYKNGKPARFSDXXLITR---NDP------------ELPPVTCSLEIIDLRFSDYGTYLC 397 Query 194 VASSVGSKFSKTQTFQGCGILQPDPPANITVTA 226 VA TFQG I PD + +++ Sbjct 398 VA-----------TFQGAPI--PDLSVEVNISS 417
> 2a0l_C C 33H1 Fv fragment
Length=105 Score = 32.3 bits (72), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ GD VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGDRVTMTCTASSSVSSSYLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L + S++ D+ Y C++ R Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQFHR 94
> 2a0l_E E 33H1 Fv fragment
Length=105 Score = 32.3 bits (72), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ GD VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGDRVTMTCTASSSVSSSYLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L + S++ D+ Y C++ R Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQFHR 94
> 1dqq_A A ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1dqq_C C ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1ndg_A A antibody kappa light chain
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1dqj_A A ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1dqm_A L ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN)
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1xgu_A A antibody kappa light chain
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1nby_A A antibody kappa light chain
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1ndm_A A antibody kappa light chain
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 1nbz_A A antibody kappa light chain
Length=214 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 118
> 6gc2_A L Light Chain
Length=252 Score = 34.3 bits (77), Expect = 1.6, Method: Compositional matrix adjust. Identities = 35/130 (27%), Positives = 52/130 (40%), Gaps = 36/130 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 29 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHEPPRLLIKYVSQSVSGIPSRFSGSGSG 87 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVD----------VPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + PP + QL Sbjct 88 TDFTLSINSVETEDFGMYFCGQSNSWPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQL--- 144 Query 123 RKSPLSNVVC 132 KS ++VVC Sbjct 145 -KSGTASVVC 153
> 1cd9_B B PROTEIN (G-CSF RECEPTOR)
Length=215 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 48/210 (23%), Positives = 81/210 (39%), Gaps = 22/210 (10%) Query 113 PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 PP P LSC +++VC+W P L T +L + F++ +Q + Sbjct 4 PPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFIL--KSFRSRADCQYQGDTIPDCVA 61 Query 172 QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA----NITV 224 +K ++P + Y + + + +GS S +++ +PP +I Sbjct 62 KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIXX 121 Query 225 TAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCV 278 P L ++W+ W S + ELRY+ A + F KD C Sbjct 122 XXXXXQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCG 178 Query 279 IHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 +H A + +Q+R G WS WSP Sbjct 179 LHQA---PVYTLQMRCIRSSLPGFWSPWSP 205
> 2zkh_A L Monoclonal TN1 FAB light chain
Length=213 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 1xgt_A A antibody kappa light chain
Length=215 Score = 33.9 bits (76), Expect = 1.7, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 70 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 119
> 1xgr_A A antibody kappa light chain
Length=215 Score = 33.9 bits (76), Expect = 1.7, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 70 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 119
> 1xgq_A A antibody kappa light chain
Length=215 Score = 33.9 bits (76), Expect = 1.7, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 70 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 119
> 1xgp_A A antibody kappa light chain
Length=215 Score = 33.9 bits (76), Expect = 1.7, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 11 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 69 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 70 TDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIF 119
> 6df0_A L 4G10-4D5 Antibody Light chain
Length=248 Score = 33.9 bits (76), Expect = 1.7, Method: Compositional matrix adjust. Identities = 35/128 (27%), Positives = 50/128 (39%), Gaps = 34/128 (27%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRW----AGM 77 L++ GD VT+TC ++ +HW +KP A PSR+ +G Sbjct 34 LSASVGDRVTITCRASSSVSSSYLHWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSRSGT 93 Query 78 GRRLLLRSVQLHDSGNYSC-----YRAGRPAGTVHLLVDV--------PPEEPQLSCFRK 124 L + S+Q D Y C YR V + V PP + QL K Sbjct 94 DFTLTISSLQPEDFATYYCQQYSGYRTFGQGTKVEIKRTVAAPSVFIFPPSDSQL----K 149 Query 125 SPLSNVVC 132 S ++VVC Sbjct 150 SGTASVVC 157
> 1v7n_A L Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.8, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 1v7n_G O Monoclonal TN1 Fab Light Chain
Length=213 Score = 33.9 bits (76), Expect = 1.8, Method: Compositional matrix adjust. Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 23/111 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G++++ PG+ VT+TC + ++W +KP A P+R+ G G Sbjct 9 GIMSASPGEKVTITCSA--SSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGS 66 Query 80 ----RLLLRSVQLHDSGNYSC-YRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + ++ D+ Y C R+G P G L + P +S F Sbjct 67 GTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIF 117
> 6df1_A L Anti-phosphotyrosine antibody 4G10-4D5 heavy chain
Length=240 Score = 33.9 bits (76), Expect = 1.9, Method: Compositional matrix adjust. Identities = 35/128 (27%), Positives = 50/128 (39%), Gaps = 34/128 (27%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRW----AGM 77 L++ GD VT+TC ++ +HW +KP A PSR+ +G Sbjct 34 LSASVGDRVTITCRASSSVSSSYLHWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSRSGT 93 Query 78 GRRLLLRSVQLHDSGNYSC-----YRAGRPAGTVHLLVDV--------PPEEPQLSCFRK 124 L + S+Q D Y C YR V + V PP + QL K Sbjct 94 DFTLTISSLQPEDFATYYCQQYSGYRTFGQGTKVEIKRTVAAPSVFIFPPSDSQL----K 149 Query 125 SPLSNVVC 132 S ++VVC Sbjct 150 SGTASVVC 157
> 6v4p_D D Abciximab, light chain
Length=214 Score = 33.5 bits (75), Expect = 2.1, Method: Compositional matrix adjust. Identities = 38/130 (29%), Positives = 53/130 (41%), Gaps = 36/130 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHW----------VLRKPAAGSH---PSRWAGMGR- 79 L+ PGDSV+L+C N +HW +L K A+ S PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASRDISN-NLHWFQQTSHESPRLLIKYASQSMSGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVD----------VPPEEPQLSCF 122 L + SV+ D G Y C + G L + PP + QL Sbjct 69 TDFTLSINSVETEDFGMYFCQQTNSWPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL--- 125 Query 123 RKSPLSNVVC 132 KS ++VVC Sbjct 126 -KSGTASVVC 134
> 25c8_A L IGG 5C8
Length=212 Score = 33.5 bits (75), Expect = 2.3, Method: Compositional matrix adjust. Identities = 26/113 (23%), Positives = 46/113 (41%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTASSSVSSSNLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP----AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C++ R G L + P +S F Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIF 119
> 35c8_A L IGG 5C8
Length=212 Score = 33.5 bits (75), Expect = 2.3, Method: Compositional matrix adjust. Identities = 26/113 (23%), Positives = 46/113 (41%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTASSSVSSSNLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP----AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C++ R G L + P +S F Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIF 119
> 15c8_A L IGG 5C8 FAB (LIGHT CHAIN)
Length=213 Score = 33.5 bits (75), Expect = 2.3, Method: Compositional matrix adjust. Identities = 26/113 (23%), Positives = 46/113 (41%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTASSSVSSSNLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP----AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C++ R G L + P +S F Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIF 119
> 4ffv_C C 11A19 Fab light chain
Length=210 Score = 33.5 bits (75), Expect = 2.4, Method: Compositional matrix adjust. Identities = 30/113 (27%), Positives = 47/113 (42%), Gaps = 27/113 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +L++ PG+ VT+TC +N +HW +KP GS P W +G+ R Sbjct 9 AILSASPGEKVTMTCRASSSVNN--MHWYQQKP--GSSPKPWLHGTSNLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + V+ D+ Y C + + P G L +D P +S F Sbjct 65 GSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRADAAPTVSIF 117
> 4ffv_E L 11A19 Fab light chain
Length=210 Score = 33.5 bits (75), Expect = 2.4, Method: Compositional matrix adjust. Identities = 30/113 (27%), Positives = 47/113 (42%), Gaps = 27/113 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +L++ PG+ VT+TC +N +HW +KP GS P W +G+ R Sbjct 9 AILSASPGEKVTMTCRASSSVNN--MHWYQQKP--GSSPKPWLHGTSNLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + V+ D+ Y C + + P G L +D P +S F Sbjct 65 GSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRADAAPTVSIF 117
> 1bm3_A L IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN
Length=214 Score = 33.5 bits (75), Expect = 2.4, Method: Compositional matrix adjust. Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 18/83 (22%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRA 99 L + SV+ D G Y C ++ Sbjct 69 TDFTLSINSVETEDFGMYFCQQS 91
> 1opg_A L OPG2 FAB (LIGHT CHAIN)
Length=214 Score = 33.5 bits (75), Expect = 2.4, Method: Compositional matrix adjust. Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 18/83 (22%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISN-NLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRA 99 L + SV+ D G Y C ++ Sbjct 69 TDFTLSINSVETEDFGMYFCQQS 91
> 6u6u_B L BI00655130 Fab light chain
Length=215 Score = 33.5 bits (75), Expect = 2.5, Method: Compositional matrix adjust. Identities = 33/131 (25%), Positives = 51/131 (39%), Gaps = 35/131 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G L+ PG+ T+TC ++ HW +KP A P R++G G Sbjct 9 GTLSLSPGERATMTCTASSSVSSSYFHWYQQKPGQAPRLWIYRTSRLASGVPDRFSGSGS 68 Query 80 ----RLLLRSVQLHDSGNYSCYRAGRP-----AGTVHLL---------VDVPPEEPQLSC 121 L + ++ D+ Y C++ R AGT + PP + QL Sbjct 69 GTDFTLTISRLEPEDAATYYCHQFHRSPLTFGAGTKLEIKRTVAAPSVFIFPPSDEQL-- 126 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 127 --KSGTASVVC 135
> 6djp_D D 8B8 light chain Fab
Length=213 Score = 33.1 bits (74), Expect = 2.7, Method: Compositional matrix adjust. Identities = 20/85 (24%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + +HW +K +G+ P RW +G+ R Sbjct 9 AIMSAFPGEKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 5opy_B L Light chain of LM609 Fab (antigen-binding fragment)
Length=214 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISNH-LHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPHTFGGGTKLEIKRADAAPTVSIF 118
> 1ors_A A 33H1 Fab light chain
Length=214 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ GD VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGDRVTMTCTASSSVSSSYLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L + S++ D+ Y C++ R Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQFHR 94
> 6avq_D L LM609 Fab light chain
Length=214 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISNH-LHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPHTFGGGTKLEIKRADAAPTVSIF 118
> 6avr_D L Fab LM609 light chain
Length=214 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISNH-LHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPHTFGGGTKLEIKRADAAPTVSIF 118
> 6avu_D L Fab LM609 light chain
Length=214 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 22/110 (20%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR- 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 10 TLSVTPGDSVSLSCRASQSISNH-LHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSG 68 Query 80 ---RLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDVPPEEPQLSCF 122 L + SV+ D G Y C ++ G L + P +S F Sbjct 69 TDFTLSINSVETEDFGMYFCQQSNSWPHTFGGGTKLEIKRADAAPTVSIF 118
> 2brr_B L MN20B9.34 ANTI-P1.4 ANTIBODY, FAB LIGHT CHAIN
Length=215 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 27/113 (24%), Positives = 48/113 (42%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSASPGEKVTMTCRASSSVSSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + SV+ D+ Y C + +G P G L + P +S F Sbjct 67 GSGTSYSLTISSVEAEDAATYYCQQYSGYPYTFGGGTKLEIKRADAAPTVSIF 119
> 6k7o_I L h128-3 Fab light chain
Length=218 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 17/82 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR-- 79 L++ GD VT+TC E ++ + W +KP A PSR++G G Sbjct 11 LSASVGDRVTITCQASESINSIYLAWYQQKPGKAPKLLIYRASTLASGVPSRFSGSGSGT 70 Query 80 --RLLLRSVQLHDSGNYSCYRA 99 L + S+Q D Y C ++ Sbjct 71 DFTLTISSLQPEDFATYYCQQS 92
> 6k7o_G G h128-3 Fab light chain
Length=218 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 17/82 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR-- 79 L++ GD VT+TC E ++ + W +KP A PSR++G G Sbjct 11 LSASVGDRVTITCQASESINSIYLAWYQQKPGKAPKLLIYRASTLASGVPSRFSGSGSGT 70 Query 80 --RLLLRSVQLHDSGNYSCYRA 99 L + S+Q D Y C ++ Sbjct 71 DFTLTISSLQPEDFATYYCQQS 92
> 6k7o_C C h128-3 Fab light chain
Length=218 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 17/82 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR-- 79 L++ GD VT+TC E ++ + W +KP A PSR++G G Sbjct 11 LSASVGDRVTITCQASESINSIYLAWYQQKPGKAPKLLIYRASTLASGVPSRFSGSGSGT 70 Query 80 --RLLLRSVQLHDSGNYSCYRA 99 L + S+Q D Y C ++ Sbjct 71 DFTLTISSLQPEDFATYYCQQS 92
> 6k7o_E E h128-3 Fab light chain
Length=218 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 17/82 (21%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR-- 79 L++ GD VT+TC E ++ + W +KP A PSR++G G Sbjct 11 LSASVGDRVTITCQASESINSIYLAWYQQKPGKAPKLLIYRASTLASGVPSRFSGSGSGT 70 Query 80 --RLLLRSVQLHDSGNYSCYRA 99 L + S+Q D Y C ++ Sbjct 71 DFTLTISSLQPEDFATYYCQQS 92
> 2brr_D X MN20B9.34 ANTI-P1.4 ANTIBODY, FAB LIGHT CHAIN
Length=215 Score = 33.1 bits (74), Expect = 2.9, Method: Compositional matrix adjust. Identities = 27/113 (24%), Positives = 48/113 (42%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSASPGEKVTMTCRASSSVSSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + SV+ D+ Y C + +G P G L + P +S F Sbjct 67 GSGTSYSLTISSVEAEDAATYYCQQYSGYPYTFGGGTKLEIKRADAAPTVSIF 119
> 5gir_B L Light chain of Fab fragment
Length=234 Score = 33.1 bits (74), Expect = 3.5, Method: Compositional matrix adjust. Identities = 24/85 (28%), Positives = 37/85 (44%), Gaps = 18/85 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 29 ATLSVTPGDSVSLSCRASQRISN-NLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGS 87 Query 80 ----RLLLRSVQLHDSGNYSCYRAG 100 L + SV+ D G Y C ++ Sbjct 88 GTDFTLSINSVETEDFGMYFCQQSN 112
> 5gir_D B Light chain of Fab fragment
Length=234 Score = 33.1 bits (74), Expect = 3.5, Method: Compositional matrix adjust. Identities = 24/85 (28%), Positives = 37/85 (44%), Gaps = 18/85 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 29 ATLSVTPGDSVSLSCRASQRISN-NLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGS 87 Query 80 ----RLLLRSVQLHDSGNYSCYRAG 100 L + SV+ D G Y C ++ Sbjct 88 GTDFTLSINSVETEDFGMYFCQQSN 112
> 5gis_B L Light chain of Fab fragment
Length=234 Score = 33.1 bits (74), Expect = 3.5, Method: Compositional matrix adjust. Identities = 24/85 (28%), Positives = 37/85 (44%), Gaps = 18/85 (21%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR 79 L+ PGDSV+L+C + N +HW +K + PSR++G G Sbjct 29 ATLSVTPGDSVSLSCRASQRISN-NLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGS 87 Query 80 ----RLLLRSVQLHDSGNYSCYRAG 100 L + SV+ D G Y C ++ Sbjct 88 GTDFTLSINSVETEDFGMYFCQQSN 112
> 3iu3_B B Light chain of Fab fragment of Basiliximab
Length=210 Score = 32.7 bits (73), Expect = 3.6, Method: Compositional matrix adjust. Identities = 31/131 (24%), Positives = 53/131 (40%), Gaps = 39/131 (30%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + + W +KP G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSRSYMQWYQQKP--GTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSC 121 L + S++ D+ Y C++ G L + PP + QL Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL-- 122 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 123 --KSGTASVVC 131
> 3iu3_F L Light chain of Fab fragment of Basiliximab
Length=210 Score = 32.7 bits (73), Expect = 3.6, Method: Compositional matrix adjust. Identities = 31/131 (24%), Positives = 53/131 (40%), Gaps = 39/131 (30%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + + W +KP G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSRSYMQWYQQKP--GTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSC 121 L + S++ D+ Y C++ G L + PP + QL Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL-- 122 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 123 --KSGTASVVC 131
> 1rvf_E L FAB 17-IA
Length=110 Score = 31.6 bits (70), Expect = 3.6, Method: Compositional matrix adjust. Identities = 13/42 (31%), Positives = 23/42 (55%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PG+ VT+TC + +HW +KP G+ P W Sbjct 9 AIMSAFPGEKVTITCSATSSVNY--MHWFQQKP--GTSPKLW 46
> 6df2_A L Anti-phosphotyrosine antibody c310-4D5 heavy chain
Length=251 Score = 33.1 bits (74), Expect = 3.8, Method: Compositional matrix adjust. Identities = 35/131 (27%), Positives = 50/131 (38%), Gaps = 37/131 (28%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRW----AGM 77 L++ GD VT+TC ++ +HW +KP A PSR+ +G Sbjct 34 LSASVGDRVTITCRASSSVSSSYLHWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSRSGT 93 Query 78 GRRLLLRSVQLHDSGNYSC--------YRAGRPAGTVHLLVDV--------PPEEPQLSC 121 L + S+Q D Y C YR V + V PP + QL Sbjct 94 DFTLTISSLQPEDFATYYCQQYSRRTSYRTFGQGTKVEIKRTVAAPSVFIFPPSDSQL-- 151 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 152 --KSGTASVVC 160
> 6df2_D A Anti-phosphotyrosine antibody c310-4D5 heavy chain
Length=251 Score = 33.1 bits (74), Expect = 3.8, Method: Compositional matrix adjust. Identities = 35/131 (27%), Positives = 50/131 (38%), Gaps = 37/131 (28%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRW----AGM 77 L++ GD VT+TC ++ +HW +KP A PSR+ +G Sbjct 34 LSASVGDRVTITCRASSSVSSSYLHWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSRSGT 93 Query 78 GRRLLLRSVQLHDSGNYSC--------YRAGRPAGTVHLLVDV--------PPEEPQLSC 121 L + S+Q D Y C YR V + V PP + QL Sbjct 94 DFTLTISSLQPEDFATYYCQQYSRRTSYRTFGQGTKVEIKRTVAAPSVFIFPPSDSQL-- 151 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 152 --KSGTASVVC 160
> 1mim_A L CHIMERIC SDZ CHI621
Length=210 Score = 32.7 bits (73), Expect = 3.8, Method: Compositional matrix adjust. Identities = 31/131 (24%), Positives = 53/131 (40%), Gaps = 39/131 (30%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + + W +KP G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSRSYMQWYQQKP--GTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSC 121 L + S++ D+ Y C++ G L + PP + QL Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL-- 122 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 123 --KSGTASVVC 131
> 5nj6_C L Fab3949 L
Length=213 Score = 32.7 bits (73), Expect = 3.9, Method: Compositional matrix adjust. Identities = 26/113 (23%), Positives = 46/113 (41%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC ++ +HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTASSSISSSYLHWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP----AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C++ R G L + P +S F Sbjct 67 GSGTSYSLTISSMEAEDAATYYCHQFHRSPYTFGGGTKLEIKRADAAPTVSIF 119
> 1fnl_A A LOW AFFINITY IMMUNOGLOBULIN GAMMA FC REGION RECEPTOR
III-B Length=175 Score = 32.3 bits (72), Expect = 3.9, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + + + ++DSG Y C Sbjct 20 LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC 71
> 1orq_A A 6E1 Fab light chain
Length=215 Score = 32.7 bits (73), Expect = 4.0, Method: Compositional matrix adjust. Identities = 27/113 (24%), Positives = 47/113 (42%), Gaps = 25/113 (22%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSPSPGEKVTMTCRARSSVSSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + SV+ D+ Y C + +G P G L + P +S F Sbjct 67 GSGTSYSLTISSVEAEDTATYYCQQYSGNPWTFGGGTKLEIKRADAAPTVSIF 119
> 3w2d_B L Monoclonal Antibody 3E2 Fab figment light chain
Length=215 Score = 32.7 bits (73), Expect = 4.1, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG++VT+TC + +HW +K +G+ P W +G+ R Sbjct 9 AIMSASPGETVTMTCRATSSVSSTYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 3iu3_D D Light chain of Fab fragment of Basiliximab
Length=210 Score = 32.7 bits (73), Expect = 4.2, Method: Compositional matrix adjust. Identities = 31/131 (24%), Positives = 53/131 (40%), Gaps = 39/131 (30%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + + W +KP G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSRSYMQWYQQKP--GTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVD----------VPPEEPQLSC 121 L + S++ D+ Y C++ G L + PP + QL Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL-- 122 Query 122 FRKSPLSNVVC 132 KS ++VVC Sbjct 123 --KSGTASVVC 131
> 1pgr_F F PROTEIN (G-CSF RECEPTOR)
Length=215 Score = 32.7 bits (73), Expect = 4.2, Method: Compositional matrix adjust. Identities = 48/210 (23%), Positives = 80/210 (38%), Gaps = 22/210 (10%) Query 113 PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 PP P LSC +++VC+W P L T +L + F++ +Q + Sbjct 4 PPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFIL--KSFRSRADCQYQGDTIPDCVA 61 Query 172 QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA----NITV 224 +K ++P + Y + + + +GS S + + +PP +I Sbjct 62 KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVXKLEPPMLQALDIGP 121 Query 225 TAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCV 278 P L ++W+ W S + ELRY+ A + F KD C Sbjct 122 DXXXHQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCG 178 Query 279 IHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 +H A + +Q+R G WS WSP Sbjct 179 LHQA---PVYTLQMRCIRSSLPGFWSPWSP 205
> 1ken_I U influenza virus infectivity neutralizing antibody (light
chain) Length=213 Score = 32.7 bits (73), Expect = 4.3, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 21/85 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VTLTC ++ ++W +KP GS P W +G+ R Sbjct 9 AIMSASPGEKVTLTCSASSTITSSFLYWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D +Y C++ Sbjct 67 GSGTSYSLTISSLEAEDGASYFCHQ 91
> 1ken_G L influenza virus infectivity neutralizing antibody (light
chain) Length=213 Score = 32.7 bits (73), Expect = 4.3, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 21/85 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VTLTC ++ ++W +KP GS P W +G+ R Sbjct 9 AIMSASPGEKVTLTCSASSTITSSFLYWYQQKP--GSSPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D +Y C++ Sbjct 67 GSGTSYSLTISSLEAEDGASYFCHQ 91
> 1e4k_C C LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III
Length=176 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + + + ++DSG Y C Sbjct 21 LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC 72
> 1t83_C C Low affinity immunoglobulin gamma Fc region receptor
III-B Length=176 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + + + ++DSG Y C Sbjct 20 LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC 71
> 1t89_C C Low affinity immunoglobulin gamma Fc region receptor
III-B Length=176 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + + + ++DSG Y C Sbjct 20 LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC 71
> 5yc5_C C Low affinity immunoglobulin gamma Fc region receptor
III-A Length=182 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 22/60 (37%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + L+ + + DSG Y C Sbjct 20 LEKDSVTLKCRGAYSPEDNST-QWFHNESLISSQASSY-------LIDAATVDDSGEYRC 71
> 1e4j_A A LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III
Length=176 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%) Query 38 LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 L DSVTL C G PEDN+T W + S S + + + ++DSG Y C Sbjct 21 LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC 72
> 1x5h_A A Neogenin
Length=132 Score = 31.6 bits (70), Expect = 5.0, Method: Compositional matrix adjust. Identities = 30/114 (26%), Positives = 49/114 (43%), Gaps = 8/114 (7%) Query 219 PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHC 277 P N+++ RN + + + WQ P + +++RYR A R T +V Q Sbjct 22 PQNLSLEV--RNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQ 79 Query 278 VIHDAWSGLRHVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSPPAENEVSTP 330 +I G + ++ A G G ++W S E + E+R P EVS P Sbjct 80 LIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVP----EVSGP 129
> 4kkl_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4ene_D D light chain of Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4ene_F F light chain of Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kka_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kkc_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kkc_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1otu_F F Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3det_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjw_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjw_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3ejy_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kkb_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2h2s_D D FAB fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3ejy_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2htk_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5d_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6adc_F F antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3ejz_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht4_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3det_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4fg6_F F Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4lou_F F Fab light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht2_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht2_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1ott_D D Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1ott_F F Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5d_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2exw_D D Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2exy_F F Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2exy_D D Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kkl_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4mqx_F F ERIC
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4mqx_D D ERIC
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5f_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5f_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ad8_F F antibody Fab fragment light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2hlf_D D Fab Fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1otu_D D Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 5hd8_D D FAB FRAGMENT (LIGHT CHAIN)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2htk_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjq_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2htl_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ad7_D D antibody Fab fragment light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1ots_F F Fab fragment (light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5i_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2htl_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk8_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4fg6_D D Fab fragment (Light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6adc_D D antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ad7_F F antibody Fab fragment light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fed_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fed_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ad8_D D antibody Fab fragment light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kkb_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk8_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kka_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk6_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2r9h_D D Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2r9h_F F Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fee_F L Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1ots_D D Fab fragment (light chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht3_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ez0_D D Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk5_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk5_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 3ejz_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2h2p_D D FAB fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2hlf_F F Fab Fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjp_D D light chain of Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjp_F F light chain of Fab fragment
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kjq_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 5hd8_F F FAB FRAGMENT (LIGHT CHAIN)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht3_D D Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ada_F F antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2h2s_F F FAB fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fec_D O Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fec_F L Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4lou_D D Fab light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ez0_F F Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6adb_F F antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk9_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk9_D D Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2exw_F F Fab Fragment (Light Chain)
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2fee_D O Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2h2p_F F FAB fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6adb_D D antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6ada_D D antibody Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 2ht4_F F Fab fragment, Light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 4kk6_F F Fab, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5i_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5a_D D Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 6k5a_F F Fab fragment, light chain
Length=211 Score = 32.3 bits (72), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PGD VT+TC + +HW +K +G+ P RW Sbjct 9 AIMSAAPGDKVTMTCSA--SSSVSYIHWYQQK--SGTSPKRW 46
> 1bql_A L HYHEL-5 FAB (LIGHT CHAIN)
Length=212 Score = 32.3 bits (72), Expect = 5.5, Method: Compositional matrix adjust. Identities = 26/112 (23%), Positives = 47/112 (42%), Gaps = 26/112 (23%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + ++W +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSASSSVN--YMYWYQQK--SGTSPKRWIYDTSKLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C + GR G L + P +S F Sbjct 65 GSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIF 116
> 2iff_A L IGG1 HYHEL-5 FAB (LIGHT CHAIN)
Length=212 Score = 32.3 bits (72), Expect = 5.5, Method: Compositional matrix adjust. Identities = 26/112 (23%), Positives = 47/112 (42%), Gaps = 26/112 (23%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + ++W +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSASSSVN--YMYWYQQK--SGTSPKRWIYDTSKLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C + GR G L + P +S F Sbjct 65 GSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIF 116
> 1yqv_A L HyHEL-5 Antibody Light Chain
Length=211 Score = 32.3 bits (72), Expect = 5.5, Method: Compositional matrix adjust. Identities = 26/112 (23%), Positives = 47/112 (42%), Gaps = 26/112 (23%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + ++W +K +G+ P RW +G+ R Sbjct 10 AIMSASPGEKVTMTCSASSSVN--YMYWYQQK--SGTSPKRWIYDTSKLASGVPVRFSGS 65 Query 81 -------LLLRSVQLHDSGNYSCYRAGRP---AGTVHLLVDVPPEEPQLSCF 122 L + S++ D+ Y C + GR G L + P +S F Sbjct 66 GSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIF 117
> 1pgr_B B PROTEIN (G-CSF RECEPTOR)
Length=215 Score = 32.3 bits (72), Expect = 5.6, Method: Compositional matrix adjust. Identities = 48/210 (23%), Positives = 80/210 (38%), Gaps = 22/210 (10%) Query 113 PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 PP P LSC +++VC+W P L T +L + F++ +Q + Sbjct 4 PPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFIL--KSFRSRADCQYQGDTIPDCVA 61 Query 172 QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA----NITV 224 +K ++P + Y + + + +GS S + + +PP +I Sbjct 62 KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVXKLEPPMLQALDIGP 121 Query 225 TAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCV 278 P L ++W+ W S + ELRY+ A + F KD C Sbjct 122 DXXXXQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCG 178 Query 279 IHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 +H A + +Q+R G WS WSP Sbjct 179 LHQA---PVYTLQMRCIRSSLPGFWSPWSP 205
> 1gl4_B B BASEMENT MEMBRANE-SPECIFIC HEPARAN SULFATE PROTEOGLYCAN
CORE PROTEIN Length=98 Score = 30.8 bits (68), Expect = 5.9, Method: Compositional matrix adjust. Identities = 19/58 (33%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC 96 PG VT C T+ W + G PSR L +R+VQ D+G Y C Sbjct 24 PGADVTFICTAKSKSPAYTLVWT--RLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVC 79
> 6m87_F I Fab 10A6 light chain
Length=215 Score = 32.3 bits (72), Expect = 5.9, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 6m87_C C Fab 10A6 light chain
Length=215 Score = 32.0 bits (71), Expect = 6.0, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 6m87_E G Fab 10A6 light chain
Length=215 Score = 32.0 bits (71), Expect = 6.0, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 6m87_G K Fab 10A6 light chain
Length=215 Score = 32.0 bits (71), Expect = 6.2, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 6ewb_F F Fab light chain
Length=214 Score = 32.0 bits (71), Expect = 6.6, Method: Compositional matrix adjust. Identities = 21/82 (26%), Positives = 37/82 (45%), Gaps = 23/82 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR----- 80 ++++ PG+ VT+TC D +HW +K +G+ P RW +G+ R Sbjct 11 IMSASPGEKVTMTCSASSSVD--YMHWYQQK--SGTSPKRWIYDTYKLASGVPARFSGSG 66 Query 81 ------LLLRSVQLHDSGNYSC 96 L + S++ D+ Y C Sbjct 67 SGTSYSLTINSMEAEDAATYYC 88
> 6ewb_L L Fab light chain
Length=214 Score = 32.0 bits (71), Expect = 6.9, Method: Compositional matrix adjust. Identities = 21/82 (26%), Positives = 37/82 (45%), Gaps = 23/82 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR----- 80 ++++ PG+ VT+TC D +HW +K +G+ P RW +G+ R Sbjct 11 IMSASPGEKVTMTCSASSSVD--YMHWYQQK--SGTSPKRWIYDTYKLASGVPARFSGSG 66 Query 81 ------LLLRSVQLHDSGNYSC 96 L + S++ D+ Y C Sbjct 67 SGTSYSLTINSMEAEDAATYYC 88
> 4f9p_C D 103.2 anti-BTN3A1 antibody fragment
Length=254 Score = 32.0 bits (71), Expect = 6.9, Method: Compositional matrix adjust. Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 18/79 (23%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHW----------VLRKPAAGS---HPSRWAGMGR-- 79 L+ PGDSV+L+C + N +HW +L K A+ S PSR++G G Sbjct 147 LSVTPGDSVSLSCRASQSISN-NLHWYRQKSHESPRLLIKYASQSIFGIPSRFSGSGSGT 205 Query 80 --RLLLRSVQLHDSGNYSC 96 L + SV+ D G Y C Sbjct 206 EFTLSINSVETEDFGIYFC 224
> 4f9p_D C 103.2 anti-BTN3A1 antibody fragment
Length=254 Score = 32.0 bits (71), Expect = 7.0, Method: Compositional matrix adjust. Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 18/79 (23%) Query 35 LTSLPGDSVTLTCPGVEPEDNATVHW----------VLRKPAAGS---HPSRWAGMGR-- 79 L+ PGDSV+L+C + N +HW +L K A+ S PSR++G G Sbjct 147 LSVTPGDSVSLSCRASQSISN-NLHWYRQKSHESPRLLIKYASQSIFGIPSRFSGSGSGT 205 Query 80 --RLLLRSVQLHDSGNYSC 96 L + SV+ D G Y C Sbjct 206 EFTLSINSVETEDFGIYFC 224
> 6m87_A A Fab 10A6 light chain
Length=215 Score = 32.0 bits (71), Expect = 7.1, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 6m87_D E Fab 10A6 light chain
Length=215 Score = 32.0 bits (71), Expect = 7.1, Method: Compositional matrix adjust. Identities = 21/85 (25%), Positives = 39/85 (46%), Gaps = 23/85 (27%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC + VHW +K +G+ P RW +G+ R Sbjct 9 AIMSASPGEKVTMTCSA--SSSVSYVHWYQQK--SGTSPKRWIYDTSKLASGVPARFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR 98 L + S++ D+ Y C++ Sbjct 65 GSGTSYSLTISSMEAEDAATYYCHQ 89
> 1ob1_D D ANTIBODY, HEAVY CHAIN
Length=215 Score = 32.0 bits (71), Expect = 7.4, Method: Compositional matrix adjust. Identities = 13/42 (31%), Positives = 23/42 (55%), Gaps = 2/42 (5%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ G+ VT+TC ++ +HW +KP GS P W Sbjct 9 AIMSAFLGERVTMTCTATSSLSSSYLHWYQQKP--GSSPKLW 48
> 1ob1_A A ANTIBODY, HEAVY CHAIN
Length=215 Score = 32.0 bits (71), Expect = 7.4, Method: Compositional matrix adjust. Identities = 13/42 (31%), Positives = 23/42 (55%), Gaps = 2/42 (5%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ G+ VT+TC ++ +HW +KP GS P W Sbjct 9 AIMSAFLGERVTMTCTATSSLSSSYLHWYQQKP--GSSPKLW 48
> 6ewb_I I Fab light chain
Length=214 Score = 32.0 bits (71), Expect = 7.5, Method: Compositional matrix adjust. Identities = 21/82 (26%), Positives = 37/82 (45%), Gaps = 23/82 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR----- 80 ++++ PG+ VT+TC D +HW +K +G+ P RW +G+ R Sbjct 11 IMSASPGEKVTMTCSASSSVD--YMHWYQQK--SGTSPKRWIYDTYKLASGVPARFSGSG 66 Query 81 ------LLLRSVQLHDSGNYSC 96 L + S++ D+ Y C Sbjct 67 SGTSYSLTINSMEAEDAATYYC 88
> 1pgr_D D PROTEIN (G-CSF RECEPTOR)
Length=215 Score = 32.0 bits (71), Expect = 7.7, Method: Compositional matrix adjust. Identities = 48/216 (22%), Positives = 82/216 (38%), Gaps = 34/216 (16%) Query 113 PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 PP P LSC +++VC+W P P +++ F++ + CQY ++ Sbjct 4 PPASPSNLSCLMHLTTNSLVCQWEP--GPETXXXTSFILKSFRS------RADCQYQGDT 55 Query 172 ------QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA-- 220 +K ++P + Y + + + +GS S + + +PP Sbjct 56 IPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVXKLEPPMLQ 115 Query 221 --NITVTAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKD 272 +I P L ++W+ W S + ELRY+ A + F KD Sbjct 116 ALDIXXXXXXXQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKD 172 Query 273 LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 C +H A + +Q+R G WS WSP Sbjct 173 QFELCGLHQA---PVYTLQMRCIRSSLPGFWSPWSP 205
> 1pgr_H H PROTEIN (G-CSF RECEPTOR)
Length=215 Score = 32.0 bits (71), Expect = 7.7, Method: Compositional matrix adjust. Identities = 48/216 (22%), Positives = 82/216 (38%), Gaps = 34/216 (16%) Query 113 PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES 171 PP P LSC +++VC+W P P +++ F++ + CQY ++ Sbjct 4 PPASPSNLSCLMHLTTNSLVCQWEP--GPETXXXTSFILKSFRS------RADCQYQGDT 55 Query 172 ------QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA-- 220 +K ++P + Y + + + +GS S + + +PP Sbjct 56 IPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVXKLEPPMLQ 115 Query 221 --NITVTAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKD 272 +I P L ++W+ W S + ELRY+ A + F KD Sbjct 116 ALDIXXXXXXXQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKD 172 Query 273 LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP 308 C +H A + +Q+R G WS WSP Sbjct 173 QFELCGLHQA---PVYTLQMRCIRSSLPGFWSPWSP 205
> 4xph_B L Antibody fragment light chain
Length=214 Score = 31.6 bits (70), Expect = 7.9, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 6jhs_D D FAB Light Chain
Length=213 Score = 31.6 bits (70), Expect = 8.0, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 26/51 (51%), Gaps = 4/51 (8%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLL 83 ++++ PG+ VT+TC + +HW +K +G+ P RW RL Sbjct 9 AIMSASPGEKVTMTCSAASSV--SYIHWYQQK--SGTSPKRWIYDTSRLAF 55
> 4hs6_C A MRCT10.v362 Fab light chain
Length=218 Score = 31.6 bits (70), Expect = 8.2, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 20/82 (24%) Query 35 LTSLPGDSVTLTCPGVEPEDN---ATVHWVLRKPAAG-------------SHPSRWAGMG 78 L++ GD VT+TC E D + +HW +KP PSR++G G Sbjct 11 LSASVGDRVTITCRASESVDGYGYSFLHWFQQKPGKAPKLLIYLASNLNSGVPSRFSGSG 70 Query 79 R----RLLLRSVQLHDSGNYSC 96 L + S+Q D Y C Sbjct 71 SGTDFTLTISSLQPEDFATYYC 92
> 4hs6_D L MRCT10.v362 Fab light chain
Length=218 Score = 31.6 bits (70), Expect = 8.2, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 20/82 (24%) Query 35 LTSLPGDSVTLTCPGVEPEDN---ATVHWVLRKPAAG-------------SHPSRWAGMG 78 L++ GD VT+TC E D + +HW +KP PSR++G G Sbjct 11 LSASVGDRVTITCRASESVDGYGYSFLHWFQQKPGKAPKLLIYLASNLNSGVPSRFSGSG 70 Query 79 R----RLLLRSVQLHDSGNYSC 96 L + S+Q D Y C Sbjct 71 SGTDFTLTISSLQPEDFATYYC 92
> 6ewb_K K Fab light chain
Length=214 Score = 31.6 bits (70), Expect = 8.2, Method: Compositional matrix adjust. Identities = 21/82 (26%), Positives = 37/82 (45%), Gaps = 23/82 (28%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR----- 80 ++++ PG+ VT+TC D +HW +K +G+ P RW +G+ R Sbjct 11 IMSASPGEKVTMTCSASSSVD--YMHWYQQK--SGTSPKRWIYDTYKLASGVPARFSGSG 66 Query 81 ------LLLRSVQLHDSGNYSC 96 L + S++ D+ Y C Sbjct 67 SGTSYSLTINSMEAEDAATYYC 88
> 4xp9_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN
Length=213 Score = 31.6 bits (70), Expect = 8.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 1psk_A L ANTIBODY
Length=213 Score = 31.6 bits (70), Expect = 8.3, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 23/42 (55%), Gaps = 4/42 (10%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW 74 ++++ PG+ VT+TC N +HW +KP G+ P W Sbjct 9 AIMSASPGEKVTITCSASSSVSN--IHWFQQKP--GTFPKLW 46
> 4xpt_B L antibody fragment light chain
Length=214 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 4xnx_B L antibody fragment light chain
Length=214 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 4xp1_B L Antibody fragment light chain
Length=214 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 4xnu_B L antibody fragment light chain
Length=214 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 4xpb_B L Antibody fragment heavy chain-protein, 9D5-heavy chain
Length=214 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 5w1k_S S CR1-28 Fab light chain
Length=206 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 31/125 (25%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR- 79 L++ GD VT+TC + DN + W +KP PSR++G G Sbjct 9 TLSASVGDRVTITCRASQSIDNW-LAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSG 67 Query 80 ---RLLLRSVQLHDSGNYSCYRAGRPAGT-VHLLVDV--------PPEEPQLSCFRKSPL 127 L + S+Q D Y C GT V + V PP + QL KS Sbjct 68 TEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQL----KSGT 123 Query 128 SNVVC 132 ++VVC Sbjct 124 ASVVC 128
> 5w1k_K K CR1-28 Fab light chain
Length=206 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 31/125 (25%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR- 79 L++ GD VT+TC + DN + W +KP PSR++G G Sbjct 9 TLSASVGDRVTITCRASQSIDNW-LAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSG 67 Query 80 ---RLLLRSVQLHDSGNYSCYRAGRPAGT-VHLLVDV--------PPEEPQLSCFRKSPL 127 L + S+Q D Y C GT V + V PP + QL KS Sbjct 68 TEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQL----KSGT 123 Query 128 SNVVC 132 ++VVC Sbjct 124 ASVVC 128
> 5w1k_A A CR1-28 Fab light chain
Length=206 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 31/125 (25%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR- 79 L++ GD VT+TC + DN + W +KP PSR++G G Sbjct 9 TLSASVGDRVTITCRASQSIDNW-LAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSG 67 Query 80 ---RLLLRSVQLHDSGNYSCYRAGRPAGT-VHLLVDV--------PPEEPQLSCFRKSPL 127 L + S+Q D Y C GT V + V PP + QL KS Sbjct 68 TEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQL----KSGT 123 Query 128 SNVVC 132 ++VVC Sbjct 124 ASVVC 128
> 5w1k_F F CR1-28 Fab light chain
Length=206 Score = 31.6 bits (70), Expect = 8.5, Method: Compositional matrix adjust. Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 31/125 (25%) Query 34 VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG-------------SHPSRWAGMGR- 79 L++ GD VT+TC + DN + W +KP PSR++G G Sbjct 9 TLSASVGDRVTITCRASQSIDNW-LAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSG 67 Query 80 ---RLLLRSVQLHDSGNYSCYRAGRPAGT-VHLLVDV--------PPEEPQLSCFRKSPL 127 L + S+Q D Y C GT V + V PP + QL KS Sbjct 68 TEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQL----KSGT 123 Query 128 SNVVC 132 ++VVC Sbjct 124 ASVVC 128
> 5l9d_B L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN
Length=215 Score = 31.6 bits (70), Expect = 8.6, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC + HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTANSSVSSNYFHWYQQKP--GSSPKLWIYSTSNLASGVPTRFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L L S++ D+ Y C++ R Sbjct 67 GSGTSYSLTLSSMEAEDAATYYCHQYHR 94
> 5vta_E L Fab light chain
Length=213 Score = 31.6 bits (70), Expect = 8.6, Method: Compositional matrix adjust. Identities = 36/133 (27%), Positives = 54/133 (41%), Gaps = 41/133 (31%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +L++ PG+ VT+TC N +HW +KP GS P W +G+ R Sbjct 9 AILSASPGEKVTMTCRASSSVCN--MHWYQQKP--GSSPKPWLHGTSNLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVD----------VPPEEPQL 119 L + V+ D+ Y C + + P G L +D PP + QL Sbjct 65 GSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRTVAAPSVFIFPPSDEQL 124 Query 120 SCFRKSPLSNVVC 132 KS ++VVC Sbjct 125 ----KSGTASVVC 133
> 6ca7_A L PCT64_13C light chain
Length=214 Score = 31.6 bits (70), Expect = 8.7, Method: Compositional matrix adjust. Identities = 33/130 (25%), Positives = 50/130 (38%), Gaps = 34/130 (26%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR 79 G L+ PG+ TL+C + N + W +KP A P R++G G Sbjct 9 GTLSLSPGERATLSCRASQSVSNNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGS 68 Query 80 ----RLLLRSVQLHDSGNYSCYRAGR-----PAGTVHLLVDV--------PPEEPQLSCF 122 L + ++ D Y C ++ R P V + V PP + QL Sbjct 69 GTDFTLTISRLEPEDFAVYYCQQSARSFTFGPGTKVDIKRTVAAPSVFIFPPSDEQL--- 125 Query 123 RKSPLSNVVC 132 KS ++VVC Sbjct 126 -KSGTASVVC 134
> 5l88_B L Anti-afamin antibody N14, Fab fragment, light chain
Length=215 Score = 31.6 bits (70), Expect = 8.8, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC + HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTANSSVSSNYFHWYQQKP--GSSPKLWIYSTSNLASGVPTRFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L L S++ D+ Y C++ R Sbjct 67 GSGTSYSLTLSSMEAEDAATYYCHQYHR 94
> 1f6f_C C PROLACTIN RECEPTOR
Length=210 Score = 31.6 bits (70), Expect = 9.0, Method: Compositional matrix adjust. Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 7/102 (7%) Query 213 ILQPDPPANIT--VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV 270 I++P+PP N+T V +L V W P E R + W + Sbjct 100 IVEPEPPRNLTLEVKXXXXXKTYLWVKWSPPXXXXXXXXXXTMEYEIRL-KXXXXXEWEI 158 Query 271 KDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA 310 H + D + G +++VQ R + + G WS WS E+ Sbjct 159 HFTGHQTQFKVFDLYPGQKYLVQTRCKPD--HGYWSRWSQES 198
> 5lgh_B L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN
Length=215 Score = 31.6 bits (70), Expect = 9.0, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC + HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTANSSVSSNYFHWYQQKP--GSSPKLWIYSTSNLASGVPTRFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L L S++ D+ Y C++ R Sbjct 67 GSGTSYSLTLSSMEAEDAATYYCHQYHR 94
> 5l7x_B L Mouse Antibody Fab Fragment, IgG1-kappa Light Chain
Length=215 Score = 31.6 bits (70), Expect = 9.0, Method: Compositional matrix adjust. Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 21/88 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ G+ VT+TC + HW +KP GS P W +G+ R Sbjct 9 AIMSASLGERVTMTCTANSSVSSNYFHWYQQKP--GSSPKLWIYSTSNLASGVPTRFSGS 66 Query 81 -------LLLRSVQLHDSGNYSCYRAGR 101 L L S++ D+ Y C++ R Sbjct 67 GSGTSYSLTLSSMEAEDAATYYCHQYHR 94
> 4xp5_B L Antibody fragment heavy chain-protein, 9D5-heavy chain
Length=213 Score = 31.6 bits (70), Expect = 9.0, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 4xp6_B L Antibody fragment heavy chain-protein, 9D5-heavy chain
Length=213 Score = 31.6 bits (70), Expect = 9.0, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 9 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 66 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 67 GSGTSYSLTISSVEAEDAATYYC 89
> 6ch9_F R BG18 Light Chain
Length=215 Score = 31.6 bits (70), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPA-----------------AGSHPSRWAGMGRRL 81 PG + +TC G P + +W +KP G + W+G L Sbjct 16 PGQTARITCSGA-PLTSRFTYWYRQKPGQAPVLIISRSSQXXXXXXGRFSASWSGTTVTL 74 Query 82 LLRSVQLHDSGNYSC 96 +R VQ D +Y C Sbjct 75 TIRGVQADDEADYYC 89
> 6chb_R R BG18 Light Chain
Length=215 Score = 31.6 bits (70), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPA-----------------AGSHPSRWAGMGRRL 81 PG + +TC G P + +W +KP G + W+G L Sbjct 16 PGQTARITCSGA-PLTSRFTYWYRQKPGQAPVLIISRSSQXXXXXXGRFSASWSGTTVTL 74 Query 82 LLRSVQLHDSGNYSC 96 +R VQ D +Y C Sbjct 75 TIRGVQADDEADYYC 89
> 6chb_L L BG18 Light Chain
Length=215 Score = 31.6 bits (70), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPA-----------------AGSHPSRWAGMGRRL 81 PG + +TC G P + +W +KP G + W+G L Sbjct 16 PGQTARITCSGA-PLTSRFTYWYRQKPGQAPVLIISRSSQXXXXXXGRFSASWSGTTVTL 74 Query 82 LLRSVQLHDSGNYSC 96 +R VQ D +Y C Sbjct 75 TIRGVQADDEADYYC 89
> 6chb_D K BG18 Light Chain
Length=215 Score = 31.6 bits (70), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPA-----------------AGSHPSRWAGMGRRL 81 PG + +TC G P + +W +KP G + W+G L Sbjct 16 PGQTARITCSGA-PLTSRFTYWYRQKPGQAPVLIISRSSQXXXXXXGRFSASWSGTTVTL 74 Query 82 LLRSVQLHDSGNYSC 96 +R VQ D +Y C Sbjct 75 TIRGVQADDEADYYC 89
> 5ud9_B L Light chain
Length=215 Score = 31.6 bits (70), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query 39 PGDSVTLTCPGVEPEDNATVHWVLRKPA-----------------AGSHPSRWAGMGRRL 81 PG + +TC G P + +W +KP G + W+G L Sbjct 16 PGQTARITCSGA-PLTSRFTYWYRQKPGQAPVLIISRSSQXXXXXXGRFSASWSGTTVTL 74 Query 82 LLRSVQLHDSGNYSC 96 +R VQ D +Y C Sbjct 75 TIRGVQADDEADYYC 89
> 4xpf_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN
Length=237 Score = 31.6 bits (70), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 31 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 88 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 89 GSGTSYSLTISSVEAEDAATYYC 111
> 4xp4_B L ANTIBODY FRAGMENT HEAVY CHAIN-PROTEIN, 9D5-HEAVY CHAIN
Length=237 Score = 31.6 bits (70), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 31 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 88 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 89 GSGTSYSLTISSVEAEDAATYYC 111
> 4m48_B L 9D5 antibody, light chain
Length=237 Score = 31.6 bits (70), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 31 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 88 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 89 GSGTSYSLTISSVEAEDAATYYC 111
> 4xpg_B L antibody fragment light chain
Length=237 Score = 31.6 bits (70), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 31 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 88 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 89 GSGTSYSLTISSVEAEDAATYYC 111
> 4xpa_B L Antibody fragment heavy chain-protein, 9D5-heavy chain
Length=237 Score = 31.6 bits (70), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/83 (24%), Positives = 37/83 (45%), Gaps = 21/83 (25%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 ++++ PG+ VT+TC ++ +HW +K +G+ P W +G+ R Sbjct 31 AIMSTSPGEKVTMTCRASSSVGSSYLHWYQQK--SGASPKLWIYSTSNLASGVPARFSGS 88 Query 81 -------LLLRSVQLHDSGNYSC 96 L + SV+ D+ Y C Sbjct 89 GSGTSYSLTISSVEAEDAATYYC 111
> 5vta_F E Fab light chain
Length=213 Score = 31.6 bits (70), Expect = 9.3, Method: Compositional matrix adjust. Identities = 36/133 (27%), Positives = 54/133 (41%), Gaps = 41/133 (31%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +L++ PG+ VT+TC N +HW +KP GS P W +G+ R Sbjct 9 AILSASPGEKVTMTCRASSSVCN--MHWYQQKP--GSSPKPWLHGTSNLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVD----------VPPEEPQL 119 L + V+ D+ Y C + + P G L +D PP + QL Sbjct 65 GSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRTVAAPSVFIFPPSDEQL 124 Query 120 SCFRKSPLSNVVC 132 KS ++VVC Sbjct 125 ----KSGTASVVC 133
> 4ffw_C C Fab light chain
Length=210 Score = 31.6 bits (70), Expect = 9.8, Method: Compositional matrix adjust. Identities = 29/113 (26%), Positives = 47/113 (42%), Gaps = 27/113 (24%) Query 33 GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--------AGMGRR---- 80 +L++ PG+ VT+TC +N +HW +KP+ S P W +G+ R Sbjct 9 AILSASPGEKVTMTCRASSSVNN--MHWYQQKPS--SSPKPWLHGTSNLASGVPVRFSGS 64 Query 81 -------LLLRSVQLHDSGNYSCYR-AGRP---AGTVHLLVDVPPEEPQLSCF 122 L + V+ D+ Y C + + P G L +D P +S F Sbjct 65 GSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRADAAPTVSIF 117 Lambda K H a alpha 0.317 0.132 0.417 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 29322295800 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40