[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200603.fasta
           524,056 sequences; 140,797,486 total letters



Query= sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1

Length=4405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  6wuu_B B papain-like protease                                        674    0.0   
  6wuu_A A papain-like protease                                        673    0.0   
  6wx4_A D Non-structural protein 3                                    671    0.0   
  6wuu_C C papain-like protease                                        670    0.0   
  6wuu_D D papain-like protease                                        670    0.0   
  6wzu_A A Non-structural protein 3                                    667    0.0   
  6wrh_A A Peptidase C16                                               665    0.0   
  6w9c_A A Papain-like proteinase                                      664    0.0   
  6w9c_C C Papain-like proteinase                                      660    0.0   
  6yb7_A A Replicase polyprotein 1ab                                   652    0.0   
  6y2e_A A Replicase polyprotein 1ab                                   652    0.0   
  6m03_A A SARS-CoV-2 main protease                                    652    0.0   
  6m2n_B B SARS-CoV-2 3CL protease                                     652    0.0   
  6m2n_D D SARS-CoV-2 3CL protease                                     652    0.0   
  6m2n_A A SARS-CoV-2 3CL protease                                     652    0.0   
  6wtj_A A 3C-like proteinase                                          652    0.0   
  6wtk_A A 3C-like proteinase                                          652    0.0   
  6lu7_A A main protease                                               652    0.0   
  6ynq_A A Replicase polyprotein 1ab                                   652    0.0   
  6wtm_B B 3C-like proteinase                                          652    0.0   
  6wtm_A A 3C-like proteinase                                          652    0.0   
  7buy_A A SARS-CoV-2 virus Main protease                              652    0.0   
  6yt8_A A Replicase polyprotein 1ab                                   652    0.0   
  6yvf_A A Replicase polyprotein 1ab                                   652    0.0   
  6wqf_A A 3C-like proteinase                                          652    0.0   
  6wnp_A A 3C-like proteinase                                          652    0.0   
  6w63_A A 3C-like proteinase                                          649    0.0   
  6m2q_A A SARS-CoV-2 3CL protease                                     649    0.0   
  6m2n_C C SARS-CoV-2 3CL protease                                     649    0.0   
  6m0k_A A Replicase polyprotein 1ab                                   647    0.0   
  5rfh_A A 3C-like proteinase                                          647    0.0   
  5rf0_A A 3C-like proteinase                                          647    0.0   
  5rgj_A A 3C-like proteinase                                          647    0.0   
  5rfv_A A 3C-like proteinase                                          647    0.0   
  5rg2_A A 3C-like proteinase                                          647    0.0   
  5rfk_A A 3C-like proteinase                                          647    0.0   
  5re9_A A 3C-like proteinase                                          647    0.0   
  5rgl_A A 3C-like proteinase                                          647    0.0   
  5res_A A 3C-like proteinase                                          647    0.0   
  5rec_A A 3C-like proteinase                                          647    0.0   
  5re5_A A 3C-like proteinase                                          647    0.0   
  5rgs_A A 3C-like proteinase                                          647    0.0   
  5rfy_A A 3C-like proteinase                                          647    0.0   
  5rfw_A A 3C-like proteinase                                          647    0.0   
  5rft_A A 3C-like proteinase                                          647    0.0   
  5reh_A A 3C-like proteinase                                          647    0.0   
  5rf1_A A 3C-like proteinase                                          647    0.0   
  5r80_A A 3C-like proteinase                                          647    0.0   
  5rfd_A A 3C-like proteinase                                          647    0.0   
  5r8t_A A 3C-like proteinase                                          647    0.0   
  5r83_A A 3C-like proteinase                                          647    0.0   
  5r84_A A 3C-like proteinase                                          647    0.0   
  5r7y_A A 3C-like proteinase                                          647    0.0   
  5r7z_A A 3C-like proteinase                                          647    0.0   
  5rfz_A A 3C-like proteinase                                          647    0.0   
  5rfx_A A 3C-like proteinase                                          647    0.0   
  5rfu_A A 3C-like proteinase                                          647    0.0   
  5rfs_A A 3C-like proteinase                                          647    0.0   
  5rfq_A A 3C-like proteinase                                          647    0.0   
  5rfr_A A 3C-like proteinase                                          647    0.0   
  5rfp_A A 3C-like proteinase                                          647    0.0   
  5rfo_A A 3C-like proteinase                                          647    0.0   
  5rfn_A A 3C-like proteinase                                          647    0.0   
  5rfm_A A 3C-like proteinase                                          647    0.0   
  5rfl_A A 3C-like proteinase                                          647    0.0   
  5rfj_A A 3C-like proteinase                                          647    0.0   
  5rfi_A A 3C-like proteinase                                          647    0.0   
  5rfg_A A 3C-like proteinase                                          647    0.0   
  5rff_A A 3C-like proteinase                                          647    0.0   
  5rfe_A A 3C-like proteinase                                          647    0.0   
  5rfc_A A 3C-like proteinase                                          647    0.0   
  5rfb_A A 3C-like proteinase                                          647    0.0   
  5rf8_A A 3C-like proteinase                                          647    0.0   
  5rf9_A A 3C-like proteinase                                          647    0.0   
  5rf7_A A 3C-like proteinase                                          647    0.0   
  5rf5_A A 3C-like proteinase                                          647    0.0   
  5rf6_A A 3C-like proteinase                                          647    0.0   
  5rf4_A A 3C-like proteinase                                          647    0.0   
  5rf3_A A 3C-like proteinase                                          647    0.0   
  5rf2_A A 3C-like proteinase                                          647    0.0   
  5rez_A A 3C-like proteinase                                          647    0.0   
  5rey_A A 3C-like proteinase                                          647    0.0   
  5rew_A A 3C-like proteinase                                          647    0.0   
  5rev_A A 3C-like proteinase                                          647    0.0   
  5rex_A A 3C-like proteinase                                          647    0.0   
  5reu_A A 3C-like proteinase                                          647    0.0   
  5ret_A A 3C-like proteinase                                          647    0.0   
  5rer_A A 3C-like proteinase                                          647    0.0   
  5rep_A A 3C-like proteinase                                          647    0.0   
  5reo_A A 3C-like proteinase                                          647    0.0   
  5rel_A A 3C-like proteinase                                          647    0.0   
  5rem_A A 3C-like proteinase                                          647    0.0   
  5ren_A A 3C-like proteinase                                          647    0.0   
  5rek_A A 3C-like proteinase                                          647    0.0   
  5rei_A A 3C-like proteinase                                          647    0.0   
  5rej_A A 3C-like proteinase                                          647    0.0   
  5reg_A A 3C-like proteinase                                          647    0.0   
  5ree_A A 3C-like proteinase                                          647    0.0   
  5ref_A A 3C-like proteinase                                          647    0.0   
  5red_A A 3C-like proteinase                                          647    0.0   
  5reb_A A 3C-like proteinase                                          647    0.0   
  5rea_A A 3C-like proteinase                                          647    0.0   
  5re8_A A 3C-like proteinase                                          647    0.0   
  5re4_A A 3C-like proteinase                                          647    0.0   
  5re6_A A 3C-like proteinase                                          647    0.0   
  5rgr_A A 3C-like proteinase                                          647    0.0   
  5rgq_A A 3C-like proteinase                                          647    0.0   
  5rgp_A A 3C-like proteinase                                          647    0.0   
  5rgn_A A 3C-like proteinase                                          647    0.0   
  5rgo_A A 3C-like proteinase                                          647    0.0   
  5rgk_A A 3C-like proteinase                                          647    0.0   
  5rgi_A A 3C-like proteinase                                          647    0.0   
  5rgh_A A 3C-like proteinase                                          647    0.0   
  5rgg_A A 3C-like proteinase                                          647    0.0   
  5rg3_A A 3C-like proteinase                                          647    0.0   
  5rg1_A A 3C-like proteinase                                          647    0.0   
  5rgy_A A 3C-like proteinase                                          647    0.0   
  5rgv_A A 3C-like proteinase                                          647    0.0   
  5rgz_A A 3C-like proteinase                                          647    0.0   
  5rgu_A A 3C-like proteinase                                          647    0.0   
  5rgw_A A 3C-like proteinase                                          647    0.0   
  5rgx_A A 3C-like proteinase                                          647    0.0   
  5rgt_A A 3C-like proteinase                                          647    0.0   
  5rha_A A 3C-like proteinase                                          647    0.0   
  5rh9_A A 3C-like proteinase                                          647    0.0   
  5rh8_A A 3C-like proteinase                                          647    0.0   
  5rh7_A A 3C-like proteinase                                          647    0.0   
  5rh6_A A 3C-like proteinase                                          647    0.0   
  5rh3_A A 3C-like proteinase                                          647    0.0   
  5rh5_A A 3C-like proteinase                                          647    0.0   
  5rh4_A A 3C-like proteinase                                          647    0.0   
  5rh2_A A 3C-like proteinase                                          647    0.0   
  5rh0_A A 3C-like proteinase                                          647    0.0   
  5rh1_A A 3C-like proteinase                                          647    0.0   
  5re7_A A 3C-like proteinase                                          647    0.0   
  6yz6_A A Main Protease                                               647    0.0   
  5rgm_A A 3C-like proteinase                                          647    0.0   
  6y84_A A Replicase polyprotein 1ab                                   647    0.0   
  5r81_A A 3C-like proteinase                                          647    0.0   
  5r82_A A 3C-like proteinase                                          647    0.0   
  5rg0_A A 3C-like proteinase                                          647    0.0   
  6lze_A A Replicase polyprotein 1ab                                   645    0.0   
  6y2g_B B Replicase polyprotein 1ab                                   645    0.0   
  6w9c_B B Papain-like proteinase                                      645    0.0   
  6y2f_A A Replicase polyprotein 1ab                                   644    0.0   
  6wtt_B B 3C-like proteinase                                          644    0.0   
  6wtt_A A 3C-like proteinase                                          644    0.0   
  6wtt_C C 3C-like proteinase                                          644    0.0   
  7brr_A A 3C-like proteinase                                          643    0.0   
  5rfa_A A 3C-like proteinase                                          642    0.0   
  6y2g_A A Replicase polyprotein 1ab                                   642    0.0   
  7bqy_A A main protease                                               642    0.0   
  7brp_B A 3C-like proteinase                                          642    0.0   
  7brp_A B 3C-like proteinase                                          642    0.0   
  7bro_A A 3C-like proteinase                                          640    0.0   
  7brr_B B 3C-like proteinase                                          637    0.0   
  2zu5_A A 3C-like proteinase                                          634    0.0   
  2duc_A A Replicase polyprotein 1ab                                   634    0.0   
  3sne_A A 3C-like proteinase                                          634    0.0   
  2gz9_A A Replicase polyprotein 1ab                                   634    0.0   
  3snb_A A 3C-like proteinase                                          634    0.0   
  2gx4_A A 3C-like proteinase                                          634    0.0   
  6y7m_A AAA Replicase polyprotein 1a                                  634    0.0   
  3sn8_A A 3C-like proteinase                                          634    0.0   
  2z3d_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  3szn_A A 3C-like proteinase                                          634    0.0   
  6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like ...   634    0.0   
  2z3c_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  6lo0_A A Replicase polyprotein 1a                                    634    0.0   
  6lny_A A Replicase polyprotein 1a                                    634    0.0   
  3v3m_A A 3C-like proteinase                                          634    0.0   
  2z9k_B B 3C-like proteinase                                          634    0.0   
  2duc_B B Replicase polyprotein 1ab                                   634    0.0   
  5n5o_A A Replicase polyprotein 1ab                                   634    0.0   
  2z94_A A Replicase polyprotein 1ab                                   634    0.0   
  3tit_A A SARS coronavirus main protease                              634    0.0   
  3snd_B B 3C-like proteinase                                          634    0.0   
  3vb6_B B 3C-like proteinase                                          634    0.0   
  2a5a_A A 3C-like peptidase                                           634    0.0   
  2hob_A A Replicase polyprotein 1ab                                   634    0.0   
  2z3e_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  3tns_A A SARS coronavirus main protease                              634    0.0   
  3vb4_B B 3C-like proteinase                                          634    0.0   
  3tiu_A A SARS coronavirus main protease                              634    0.0   
  2gz7_A A Replicase polyprotein 1ab                                   634    0.0   
  2v6n_A A REPLICASE POLYPROTEIN 1AB                                   634    0.0   
  3vb3_B B 3C-like proteinase                                          634    0.0   
  2gz8_A A Replicase polyprotein 1ab                                   634    0.0   
  3snc_A A 3C-like proteinase                                          634    0.0   
  5n19_A A SARS coronavirus main protease                              634    0.0   
  3tnt_A A SARS coronavirus main protease                              634    0.0   
  3snd_A A 3C-like proteinase                                          634    0.0   
  2a5i_A A 3C-like peptidase                                           634    0.0   
  3vb7_B B 3C-like proteinase                                          634    0.0   
  3vb5_B B 3C-like proteinase                                          634    0.0   
  2z9g_A A 3C-like proteinase                                          634    0.0   
  2zu4_A A 3C-like proteinase                                          634    0.0   
  2h2z_A A Replicase polyprotein 1ab                                   634    0.0   
  3ea8_A A 3C-like proteinase                                          633    0.0   
  3m3v_A A 3C-like proteinase                                          633    0.0   
  5b6o_A A 3C-like proteinase                                          632    0.0   
  2z9k_A A 3C-like proteinase                                          632    0.0   
  3ea7_A A 3C-like proteinase                                          632    0.0   
  3e91_A A 3C-like proteinase                                          632    0.0   
  2qcy_A A 3C-like proteinase                                          631    0.0   
  2amd_A A 3C-like proteinase                                          631    0.0   
  1wof_A A 3C-like proteinase                                          631    0.0   
  3m3s_A A 3C-like proteinase                                          631    0.0   
  1z1j_B B 3C-like proteinase                                          631    0.0   
  1z1j_A A 3C-like proteinase                                          631    0.0   
  4twy_A A 3C-like proteinase                                          630    0.0   
  5c5n_A A 3C-like proteinase                                          630    0.0   
  3aw0_A A 3C-Like Proteinase                                          630    0.0   
  4tww_B B 3C-like proteinase                                          630    0.0   
  4tww_A A 3C-like proteinase                                          630    0.0   
  4wy3_A A 3C-like proteinase                                          630    0.0   
  2z9j_B B 3C-like proteinase                                          629    0.0   
  2a5k_A A 3C-like peptidase                                           629    0.0   
  2qc2_B B 3C-like proteinase                                          629    0.0   
  3m3t_A A 3C-like proteinase                                          629    0.0   
  2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)    629    0.0   
  3m3v_B B 3C-like proteinase                                          628    0.0   
  2qc2_A A 3C-like proteinase                                          627    0.0   
  2amq_A A 3C-like proteinase                                          627    0.0   
  2amd_B B 3C-like proteinase                                          626    0.0   
  1wof_B B 3C-like proteinase                                          626    0.0   
  4mds_A A 3C-like proteinase                                          626    0.0   
  2alv_A A Replicase polyprotein 1ab                                   625    0.0   
  1uk2_A A 3C-LIKE PROTEINASE                                          625    0.0   
  1uj1_B B 3C-like proteinase                                          625    0.0   
  2gt7_B B 3C-like proteinase                                          625    0.0   
  1uk4_B B 3C-like proteinase                                          625    0.0   
  1uk3_B B 3C-like proteinase                                          625    0.0   
  2z9j_A A 3C-like proteinase                                          625    0.0   
  1uk2_B B 3C-LIKE PROTEINASE                                          625    0.0   
  2c3s_A A SARS COV 3C-LIKE PROTEINASE                                 625    0.0   
  2amq_B B 3C-like proteinase                                          625    0.0   
  2d2d_B B 3C-like proteinase                                          625    0.0   
  2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   624    0.0   
  3sna_A A 3C-like proteinase                                          624    0.0   
  3vb7_A A 3C-like proteinase                                          624    0.0   
  3vb6_A A 3C-like proteinase                                          624    0.0   
  2z9l_B B 3C-like proteinase                                          624    0.0   
  3vb4_A A 3C-like proteinase                                          624    0.0   
  3iwm_A A 3C-like proteinase                                          624    0.0   
  3vb3_A A 3C-like proteinase                                          624    0.0   
  3iwm_B B 3C-like proteinase                                          624    0.0   
  1z1i_A A 3C-like proteinase                                          624    0.0   
  3vb5_A A 3C-like proteinase                                          624    0.0   
  1uk3_A A 3C-like proteinase                                          624    0.0   
  1uk4_A A 3C-like proteinase                                          624    0.0   
  1uj1_A A 3C-like proteinase                                          624    0.0   
  2d2d_A A 3C-like proteinase                                          624    0.0   
  3ea7_B B 3C-like proteinase                                          623    0.0   
  3m3s_B B 3C-like proteinase                                          623    0.0   
  3eaj_A A 3C-like proteinase                                          623    0.0   
  3eaj_B B 3C-like proteinase                                          623    0.0   
  2qiq_A A Replicase polyprotein 1ab                                   622    0.0   
  2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)    622    0.0   
  2bx3_A A MAIN PROTEINASE                                             622    0.0   
  3iwm_D D 3C-like proteinase                                          622    0.0   
  3iwm_C C 3C-like proteinase                                          622    0.0   
  2a5k_B B 3C-like peptidase                                           622    0.0   
  2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE                            622    0.0   
  2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE                            622    0.0   
  3e91_B B 3C-like proteinase                                          621    0.0   
  4hi3_B B 3C-like proteinase                                          621    0.0   
  3ea9_A A 3C-like proteinase                                          621    0.0   
  2z9l_A A 3C-like proteinase                                          621    0.0   
  2gt7_A A 3C-like proteinase                                          621    0.0   
  3aw1_A A 3C-Like Proteinase                                          620    0.0   
  5b6o_B B 3C-like proteinase                                          621    0.0   
  2gtb_A A 3C-like proteinase                                          620    0.0   
  2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   620    0.0   
  3d62_A A 3C-like proteinase                                          619    0.0   
  3f9h_B B 3C-like proteinase                                          619    0.0   
  4hi3_A A 3C-like proteinase                                          619    0.0   
  3avz_A A 3C-Like Proteinase                                          619    0.0   
  5c5o_A A 3C-like proteinase                                          619    0.0   
  3aw1_B B 3C-Like Proteinase                                          619    0.0   
  3atw_A A 3C-Like Proteinase                                          619    0.0   
  3atw_B B 3C-Like Proteinase                                          619    0.0   
  5c5o_B B 3C-like proteinase                                          619    0.0   
  2bx4_A A 3C-LIKE PROTEINASE                                          618    0.0   
  2gt8_A A 3C-like proteinase                                          618    0.0   
  3f9f_B B 3C-like proteinase                                          617    0.0   
  3f9f_A A 3C-like proteinase                                          617    0.0   
  3f9h_A A 3C-like proteinase                                          617    0.0   
  3f9e_A A 3C-like proteinase                                          614    0.0   
  3f9g_A A 3C-like proteinase                                          612    0.0   
  1q2w_A A 3C-like protease                                            611    0.0   
  1q2w_B B 3C-like protease                                            610    0.0   
  3fzd_A A 3C-like proteinase                                          610    0.0   
  3f9g_B B 3C-like proteinase                                          607    0.0   
  2pwx_A A 3C-like proteinase                                          592    0.0   
  5tl6_A B Replicase polyprotein 1ab                                   562    7e-180
  4mm3_B B Papain-like proteinase                                      562    8e-180
  5tl7_B B Replicase polyprotein 1ab                                   562    8e-180
  4m0w_A A Replicase polyprotein 1a                                    562    9e-180
  5e6j_A A Replicase polyprotein 1ab                                   561    2e-179
  5y3e_A A Replicase polyprotein 1a                                    561    2e-179
  5y3q_A A Replicase polyprotein 1a                                    561    2e-179
  2fe8_A A Replicase polyprotein 1ab                                   560    3e-179
  5tl7_D D Replicase polyprotein 1ab                                   558    1e-178
  2fe8_B B Replicase polyprotein 1ab                                   558    2e-178
  5e6j_D D Replicase polyprotein 1ab                                   558    2e-178
  5tl6_B D Replicase polyprotein 1ab                                   557    3e-178
  3e9s_A A Non-structural protein 3                                    557    3e-178
  2fe8_C C Replicase polyprotein 1ab                                   556    5e-178
  3mj5_A A Replicase polyprotein 1a                                    556    5e-178
  4ow0_A A papain-like protease                                        553    1e-176
  6yva_A A Replicase polyprotein 1a                                    553    1e-176
  4ovz_A A Papain-like proteinase                                      538    2e-171
  3mj5_B B Replicase polyprotein 1a                                    460    3e-144
  4ow0_B B papain-like protease                                        452    1e-141
  4ovz_B B Papain-like proteinase                                      438    2e-136
  2wct_B B NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2wct_A A NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2w2g_A A NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2w2g_B B NON-STRUCTURAL PROTEIN 3                                    402    5e-125
  2wct_C C NON-STRUCTURAL PROTEIN 3                                    401    2e-124
  2wct_D D NON-STRUCTURAL PROTEIN 3                                    392    2e-121
  2ahm_H H Replicase polyprotein 1ab, heavy chain                      384    2e-119
  6yyt_D D nsp8                                                        383    4e-119
  6yyt_B B nsp8                                                        383    4e-119
  2ahm_G G Replicase polyprotein 1ab, heavy chain                      382    4e-119
  6wey_A A Non-structural protein 3                                    350    3e-108
  6ywm_A A NSP3 macrodomain                                            349    9e-108
  6woj_B B Non-structural protein 3                                    349    1e-107
  6woj_D D Non-structural protein 3                                    349    1e-107
  6ywl_C C NSP3 macrodomain                                            348    1e-107
  6ywk_C C NSP3 macrodomain                                            348    1e-107
  6woj_C C Non-structural protein 3                                    347    5e-107
  6woj_A A Non-structural protein 3                                    347    5e-107
  6ywl_B B NSP3 macrodomain                                            347    5e-107
  6ywl_A A NSP3 macrodomain                                            347    5e-107
  6ywk_E E NSP3 macrodomain                                            347    5e-107
  6ywk_D D NSP3 macrodomain                                            347    5e-107
  6ywk_A A NSP3 macrodomain                                            347    5e-107
  6ywk_B B NSP3 macrodomain                                            347    5e-107
  6ywl_E E NSP3 macrodomain                                            347    5e-107
  6ywm_B B NSP3 macrodomain                                            344    3e-106
  6w6y_A A SARS-CoV-2 NSP3                                             344    3e-106
  6wen_A A Non-structural protein 3                                    344    3e-106
  6ywl_D D NSP3 macrodomain                                            344    4e-106
  6w6y_B B SARS-CoV-2 NSP3                                             342    2e-105
  6vxs_B B Non-structural protein 3                                    342    2e-105
  6vxs_A A Non-structural protein 3                                    342    2e-105
  6w02_B B Non-structural protein 3                                    342    2e-105
  6ywm_C C NSP3 macrodomain                                            342    2e-105
  6wcf_A A Non-structural protein 3                                    341    6e-105
  6w02_A A Non-structural protein 3                                    339    2e-104
  4rsp_A A Orf1a protein                                               324    3e-97 
  4ylu_A A ORF1a protein                                               323    8e-97 
  4ylu_D D ORF1a protein                                               323    8e-97 
  5wkj_A A Orf1a protein                                               322    2e-96 
  5wkl_A A Orf1a protein                                               322    2e-96 
  4wme_D D MERS-CoV 3CL protease                                       322    2e-96 
  4wme_A A MERS-CoV 3CL protease                                       322    2e-96 
  5wkk_A A Orf1a protein                                               322    3e-96 
  4ylu_B B ORF1a protein                                               321    3e-96 
  4ylu_C C ORF1a protein                                               321    3e-96 
  5wkm_A A Orf1a protein                                               321    5e-96 
  5c3n_A A ORF1a protein                                               320    6e-96 
  5c3n_B B ORF1a protein                                               320    8e-96 
  4wme_B B MERS-CoV 3CL protease                                       320    1e-95 
  4wmd_B B ORF1a                                                       320    1e-95 
  4wmf_B B MERS-CoV 3CL protease                                       320    1e-95 
  4wmd_C C ORF1a                                                       320    1e-95 
  4wme_C C MERS-CoV 3CL protease                                       318    4e-95 
  4wmd_A A ORF1a                                                       317    8e-95 
  4wmf_A A MERS-CoV 3CL protease                                       317    1e-94 
  2ahm_E E Replicase polyprotein 1ab, heavy chain                      312    2e-94 
  4yog_B B 3C-like proteinase                                          313    3e-93 
  4yog_A A 3C-like proteinase                                          313    3e-93 
  4yoj_B B 3C-like proteinase                                          313    3e-93 
  4yoj_A A 3C-like proteinase                                          313    3e-93 
  4yo9_A A 3C-like proteinase                                          313    3e-93 
  2ynb_A A 3C-LIKE PROTEINASE                                          313    3e-93 
  4yoi_A A 3C-like proteinase                                          313    3e-93 
  2yna_A A 3C-LIKE PROTEINASE                                          313    3e-93 
  4yoi_B B 3C-like proteinase                                          313    3e-93 
  2ynb_B B 3C-LIKE PROTEINASE                                          309    6e-92 
  2yna_B B 3C-LIKE PROTEINASE                                          309    6e-92 
  4yo9_B B 3C-like proteinase                                          308    1e-91 
  4wmf_C C MERS-CoV 3CL protease                                       306    4e-91 
  3d23_A B 3C-like proteinase                                          303    7e-90 
  6jij_B C Replicative polyprotein 1ab                                 302    1e-89 
  3d23_D D 3C-like proteinase                                          301    2e-89 
  6jij_A B Replicative polyprotein 1ab                                 301    4e-89 
  6jij_C A Replicative polyprotein 1ab                                 301    4e-89 
  3d23_B A 3C-like proteinase                                          300    6e-89 
  3d23_C C 3C-like proteinase                                          300    8e-89 
  2ahm_F F Replicase polyprotein 1ab, heavy chain                      290    5e-87 
  7c2k_D D Non-structural protein 8                                    286    2e-85 
  5nfy_E M Polyprotein 1ab                                             281    1e-84 
  5nfy_F N Polyprotein 1ab                                             281    1e-84 
  5nfy_H P Polyprotein 1ab                                             281    1e-84 
  5nfy_G O Polyprotein 1ab                                             281    1e-84 
  5c8u_C C Non-structural protein 10                                   281    2e-84 
  5c8t_A A Non-structural protein 10                                   281    2e-84 
  5c8s_C C Non-structural protein 10                                   281    2e-84 
  5c8u_A A Non-structural protein 10                                   281    2e-84 
  5c8s_A A Non-structural protein 10                                   281    2e-84 
  5c8t_C C Non-structural protein 10                                   281    2e-84 
  6wvn_B B Non-structural protein 10                                   268    5e-80 
  6w75_B B SARS-CoV-2 NSP10                                            268    5e-80 
  6wkq_B B SARS-CoV-2 NSP10                                            268    5e-80 
  6wjt_B B Non-structural protein 10                                   268    5e-80 
  2fyg_A A Replicase polyprotein 1ab                                   265    4e-79 
  2acf_D D Replicase polyprotein 1ab                                   265    2e-78 
  2xyq_B B NON-STRUCTURAL PROTEIN 10                                   262    2e-78 
  2acf_A A Replicase polyprotein 1ab                                   264    5e-78 
  5hyo_A A PEDV 3CLpro                                                 267    1e-77 
  5hyo_B B PEDV 3CLpro                                                 267    1e-77 
  5gwz_B A PEDV main protease                                          266    3e-77 
  5gwz_A B PEDV main protease                                          266    3e-77 
  7btf_C B NSP8                                                        262    4e-77 
  6l70_B B PEDV main protease                                          266    4e-77 
  6l70_A A PEDV main protease                                          266    4e-77 
  2acf_B B Replicase polyprotein 1ab                                   261    6e-77 
  2acf_C C Replicase polyprotein 1ab                                   261    6e-77 
  6wq3_B B Non-structural protein 10                                   259    7e-77 
  4xfq_A A PEDV main protease                                          265    1e-76 
  2fav_C C Replicase polyprotein 1ab (pp1ab) (ORF1AB)                  260    1e-76 
  2fav_B B Replicase polyprotein 1ab (pp1ab) (ORF1AB)                  260    1e-76 
  2fav_A A Replicase polyprotein 1ab (pp1ab) (ORF1AB)                  260    1e-76 
  3r24_B B Non-structural protein 10 and Non-structural protein 11     258    2e-76 
  4xfq_B B PEDV main protease                                          263    5e-76 
  6wrz_B B Non-structural protein 10                                   256    5e-76 
  2ga6_F F orf1a polyprotein                                           256    9e-76 
  4zuh_A A PEDV 3C-Like protease                                       262    1e-75 
  6wkq_D D SARS-CoV-2 NSP10                                            254    4e-75 
  6w4h_B B SARS-CoV-2 NSP10                                            254    4e-75 
  7c2i_B B Replicase polyprotein 1ab                                   254    5e-75 
  4zuh_B B PEDV 3C-Like protease                                       259    7e-75 
  5zqg_B B Non-structural protein                                      259    8e-75 
  2ga6_N N orf1a polyprotein                                           253    9e-75 
  2ga6_B B orf1a polyprotein                                           253    9e-75 
  2g9t_B B orf1a polyprotein                                           253    9e-75 
  6w61_B B Non-structural protein 10                                   252    2e-74 
  5zqg_A A Non-structural protein                                      259    2e-74 
  7c2j_B B Replicase polyprotein 1ab                                   252    2e-74 
  6w75_D D SARS-CoV-2 NSP10                                            252    2e-74 
  6wjt_D D Non-structural protein 10                                   252    2e-74 
  6wqd_B B SARS-CoV-2 NSP8                                             249    6e-74 
  2ga6_J J orf1a polyprotein                                           251    7e-74 
  2ga6_Q Q orf1a polyprotein                                           251    7e-74 
  2ga6_V V orf1a polyprotein                                           251    7e-74 
  2ga6_M M orf1a polyprotein                                           251    7e-74 
  2ga6_U U orf1a polyprotein                                           251    7e-74 
  2ga6_I I orf1a polyprotein                                           251    7e-74 
  2ga6_E E orf1a polyprotein                                           251    7e-74 
  2ga6_P P orf1a polyprotein                                           251    7e-74 
  2ga6_S S orf1a polyprotein                                           251    7e-74 
  2ga6_O O orf1a polyprotein                                           251    7e-74 
  2ga6_L L orf1a polyprotein                                           251    7e-74 
  2ga6_T T orf1a polyprotein                                           251    7e-74 
  2ga6_A A orf1a polyprotein                                           251    7e-74 
  2ga6_X X orf1a polyprotein                                           251    7e-74 
  2ga6_W W orf1a polyprotein                                           251    7e-74 
  2ga6_C C orf1a polyprotein                                           251    7e-74 
  2ga6_D D orf1a polyprotein                                           251    7e-74 
  2ga6_K K orf1a polyprotein                                           251    7e-74 
  2ga6_H H orf1a polyprotein                                           251    7e-74 
  2g9t_W W orf1a polyprotein                                           251    7e-74 
  2g9t_J J orf1a polyprotein                                           251    7e-74 
  2g9t_O O orf1a polyprotein                                           251    7e-74 
  2g9t_R R orf1a polyprotein                                           251    7e-74 
  2ga6_G G orf1a polyprotein                                           251    7e-74 
  2g9t_Q Q orf1a polyprotein                                           251    7e-74 
  2g9t_E E orf1a polyprotein                                           251    7e-74 
  2g9t_I I orf1a polyprotein                                           251    7e-74 
  2g9t_N N orf1a polyprotein                                           251    7e-74 
  2g9t_M M orf1a polyprotein                                           251    7e-74 
  2g9t_S S orf1a polyprotein                                           251    7e-74 
  2g9t_A A orf1a polyprotein                                           251    7e-74 
  2g9t_T T orf1a polyprotein                                           251    7e-74 
  2g9t_G G orf1a polyprotein                                           251    7e-74 
  2g9t_X X orf1a polyprotein                                           251    7e-74 
  2g9t_K K orf1a polyprotein                                           251    7e-74 
  2g9t_C C orf1a polyprotein                                           251    7e-74 
  2g9t_P P orf1a polyprotein                                           251    7e-74 
  2g9t_H H orf1a polyprotein                                           251    7e-74 
  2g9t_L L orf1a polyprotein                                           251    7e-74 
  2g9t_D D orf1a polyprotein                                           251    7e-74 
  6wks_B BBB Non-structural protein 10                                 249    1e-73 
  4zro_D D 3C-like proteinase                                          256    1e-73 
  4zro_C C 3C-like proteinase                                          256    1e-73 
  4zro_A A 3C-like proteinase                                          256    1e-73 
  4zro_B B 3C-like proteinase                                          256    1e-73 
  4f49_C C 3C-like proteinase                                          256    1e-73 
  4f49_A A 3C-like proteinase                                          256    1e-73 
  5eu8_A A main protease                                               256    1e-73 
  1p9u_B B putative coronavirus nsp2 (3CL-PRO)                         256    1e-73 
  1lvo_D D Replicase, hydrolase domain                                 256    1e-73 
  1lvo_B B Replicase, hydrolase domain                                 256    1e-73 
  1lvo_C C Replicase, hydrolase domain                                 256    1e-73 
  1p9u_C C putative coronavirus nsp2 (3CL-PRO)                         256    1e-73 
  1p9u_D D putative coronavirus nsp2 (3CL-PRO)                         256    1e-73 


> 6wuu_B B papain-like protease
Length=326 Score = 674 bits (1739), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/321 (99%), Positives = 320/321 (99%), Gaps = 0/321 (0%) Query 1562 LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 1621 +REVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL Sbjct 1 MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 60 Query 1622 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 1681 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL Sbjct 61 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 120 Query 1682 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 1741 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL Sbjct 121 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 180 Query 1742 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 1801 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE Sbjct 181 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 240 Query 1802 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 1861 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG Sbjct 241 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 300 Query 1862 PITDVFYKENSYTTTIKPVTY 1882 PITDVFYKENSYTTTIKP+ + Sbjct 301 PITDVFYKENSYTTTIKPLEH 321
> 6wuu_A A papain-like protease
Length=326 Score = 673 bits (1737), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/318 (99%), Positives = 318/318 (100%), Gaps = 0/318 (0%) Query 1562 LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 1621 +REVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL Sbjct 1 MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 60 Query 1622 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 1681 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL Sbjct 61 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 120 Query 1682 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 1741 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL Sbjct 121 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 180 Query 1742 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 1801 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE Sbjct 181 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 240 Query 1802 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 1861 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG Sbjct 241 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 300 Query 1862 PITDVFYKENSYTTTIKP 1879 PITDVFYKENSYTTTIKP Sbjct 301 PITDVFYKENSYTTTIKP 318
> 6wx4_A D Non-structural protein 3
Length=326 Score = 671 bits (1730), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/319 (99%), Positives = 318/319 (99%), Gaps = 0/319 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPVTY 1882 TDVFYKENSYTTTIKP+ + Sbjct 303 TDVFYKENSYTTTIKPLEH 321
> 6wuu_C C papain-like protease
Length=326 Score = 670 bits (1729), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/317 (99%), Positives = 317/317 (100%), Gaps = 0/317 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPV 1880 TDVFYKENSYTTTIKP+ Sbjct 303 TDVFYKENSYTTTIKPL 319
> 6wuu_D D papain-like protease
Length=326 Score = 670 bits (1729), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/317 (99%), Positives = 317/317 (100%), Gaps = 0/317 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPV 1880 TDVFYKENSYTTTIKP+ Sbjct 303 TDVFYKENSYTTTIKPL 319
> 6wzu_A A Non-structural protein 3
Length=318 Score = 667 bits (1722), Expect = 0.0, Method: Compositional matrix adjust. Identities = 315/315 (100%), Positives = 315/315 (100%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 4 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 64 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 124 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 184 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 244 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 303 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 304 TDVFYKENSYTTTIK 318
> 6wrh_A A Peptidase C16
Length=318 Score = 665 bits (1715), Expect = 0.0, Method: Compositional matrix adjust. Identities = 314/315 (99%), Positives = 314/315 (99%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 4 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTL Sbjct 64 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 124 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 184 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 244 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 303 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 304 TDVFYKENSYTTTIK 318
> 6w9c_A A Papain-like proteinase
Length=317 Score = 664 bits (1712), Expect = 0.0, Method: Compositional matrix adjust. Identities = 313/313 (100%), Positives = 313/313 (100%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD Sbjct 3 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 62 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ Sbjct 63 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 122 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK Sbjct 123 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 182 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV Sbjct 183 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 242 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD Sbjct 243 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 302 Query 1866 VFYKENSYTTTIK 1878 VFYKENSYTTTIK Sbjct 303 VFYKENSYTTTIK 315
> 6w9c_C C Papain-like proteinase
Length=317 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/312 (100%), Positives = 312/312 (100%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 4 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 63 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI Sbjct 64 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 123 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 124 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 183 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM Sbjct 184 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 243 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 244 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 303 Query 1867 FYKENSYTTTIK 1878 FYKENSYTTTIK Sbjct 304 FYKENSYTTTIK 315
> 6yb7_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y2e_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m03_A A SARS-CoV-2 main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_B B SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_D D SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_A A SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtj_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtk_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lu7_A A main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6ynq_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_B B 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7buy_A A SARS-CoV-2 virus Main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yt8_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yvf_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wqf_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wnp_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6w63_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6m2q_A A SARS-CoV-2 3CL protease
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6m2n_C C SARS-CoV-2 3CL protease
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6m0k_A A Replicase polyprotein 1ab
Length=304 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgj_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfv_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfk_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgl_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5res_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rec_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgs_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfy_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfw_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rft_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r80_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfd_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r8t_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r83_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r84_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r7y_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r7z_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfz_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfx_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfs_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfq_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfr_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfp_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfn_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfm_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfl_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfj_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfi_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rff_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfe_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfc_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfb_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rez_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rey_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rew_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rev_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rex_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ret_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rer_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rep_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rel_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rem_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ren_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rek_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rei_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rej_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ree_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ref_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5red_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reb_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rea_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgr_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgq_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgp_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgn_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgk_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgi_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgy_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgv_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgz_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgw_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgx_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgt_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rha_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6yz6_A A Main Protease
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgm_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6y84_A A Replicase polyprotein 1ab
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r81_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r82_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6lze_A A Replicase polyprotein 1ab
Length=303 Score = 645 bits (1663), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGV 3566 SGV Sbjct 301 SGV 303
> 6y2g_B B Replicase polyprotein 1ab
Length=306 Score = 645 bits (1663), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGV 3566 SGV Sbjct 301 SGV 303
> 6w9c_B B Papain-like proteinase
Length=317 Score = 645 bits (1664), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/311 (98%), Positives = 306/311 (98%), Gaps = 0/311 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 4 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 63 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI Sbjct 64 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 123 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 124 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 183 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIP QATKYLVQQESPFVM Sbjct 184 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPXXXXXQATKYLVQQESPFVM 243 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 244 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 303 Query 1867 FYKENSYTTTI 1877 FYKENSYTTTI Sbjct 304 FYKENSYTTTI 314
> 6y2f_A A Replicase polyprotein 1ab
Length=306 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/305 (99%), Positives = 303/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTS MLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSXXMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6wtt_B B 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6wtt_A A 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6wtt_C C 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 7brr_A A 3C-like proteinase
Length=307 Score = 643 bits (1659), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302 Query 3565 GV 3566 GV Sbjct 303 GV 304
> 5rfa_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 6y2g_A A Replicase polyprotein 1ab
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7bqy_A A main protease
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7brp_B A 3C-like proteinase
Length=307 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7brp_A B 3C-like proteinase
Length=307 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7bro_A A 3C-like proteinase
Length=307 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 7brr_B B 3C-like proteinase
Length=307 Score = 637 bits (1643), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 124 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 2zu5_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sne_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz9_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snb_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gx4_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y7m_A AAA Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sn8_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3d_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3szn_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like
Protease Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3c_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lo0_A A Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lny_A A Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3v3m_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9k_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_B B Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n5o_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z94_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tit_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb6_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5a_A A 3C-like peptidase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2hob_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3e_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tns_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb4_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tiu_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz7_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2v6n_A A REPLICASE POLYPROTEIN 1AB
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb3_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz8_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snc_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n19_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tnt_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5i_A A 3C-like peptidase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb7_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb5_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9g_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2zu4_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2h2z_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3ea8_A A 3C-like proteinase
Length=306 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3m3v_A A 3C-like proteinase
Length=308 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 303 SGVTFQ 308
> 5b6o_A A 3C-like proteinase
Length=316 Score = 632 bits (1630), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/310 (95%), Positives = 302/310 (97%), Gaps = 0/310 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQSAVK 3573 SGVTFQ K Sbjct 301 SGVTFQGKFK 310
> 2z9k_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3ea7_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3e91_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 2qcy_A A 3C-like proteinase
Length=306 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2amd_A A 3C-like proteinase
Length=311 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SGVTF 3568 SGVTF Sbjct 306 SGVTF 310
> 1wof_A A 3C-like proteinase
Length=311 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SGVTF 3568 SGVTF Sbjct 306 SGVTF 310
> 3m3s_A A 3C-like proteinase
Length=306 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_B B 3C-like proteinase
Length=306 Score = 631 bits (1627), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_A A 3C-like proteinase
Length=306 Score = 631 bits (1627), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4twy_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5c5n_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3aw0_A A 3C-Like Proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_B B 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4wy3_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9j_B B 3C-like proteinase
Length=306 Score = 629 bits (1623), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 2a5k_A A 3C-like peptidase
Length=307 Score = 629 bits (1623), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 SGVT 3567 SGVT Sbjct 302 SGVT 305
> 2qc2_B B 3C-like proteinase
Length=308 Score = 629 bits (1622), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 SGVTF 3568 SGVTF Sbjct 303 SGVTF 307
> 3m3t_A A 3C-like proteinase
Length=308 Score = 629 bits (1622), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 302 Query 3564 SGVTF 3568 SGVTF Sbjct 303 SGVTF 307
> 2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 629 bits (1621), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3m3v_B B 3C-like proteinase
Length=308 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 3564 SGV 3566 SGV Sbjct 303 SGV 305
> 2qc2_A A 3C-like proteinase
Length=308 Score = 627 bits (1618), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/304 (96%), Positives = 299/304 (98%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 SGVT 3567 SGVT Sbjct 303 SGVT 306
> 2amq_A A 3C-like proteinase
Length=311 Score = 627 bits (1618), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 3566 VTF 3568 VTF Sbjct 308 VTF 310
> 2amd_B B 3C-like proteinase
Length=311 Score = 626 bits (1615), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 1wof_B B 3C-like proteinase
Length=311 Score = 626 bits (1615), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 4mds_A A 3C-like proteinase
Length=303 Score = 626 bits (1614), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2alv_A A Replicase polyprotein 1ab
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301 Query 3565 GV 3566 GV Sbjct 302 GV 303
> 1uk2_A A 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uj1_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2gt7_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk4_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk3_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2z9j_A A 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk2_B B 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2c3s_A A SARS COV 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2amq_B B 3C-like proteinase
Length=311 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 2d2d_B B 3C-like proteinase
Length=311 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 624 bits (1609), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3sna_A A 3C-like proteinase
Length=301 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb7_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb6_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2z9l_B B 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb4_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3iwm_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb3_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3iwm_B B 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 1z1i_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb5_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 1uk3_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 1uk4_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 1uj1_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 2d2d_A A 3C-like proteinase
Length=311 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 3566 V 3566 V Sbjct 308 V 308
> 3ea7_B B 3C-like proteinase
Length=306 Score = 623 bits (1607), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3m3s_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 3eaj_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 3eaj_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2qiq_A A Replicase polyprotein 1ab
Length=301 Score = 622 bits (1605), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 +GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 AGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2bx3_A A MAIN PROTEINASE
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 3iwm_D D 3C-like proteinase
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3iwm_C C 3C-like proteinase
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2a5k_B B 3C-like peptidase
Length=307 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 3e91_B B 3C-like proteinase
Length=306 Score = 621 bits (1602), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300
> 4hi3_B B 3C-like proteinase
Length=315 Score = 621 bits (1602), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3ea9_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2z9l_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 2gt7_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3aw1_A A 3C-Like Proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 5b6o_B B 3C-like proteinase
Length=316 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2gtb_A A 3C-like proteinase
Length=307 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3d62_A A 3C-like proteinase
Length=299 Score = 619 bits (1597), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 60 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 121 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 180 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 299
> 3f9h_B B 3C-like proteinase
Length=308 Score = 619 bits (1596), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 4hi3_A A 3C-like proteinase
Length=315 Score = 619 bits (1597), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301
> 3avz_A A 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 5c5o_A A 3C-like proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3aw1_B B 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_A A 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_B B 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 5c5o_B B 3C-like proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2bx4_A A 3C-LIKE PROTEINASE
Length=306 Score = 618 bits (1594), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2gt8_A A 3C-like proteinase
Length=307 Score = 618 bits (1594), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 3f9f_B B 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9f_A A 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9h_A A 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9e_A A 3C-like proteinase
Length=308 Score = 614 bits (1584), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/297 (96%), Positives = 293/297 (99%), Gaps = 0/297 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKG+FLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGAFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQ Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ 301
> 3f9g_A A 3C-like proteinase
Length=303 Score = 612 bits (1578), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/300 (95%), Positives = 292/300 (97%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 1q2w_A A 3C-like protease
Length=308 Score = 611 bits (1576), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC MLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 1q2w_B B 3C-like protease
Length=308 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/301 (94%), Positives = 291/301 (97%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT PNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXXXXXXPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 S 3564 S Sbjct 303 S 303
> 3fzd_A A 3C-like proteinase
Length=301 Score = 610 bits (1573), Expect = 0.0, Method: Compositional matrix adjust. Identities = 283/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTL GLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLAGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKG NGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGXXXNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 3f9g_B B 3C-like proteinase
Length=303 Score = 607 bits (1566), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/298 (95%), Positives = 290/298 (97%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 2pwx_A A 3C-like proteinase
Length=308 Score = 592 bits (1526), Expect = 0.0, Method: Compositional matrix adjust. Identities = 276/296 (93%), Positives = 284/296 (96%), Gaps = 0/296 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPS KVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSN Sbjct 6 RKMAFPSAKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSN 65 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 H+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 66 HSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPS 125 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG FYG Sbjct 126 GVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGKFYG 185 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLN TTLNDFNLVAMKYNYEPLT Sbjct 186 PFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNXXXTTLNDFNLVAMKYNYEPLT 245 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 QDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM TILGS +LEDEFTPFDVVRQ Sbjct 246 QDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXXTILGSTILEDEFTPFDVVRQ 301
> 5tl6_A B Replicase polyprotein 1ab
Length=319 Score = 562 bits (1448), Expect = 7e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 5 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 64 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 65 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 124 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 125 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 184 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 185 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 244 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 245 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 304 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 305 TDVFYKETSYTTTIK 319
> 4mm3_B B Papain-like proteinase
Length=316 Score = 562 bits (1448), Expect = 8e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 302 TDVFYKETSYTTTIK 316
> 5tl7_B B Replicase polyprotein 1ab
Length=319 Score = 562 bits (1448), Expect = 8e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 5 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 64 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 65 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 124 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 125 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 184 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 185 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 244 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 245 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 304 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 305 TDVFYKETSYTTTIK 319
> 4m0w_A A Replicase polyprotein 1a
Length=327 Score = 562 bits (1449), Expect = 9e-180, Method: Compositional matrix adjust. Identities = 261/317 (82%), Positives = 287/317 (91%), Gaps = 0/317 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 V+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+D Sbjct 3 VKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSD 62 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQ Sbjct 63 DTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNSYLSSVLLALQ 122 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 Q+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 123 QLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESA 182 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES F Sbjct 183 KRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSF 242 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+T Sbjct 243 VMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVT 302 Query 1865 DVFYKENSYTTTIKPVT 1881 DVFYKE SYTTTIKPV+ Sbjct 303 DVFYKETSYTTTIKPVS 319
> 5e6j_A A Replicase polyprotein 1ab
Length=325 Score = 561 bits (1446), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/317 (82%), Positives = 287/317 (91%), Gaps = 0/317 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTIKPVTY 1882 VFYKE SYTTTIKP+ + Sbjct 304 VFYKETSYTTTIKPLEH 320
> 5y3e_A A Replicase polyprotein 1a
Length=323 Score = 561 bits (1445), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 5y3q_A A Replicase polyprotein 1a
Length=323 Score = 561 bits (1445), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 2fe8_A A Replicase polyprotein 1ab
Length=315 Score = 560 bits (1443), Expect = 3e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 5tl7_D D Replicase polyprotein 1ab
Length=319 Score = 558 bits (1439), Expect = 1e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 7 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 66 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 67 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 126 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 127 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 186 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 187 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 246 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 247 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 306 Query 1866 VFYKENSYTTTIK 1878 VFYKE SYTTTIK Sbjct 307 VFYKETSYTTTIK 319
> 2fe8_B B Replicase polyprotein 1ab
Length=315 Score = 558 bits (1438), Expect = 2e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTT 1876 TDVFYKE SYTTT Sbjct 302 TDVFYKETSYTTT 314
> 5e6j_D D Replicase polyprotein 1ab
Length=325 Score = 558 bits (1439), Expect = 2e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTIK 1878 VFYKE SYTTTIK Sbjct 304 VFYKETSYTTTIK 316
> 5tl6_B D Replicase polyprotein 1ab
Length=319 Score = 557 bits (1436), Expect = 3e-178, Method: Compositional matrix adjust. Identities = 259/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DDT Sbjct 8 TIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDT 67 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ+ Sbjct 68 LRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQL 127 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KR Sbjct 128 EVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKR 187 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVM Sbjct 188 VLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVM 247 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TDV Sbjct 248 MSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDV 307 Query 1867 FYKENSYTTTIK 1878 FYKE SYTTTIK Sbjct 308 FYKETSYTTTIK 319
> 3e9s_A A Non-structural protein 3
Length=322 Score = 557 bits (1436), Expect = 3e-178, Method: Compositional matrix adjust. Identities = 259/314 (82%), Positives = 284/314 (90%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 4 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL L Sbjct 64 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLAL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 124 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 184 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 244 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 303 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 304 TDVFYKETSYTTTI 317
> 2fe8_C C Replicase polyprotein 1ab
Length=315 Score = 556 bits (1434), Expect = 5e-178, Method: Compositional matrix adjust. Identities = 258/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTT 1875 TDVFYKE SYTT Sbjct 302 TDVFYKETSYTT 313
> 3mj5_A A Replicase polyprotein 1a
Length=316 Score = 556 bits (1434), Expect = 5e-178, Method: Compositional matrix adjust. Identities = 258/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTI 1877 VFYKE SYTTTI Sbjct 304 VFYKETSYTTTI 315
> 4ow0_A A papain-like protease
Length=320 Score = 553 bits (1425), Expect = 1e-176, Method: Compositional matrix adjust. Identities = 257/312 (82%), Positives = 282/312 (90%), Gaps = 0/312 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTI 1877 VFYKE SYTTTI Sbjct 304 VFYKETSYTTTI 315
> 6yva_A A Replicase polyprotein 1a
Length=315 Score = 553 bits (1424), Expect = 1e-176, Method: Compositional matrix adjust. Identities = 267/305 (88%), Positives = 267/305 (88%), Gaps = 0/305 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDM YG QFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 4 TIKVFTTVDNINLHTQVVDMXXXYGXQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 63 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQQI Sbjct 64 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQI 123 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 124 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 183 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 V LKGVEAVMYMGTLSYEQFKKG YLVQQESPFVM Sbjct 184 VXXXXXXXXXXXXXXLKGVEAVMYMGTLSYEQFKKGXXXXXXXXXXXXXYLVQQESPFVM 243 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYT HYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 244 MSAPPAQYELKHGTFTCASEYTXXXXXXHYKHITSKETLYCIDGALLTKSSEYKGPITDV 303 Query 1867 FYKEN 1871 FYKEN Sbjct 304 FYKEN 308
> 4ovz_A A Papain-like proteinase
Length=324 Score = 538 bits (1386), Expect = 2e-171, Method: Compositional matrix adjust. Identities = 250/305 (82%), Positives = 274/305 (90%), Gaps = 0/305 (0%) Query 1571 FTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVE 1630 FTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DDTLR E Sbjct 9 FTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSE 68 Query 1631 AFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKF 1690 AFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ+E+KF Sbjct 69 AFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQLEVKF 128 Query 1691 NPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNV 1750 N PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KRVLNV Sbjct 129 NAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNV 188 Query 1751 VCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAP 1810 VCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVMMSAP Sbjct 189 VCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAP 248 Query 1811 PAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKE 1870 PA+Y+L+ GTF CA+EYTGNYQ GHY HIT+KETLY IDGA LTK SEYKGP+TDVFYKE Sbjct 249 PAEYKLQQGTFLCANEYTGNYQXGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKE 308 Query 1871 NSYTT 1875 SYTT Sbjct 309 TSYTT 313
> 3mj5_B B Replicase polyprotein 1a
Length=316 Score = 460 bits (1183), Expect = 3e-144, Method: Compositional matrix adjust. Identities = 213/262 (81%), Positives = 235/262 (90%), Gaps = 0/262 (0%) Query 1617 TFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYL 1676 TF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL Sbjct 55 TFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYL 114 Query 1677 ATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLF 1736 ++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L Sbjct 115 SSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLL 174 Query 1737 QHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKY 1796 QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+Y Sbjct 175 QHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQY 234 Query 1797 LVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKS 1856 LVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK Sbjct 235 LVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKM 294 Query 1857 SEYKGPITDVFYKENSYTTTIK 1878 SEYKGP+TDVFYKE SYTTTIK Sbjct 295 SEYKGPVTDVFYKETSYTTTIK 316
> 4ow0_B B papain-like protease
Length=320 Score = 452 bits (1164), Expect = 1e-141, Method: Compositional matrix adjust. Identities = 210/260 (81%), Positives = 232/260 (89%), Gaps = 0/260 (0%) Query 1619 YVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLAT 1678 +VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ Sbjct 57 FVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSS 116 Query 1679 ALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH 1738 LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QH Sbjct 117 VLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQH 176 Query 1739 ANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV 1798 ANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLV Sbjct 177 ANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLV 236 Query 1799 QQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSE 1858 QQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SE Sbjct 237 QQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSE 296 Query 1859 YKGPITDVFYKENSYTTTIK 1878 YKGP+TDVFYKE SYTTTIK Sbjct 297 YKGPVTDVFYKETSYTTTIK 316
> 4ovz_B B Papain-like proteinase
Length=320 Score = 438 bits (1126), Expect = 2e-136, Method: Compositional matrix adjust. Identities = 204/252 (81%), Positives = 224/252 (89%), Gaps = 0/252 (0%) Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ+ Sbjct 65 LRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQL 124 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KR Sbjct 125 EVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKR 184 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVM Sbjct 185 VLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVM 244 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TDV Sbjct 245 MSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDV 304 Query 1867 FYKENSYTTTIK 1878 FYKE SYTTTIK Sbjct 305 FYKETSYTTTIK 316
> 2wct_B B NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2wct_A A NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2w2g_A A NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2w2g_B B NON-STRUCTURAL PROTEIN 3
Length=264 Score = 402 bits (1033), Expect = 5e-125, Method: Compositional matrix adjust. Identities = 192/260 (74%), Positives = 221/260 (85%), Gaps = 0/260 (0%) Query 1235 CVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEG 1294 C++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV+ G Sbjct 5 CIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSG 64 Query 1295 VLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFY 1354 +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCKSAFY Sbjct 65 DITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFY 124 Query 1355 ILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEG 1414 +LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIKIQEG Sbjct 125 VLPSEAPXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEG 184 Query 1415 VVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPAT 1474 +VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ PA Sbjct 185 IVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAV 244 Query 1475 VSVSSPDAVTAYNGYLTSSS 1494 VSVSSPDAVT YNGYLTSSS Sbjct 245 VSVSSPDAVTTYNGYLTSSS 264
> 2wct_C C NON-STRUCTURAL PROTEIN 3
Length=264 Score = 401 bits (1030), Expect = 2e-124, Method: Compositional matrix adjust. Identities = 191/264 (72%), Positives = 220/264 (83%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++ LEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDXXXXXLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2wct_D D NON-STRUCTURAL PROTEIN 3
Length=264 Score = 392 bits (1007), Expect = 2e-121, Method: Compositional matrix adjust. Identities = 187/264 (71%), Positives = 216/264 (82%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++ KFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDXXXXXXXXXKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2ahm_H H Replicase polyprotein 1ab, heavy chain
Length=203 Score = 384 bits (985), Expect = 2e-119, Method: Compositional matrix adjust. Identities = 186/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%) Query 3944 IASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK 4003 IASEFSSLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK Sbjct 7 IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK 66 Query 4004 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP 4063 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP Sbjct 67 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP 126 Query 4064 LTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLA 4123 LTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLA Sbjct 127 LTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLA 186 Query 4124 WPLIVTALRAN 4134 WPLIVTALRAN Sbjct 187 WPLIVTALRAN 197
> 6yyt_D D nsp8
Length=201 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 9 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 68 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 69 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 128 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 129 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 188 Query 4128 VTALRA 4133 VTALRA Sbjct 189 VTALRA 194
> 6yyt_B B nsp8
Length=201 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 9 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 68 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 69 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 128 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 129 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 188 Query 4128 VTALRA 4133 VTALRA Sbjct 189 VTALRA 194
> 2ahm_G G Replicase polyprotein 1ab, heavy chain
Length=203 Score = 382 bits (982), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%) Query 3943 AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE 4002 AIASEFSSLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE Sbjct 6 AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE 65 Query 4003 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII 4062 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII Sbjct 66 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII 125 Query 4063 PLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNL 4122 PLTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNL Sbjct 126 PLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNL 185 Query 4123 AWPLIVTALRA 4133 AWPLIVTALRA Sbjct 186 AWPLIVTALRA 196
> 6wey_A A Non-structural protein 3
Length=172 Score = 350 bits (899), Expect = 3e-108, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 2 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 61 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 62 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 121 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS 1195 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS Sbjct 122 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS 172
> 6ywm_A A NSP3 macrodomain
Length=173 Score = 349 bits (895), Expect = 9e-108, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_B B Non-structural protein 3
Length=176 Score = 349 bits (895), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_D D Non-structural protein 3
Length=176 Score = 349 bits (895), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6ywl_C C NSP3 macrodomain
Length=173 Score = 348 bits (894), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6ywk_C C NSP3 macrodomain
Length=173 Score = 348 bits (894), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_C C Non-structural protein 3
Length=176 Score = 347 bits (890), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6woj_A A Non-structural protein 3
Length=176 Score = 347 bits (890), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_B B NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_A A NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_E E NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_D D NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_A A NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_B B NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_E E NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywm_B B NSP3 macrodomain
Length=173 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 171
> 6w6y_A A SARS-CoV-2 NSP3
Length=170 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 170
> 6wen_A A Non-structural protein 3
Length=170 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 170
> 6ywl_D D NSP3 macrodomain
Length=173 Score = 344 bits (883), Expect = 4e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 171
> 6w6y_B B SARS-CoV-2 NSP3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6vxs_B B Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6vxs_A A Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6w02_B B Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6ywm_C C NSP3 macrodomain
Length=173 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 170
> 6wcf_A A Non-structural protein 3
Length=170 Score = 341 bits (874), Expect = 6e-105, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 1026 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 1085 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV Sbjct 4 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 63 Query 1086 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 1145 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL Sbjct 64 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 123 Query 1146 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 124 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6w02_A A Non-structural protein 3
Length=170 Score = 339 bits (869), Expect = 2e-104, Method: Compositional matrix adjust. Identities = 165/165 (100%), Positives = 165/165 (100%), Gaps = 0/165 (0%) Query 1026 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 1085 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV Sbjct 4 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 63 Query 1086 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 1145 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL Sbjct 64 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 123 Query 1146 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF 1190 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF Sbjct 124 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF 168
> 4rsp_A A Orf1a protein
Length=310 Score = 324 bits (831), Expect = 3e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLXGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_A A ORF1a protein
Length=306 Score = 323 bits (828), Expect = 8e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_D D ORF1a protein
Length=306 Score = 323 bits (828), Expect = 8e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 5wkj_A A Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 5wkl_A A Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 4wme_D D MERS-CoV 3CL protease
Length=306 Score = 322 bits (825), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 4wme_A A MERS-CoV 3CL protease
Length=306 Score = 322 bits (825), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 5wkk_A A Orf1a protein
Length=313 Score = 322 bits (825), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 205/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 4ylu_B B ORF1a protein
Length=306 Score = 321 bits (823), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 4ylu_C C ORF1a protein
Length=306 Score = 321 bits (823), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 5wkm_A A Orf1a protein
Length=313 Score = 321 bits (823), Expect = 5e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 204/308 (66%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPXXQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 5c3n_A A ORF1a protein
Length=306 Score = 320 bits (821), Expect = 6e-96, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 5c3n_B B ORF1a protein
Length=306 Score = 320 bits (820), Expect = 8e-96, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 4wme_B B MERS-CoV 3CL protease
Length=306 Score = 320 bits (820), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wmd_B B ORF1a
Length=306 Score = 320 bits (820), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wmf_B B MERS-CoV 3CL protease
Length=306 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wmd_C C ORF1a
Length=306 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wme_C C MERS-CoV 3CL protease
Length=306 Score = 318 bits (815), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 154/306 (50%), Positives = 204/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 4wmd_A A ORF1a
Length=306 Score = 317 bits (813), Expect = 8e-95, Method: Compositional matrix adjust. Identities = 153/303 (50%), Positives = 203/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 4wmf_A A MERS-CoV 3CL protease
Length=306 Score = 317 bits (812), Expect = 1e-94, Method: Compositional matrix adjust. Identities = 154/307 (50%), Positives = 204/307 (66%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PS VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSXDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 2ahm_E E Replicase polyprotein 1ab, heavy chain
Length=203 Score = 312 bits (799), Expect = 2e-94, Method: Composition-based stats. Identities = 151/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%) Query 3980 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK 4039 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK Sbjct 43 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK 102 Query 4040 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQ 4099 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQ Sbjct 103 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQ 162 Query 4100 QVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN 4134 QVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRAN Sbjct 163 QVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN 197
> 4yog_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yog_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yo9_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2ynb_A A 3C-LIKE PROTEINASE
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2yna_A A 3C-LIKE PROTEINASE
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2ynb_B B 3C-LIKE PROTEINASE
Length=306 Score = 309 bits (791), Expect = 6e-92, Method: Compositional matrix adjust. Identities = 152/306 (50%), Positives = 203/306 (66%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQVMG 302
> 2yna_B B 3C-LIKE PROTEINASE
Length=306 Score = 309 bits (791), Expect = 6e-92, Method: Compositional matrix adjust. Identities = 152/306 (50%), Positives = 203/306 (66%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQVMG 302
> 4yo9_B B 3C-like proteinase
Length=306 Score = 308 bits (788), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 151/303 (50%), Positives = 202/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 4wmf_C C MERS-CoV 3CL protease
Length=306 Score = 306 bits (785), Expect = 4e-91, Method: Compositional matrix adjust. Identities = 149/300 (50%), Positives = 197/300 (66%), Gaps = 8/300 (3%) Query 3274 GKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ- 3332 G VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ +PNY+ LLI +NH+F VQ Sbjct 11 GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADXXXDPNYDALLISMTNHSFSVQK 70 Query 3333 --AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQ 3390 LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLACYNG P+G + Sbjct 71 HIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFT 130 Query 3391 CAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD 3450 MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ +G YG F+D Sbjct 131 VVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAXGTHTGSAFDGTMYGAFMD 190 Query 3451 RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDH 3509 +Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ + E + Sbjct 191 KQVXXXQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQS 250 Query 3510 VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ 3569 VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Q GV Q Sbjct 251 VDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ 306
> 3d23_A B 3C-like proteinase
Length=302 Score = 303 bits (775), Expect = 7e-90, Method: Compositional matrix adjust. Identities = 149/303 (49%), Positives = 192/303 (63%), Gaps = 3/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 3564 SGV 3566 +GV Sbjct 300 AGV 302
> 6jij_B C Replicative polyprotein 1ab
Length=301 Score = 302 bits (774), Expect = 1e-89, Method: Compositional matrix adjust. Identities = 152/303 (50%), Positives = 196/303 (65%), Gaps = 5/303 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 3564 SGV 3566 +GV Sbjct 296 AGV 298
> 3d23_D D 3C-like proteinase
Length=302 Score = 301 bits (772), Expect = 2e-89, Method: Compositional matrix adjust. Identities = 148/302 (49%), Positives = 191/302 (63%), Gaps = 3/302 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 3564 SG 3565 +G Sbjct 300 AG 301
> 6jij_A B Replicative polyprotein 1ab
Length=301 Score = 301 bits (770), Expect = 4e-89, Method: Compositional matrix adjust. Identities = 151/302 (50%), Positives = 195/302 (65%), Gaps = 5/302 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 3564 SG 3565 +G Sbjct 296 AG 297
> 6jij_C A Replicative polyprotein 1ab
Length=301 Score = 301 bits (770), Expect = 4e-89, Method: Compositional matrix adjust. Identities = 151/302 (50%), Positives = 195/302 (65%), Gaps = 5/302 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 3564 SG 3565 +G Sbjct 296 AG 297
> 3d23_B A 3C-like proteinase
Length=302 Score = 300 bits (768), Expect = 6e-89, Method: Compositional matrix adjust. Identities = 148/303 (49%), Positives = 190/303 (63%), Gaps = 3/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+ M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSXXXMNEPDYSALLCR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 3564 SGV 3566 +GV Sbjct 300 AGV 302
> 3d23_C C 3C-like proteinase
Length=302 Score = 300 bits (767), Expect = 8e-89, Method: Compositional matrix adjust. Identities = 147/301 (49%), Positives = 190/301 (63%), Gaps = 3/301 (1%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 G KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 4 GIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRV 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 64 TLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNGR 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GNF Sbjct 124 PQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 184 YGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQ 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q + Sbjct 244 VKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLA 300 Query 3565 G 3565 G Sbjct 301 G 301
> 2ahm_F F Replicase polyprotein 1ab, heavy chain
Length=203 Score = 290 bits (743), Expect = 5e-87, Method: Composition-based stats. Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%) Query 3992 DRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINN 4051 DRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINN Sbjct 55 DRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINN 114 Query 4052 ARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQL 4111 ARDGCVPLNIIPLTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQL Sbjct 115 ARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQL 174 Query 4112 SEISMDNSPNLAWPLIVTALRAN 4134 SEI+MDNSPNLAWPLIVTALRAN Sbjct 175 SEINMDNSPNLAWPLIVTALRAN 197
> 7c2k_D D Non-structural protein 8
Length=200 Score = 286 bits (731), Expect = 2e-85, Method: Composition-based stats. Identities = 139/139 (100%), Positives = 139/139 (100%), Gaps = 0/139 (0%) Query 3995 AAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARD 4054 AAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARD Sbjct 55 AAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARD 114 Query 4055 GCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEI 4114 GCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEI Sbjct 115 GCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEI 174 Query 4115 SMDNSPNLAWPLIVTALRA 4133 SMDNSPNLAWPLIVTALRA Sbjct 175 SMDNSPNLAWPLIVTALRA 193
> 5nfy_E M Polyprotein 1ab
Length=138 Score = 281 bits (718), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 7 HAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 66 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 67 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 126 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 127 CGMWKGYGCSCD 138
> 5nfy_F N Polyprotein 1ab
Length=138 Score = 281 bits (718), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 7 HAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 66 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 67 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 126 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 127 CGMWKGYGCSCD 138
> 5nfy_H P Polyprotein 1ab
Length=138 Score = 281 bits (718), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 7 HAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 66 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 67 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 126 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 127 CGMWKGYGCSCD 138
> 5nfy_G O Polyprotein 1ab
Length=138 Score = 281 bits (718), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 7 HAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 66 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 67 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 126 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 127 CGMWKGYGCSCD 138
> 5c8u_C C Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 5c8t_A A Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 5c8s_C C Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 5c8u_A A Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 5c8s_A A Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 5c8t_C C Non-structural protein 10
Length=144 Score = 281 bits (718), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%) Query 4253 QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 4312 AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP Sbjct 5 SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP 64 Query 4313 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV 4372 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV Sbjct 65 EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV 124 Query 4373 CGMWKGYGCSCD 4384 CGMWKGYGCSCD Sbjct 125 CGMWKGYGCSCD 136
> 6wvn_B B Non-structural protein 10
Length=142 Score = 268 bits (685), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%) Query 4263 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 4322 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG Sbjct 13 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 72 Query 4323 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS 4382 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS Sbjct 73 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS 132 Query 4383 CDQ 4385 CDQ Sbjct 133 CDQ 135
> 6w75_B B SARS-CoV-2 NSP10
Length=142 Score = 268 bits (684), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%), Gaps = 0/122 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 4390 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 140 Query 4391 LQ 4392 LQ Sbjct 141 LQ 142
> 6wkq_B B SARS-CoV-2 NSP10
Length=142 Score = 268 bits (684), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%), Gaps = 0/122 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 4390 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 140 Query 4391 LQ 4392 LQ Sbjct 141 LQ 142
> 6wjt_B B Non-structural protein 10
Length=142 Score = 268 bits (684), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%), Gaps = 0/122 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 4390 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPM 140 Query 4391 LQ 4392 LQ Sbjct 141 LQ 142
> 2fyg_A A Replicase polyprotein 1ab
Length=128 Score = 265 bits (677), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%) Query 4263 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 4322 NSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG Sbjct 6 NSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 65 Query 4323 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS 4382 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGCS Sbjct 66 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCS 125 Query 4383 CDQ 4385 CDQ Sbjct 126 CDQ 128
> 2acf_D D Replicase polyprotein 1ab
Length=182 Score = 265 bits (677), Expect = 2e-78, Method: Composition-based stats. Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN AMQ Sbjct 9 VNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQ 68 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN ++L Sbjct 69 KESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDIL 128 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 129 LAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 176
> 2xyq_B B NON-STRUCTURAL PROTEIN 10
Length=122 Score = 262 bits (670), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%) Query 4263 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 4322 NSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG Sbjct 1 NSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 60 Query 4323 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS 4382 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGCS Sbjct 61 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCS 120 Query 4383 CD 4384 CD Sbjct 121 CD 122
> 2acf_A A Replicase polyprotein 1ab
Length=182 Score = 264 bits (674), Expect = 5e-78, Method: Composition-based stats. Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN AMQ Sbjct 9 VNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQ 68 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN ++L Sbjct 69 KESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDIL 128 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L Sbjct 129 LAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYL 175
> 5hyo_A A PEDV 3CLpro
Length=301 Score = 267 bits (683), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 197/306 (64%), Gaps = 6/306 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 GS +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSGVTF 3568 GV Sbjct 296 MYGVNL 301
> 5hyo_B B PEDV 3CLpro
Length=301 Score = 267 bits (683), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 197/306 (64%), Gaps = 6/306 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 GS +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSGVTF 3568 GV Sbjct 296 MYGVNL 301
> 5gwz_B A PEDV main protease
Length=307 Score = 266 bits (681), Expect = 3e-77, Method: Compositional matrix adjust. Identities = 137/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIR 3323 G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++R Sbjct 7 GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLR 66 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 67 L--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 124 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 125 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 184 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 185 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 244 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 245 --TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 301 Query 3564 SGV 3566 GV Sbjct 302 YGV 304
> 5gwz_A B PEDV main protease
Length=307 Score = 266 bits (681), Expect = 3e-77, Method: Compositional matrix adjust. Identities = 137/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIR 3323 G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++R Sbjct 7 GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLR 66 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 67 L--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 124 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 125 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 184 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 185 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 244 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 245 --TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 301 Query 3564 SGV 3566 GV Sbjct 302 YGV 304
> 7btf_C B NSP8
Length=198 Score = 262 bits (669), Expect = 4e-77, Method: Compositional matrix adjust. Identities = 126/126 (100%), Positives = 126/126 (100%), Gaps = 0/126 (0%) Query 4009 MTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAA 4068 MTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAA Sbjct 67 MTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAA 126 Query 4069 KLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIV 4128 KLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIV Sbjct 127 KLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIV 186 Query 4129 TALRAN 4134 TALRAN Sbjct 187 TALRAN 192
> 6l70_B B PEDV main protease
Length=305 Score = 266 bits (680), Expect = 4e-77, Method: Compositional matrix adjust. Identities = 136/304 (45%), Positives = 197/304 (65%), Gaps = 6/304 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSGV 3566 GV Sbjct 296 MYGV 299
> 6l70_A A PEDV main protease
Length=305 Score = 266 bits (680), Expect = 4e-77, Method: Compositional matrix adjust. Identities = 136/304 (45%), Positives = 197/304 (65%), Gaps = 6/304 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSGV 3566 GV Sbjct 296 MYGV 299
> 2acf_B B Replicase polyprotein 1ab
Length=182 Score = 261 bits (666), Expect = 6e-77, Method: Compositional matrix adjust. Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 0/170 (0%) Query 1023 IEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNA 1082 + VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN A Sbjct 7 MPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGA 66 Query 1083 MQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHE 1142 MQ ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN + Sbjct 67 MQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQD 126 Query 1143 VLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 +LLAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 127 ILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 176
> 2acf_C C Replicase polyprotein 1ab
Length=182 Score = 261 bits (666), Expect = 6e-77, Method: Compositional matrix adjust. Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 0/170 (0%) Query 1023 IEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNA 1082 + VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN A Sbjct 7 MPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGA 66 Query 1083 MQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHE 1142 MQ ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN + Sbjct 67 MQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQD 126 Query 1143 VLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 +LLAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 127 ILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 176
> 6wq3_B B Non-structural protein 10
Length=142 Score = 259 bits (661), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 119/122 (98%), Positives = 119/122 (98%), Gaps = 0/122 (0%) Query 4264 STVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG 4323 STVLSFC VDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG Sbjct 14 STVLSFCXXXVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG 73 Query 4324 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC 4383 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC Sbjct 74 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC 133 Query 4384 DQ 4385 DQ Sbjct 134 DQ 135
> 4xfq_A A PEDV main protease
Length=305 Score = 265 bits (677), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSG 3565 G Sbjct 296 MYG 298
> 2fav_C C Replicase polyprotein 1ab (pp1ab) (ORF1AB)
Length=192 Score = 260 bits (665), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN AMQ Sbjct 10 VNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQ 69 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN ++L Sbjct 70 KESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDIL 129 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 130 LAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 177
> 2fav_B B Replicase polyprotein 1ab (pp1ab) (ORF1AB)
Length=192 Score = 260 bits (665), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN AMQ Sbjct 10 VNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQ 69 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN ++L Sbjct 70 KESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDIL 129 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 130 LAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 177
> 2fav_A A Replicase polyprotein 1ab (pp1ab) (ORF1AB)
Length=192 Score = 260 bits (665), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VN F+GYLKLTDNV IK DIV+EA+ P V+VNAAN++LKHGGGVAGALNKATN AMQ Sbjct 10 VNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQ 69 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 ESDDYI NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENFN ++L Sbjct 70 KESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDIL 129 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V +L+ Sbjct 130 LAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD 177
> 3r24_B B Non-structural protein 10 and Non-structural protein
11 Length=155 Score = 258 bits (658), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%) Query 4263 NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 4322 NSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG Sbjct 13 NSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFG 72 Query 4323 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCS 4382 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGCS Sbjct 73 GASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCS 132
> 4xfq_B B PEDV main protease
Length=305 Score = 263 bits (672), Expect = 5e-76, Method: Compositional matrix adjust. Identities = 135/302 (45%), Positives = 192/302 (64%), Gaps = 4/302 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVI-ASXXXXTIDYDYALSV 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 60 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 296 Query 3564 SG 3565 G Sbjct 297 YG 298
> 6wrz_B B Non-structural protein 10
Length=142 Score = 256 bits (655), Expect = 5e-76, Method: Compositional matrix adjust. Identities = 118/121 (98%), Positives = 118/121 (98%), Gaps = 0/121 (0%) Query 4264 STVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG 4323 STVLSFC VDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG Sbjct 14 STVLSFCXXXVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGG 73 Query 4324 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC 4383 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC Sbjct 74 ASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC 133 Query 4384 D 4384 D Sbjct 134 D 134
> 2ga6_F F orf1a polyprotein
Length=152 Score = 256 bits (654), Expect = 9e-76, Method: Compositional matrix adjust. Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCT TGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTXTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 4zuh_A A PEDV 3C-Like protease
Length=305 Score = 262 bits (669), Expect = 1e-75, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 195/303 (64%), Gaps = 6/303 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G+ +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 3563 CSG 3565 G Sbjct 296 MYG 298
> 6wkq_D D SARS-CoV-2 NSP10
Length=142 Score = 254 bits (648), Expect = 4e-75, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 4386 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 136
> 6w4h_B B SARS-CoV-2 NSP10
Length=142 Score = 254 bits (648), Expect = 4e-75, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 4386 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 136
> 7c2i_B B Replicase polyprotein 1ab
Length=144 Score = 254 bits (648), Expect = 5e-75, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 23 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 82 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 4386 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL Sbjct 83 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 138
> 4zuh_B B PEDV 3C-Like protease
Length=305 Score = 259 bits (663), Expect = 7e-75, Method: Compositional matrix adjust. Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 4/302 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVI-ASXXXXTIDYDYALSV 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 60 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 + +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 AAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 296 Query 3564 SG 3565 G Sbjct 297 YG 298
> 5zqg_B B Non-structural protein
Length=308 Score = 259 bits (663), Expect = 8e-75, Method: Compositional matrix adjust. Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 4/302 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 2 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVI-ASXXXXTIDYDYALSV 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 61 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 + +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 121 AAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 181 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 241 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 297 Query 3564 SG 3565 G Sbjct 298 YG 299
> 2ga6_N N orf1a polyprotein
Length=152 Score = 253 bits (646), Expect = 9e-75, Method: Compositional matrix adjust. Identities = 117/122 (96%), Positives = 118/122 (97%), Gaps = 0/122 (0%) Query 4261 PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 4320 PANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES Sbjct 8 PANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 67 Query 4321 FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG 4380 FGGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYG Sbjct 68 FGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYG 127 Query 4381 CS 4382 CS Sbjct 128 CS 129
> 2ga6_B B orf1a polyprotein
Length=152 Score = 253 bits (646), Expect = 9e-75, Method: Compositional matrix adjust. Identities = 117/122 (96%), Positives = 118/122 (97%), Gaps = 0/122 (0%) Query 4261 PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 4320 PANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES Sbjct 8 PANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 67 Query 4321 FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG 4380 FGGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYG Sbjct 68 FGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYG 127 Query 4381 CS 4382 CS Sbjct 128 CS 129
> 2g9t_B B orf1a polyprotein
Length=152 Score = 253 bits (646), Expect = 9e-75, Method: Compositional matrix adjust. Identities = 117/122 (96%), Positives = 118/122 (97%), Gaps = 0/122 (0%) Query 4261 PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 4320 PANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES Sbjct 8 PANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES 67 Query 4321 FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG 4380 FGGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYG Sbjct 68 FGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYG 127 Query 4381 CS 4382 CS Sbjct 128 CS 129
> 6w61_B B Non-structural protein 10
Length=140 Score = 252 bits (643), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 19 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 78 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 4385 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ Sbjct 79 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 133
> 5zqg_A A Non-structural protein
Length=308 Score = 259 bits (661), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 133/303 (44%), Positives = 193/303 (64%), Gaps = 6/303 (2%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDM-LNPNYEDLLI 3322 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI ++ +Y ++ Sbjct 2 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIAXXXXXXIDYDYALSVL 61 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 62 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 119 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G+ +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 GAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 179 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 239 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 296 Query 3563 CSG 3565 G Sbjct 297 MYG 299
> 7c2j_B B Replicase polyprotein 1ab
Length=144 Score = 252 bits (643), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%) Query 4272 FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR 4331 FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR Sbjct 24 FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR 83 Query 4332 CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 4386 CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL Sbjct 84 CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL 138
> 6w75_D D SARS-CoV-2 NSP10
Length=142 Score = 252 bits (643), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 4385 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 135
> 6wjt_D D Non-structural protein 10
Length=142 Score = 252 bits (643), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 21 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 80 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 4385 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ Sbjct 81 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQ 135
> 6wqd_B B SARS-CoV-2 NSP8
Length=122 Score = 249 bits (637), Expect = 6e-74, Method: Compositional matrix adjust. Identities = 121/121 (100%), Positives = 121/121 (100%), Gaps = 0/121 (0%) Query 4020 DKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT 4079 DKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT Sbjct 2 DKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT 61 Query 4080 YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKL 4139 YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKL Sbjct 62 YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKL 121 Query 4140 Q 4140 Q Sbjct 122 Q 122
> 2ga6_J J orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_Q Q orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_V V orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_M M orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_U U orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_I I orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_E E orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_P P orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_S S orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_O O orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_L L orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_T T orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_A A orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_X X orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_W W orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_C C orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_D D orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_K K orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_H H orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_W W orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_J J orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_O O orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_R R orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2ga6_G G orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_Q Q orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_E E orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_I I orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_N N orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_M M orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_S S orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_A A orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_T T orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_G G orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_X X orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_K K orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_C C orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_P P orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_H H orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_L L orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 2g9t_D D orf1a polyprotein
Length=152 Score = 251 bits (640), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%) Query 4262 ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 4321 ANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF Sbjct 9 ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESF 68 Query 4322 GGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGC 4381 GGASCCLYCRCHIDHPN FCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCGMWKGYGC Sbjct 69 GGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC 128 Query 4382 S 4382 S Sbjct 129 S 129
> 6wks_B BBB Non-structural protein 10
Length=139 Score = 249 bits (637), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 114/114 (100%), Positives = 114/114 (100%), Gaps = 0/114 (0%) Query 4271 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 4330 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC Sbjct 18 AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC 77 Query 4331 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD 4384 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD Sbjct 78 RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD 131
> 4zro_D D 3C-like proteinase
Length=299 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 4zro_C C 3C-like proteinase
Length=299 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 4zro_A A 3C-like proteinase
Length=299 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 4zro_B B 3C-like proteinase
Length=299 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 4f49_C C 3C-like proteinase
Length=310 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/304 (44%), Positives = 184/304 (61%), Gaps = 4/304 (1%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 7 HSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMS 65 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY Sbjct 66 SVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYE 125 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 126 GCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEG 185 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 186 EMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSF 245 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 246 TELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQ 302 Query 3563 CSGV 3566 GV Sbjct 303 MYGV 306
> 4f49_A A 3C-like proteinase
Length=310 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/304 (44%), Positives = 184/304 (61%), Gaps = 4/304 (1%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 7 HSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMS 65 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY Sbjct 66 SVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYE 125 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 126 GCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEG 185 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 186 EMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSF 245 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 246 TELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQ 302 Query 3563 CSGV 3566 GV Sbjct 303 MYGV 306
> 5eu8_A A main protease
Length=307 Score = 256 bits (654), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 134/304 (44%), Positives = 182/304 (60%), Gaps = 4/304 (1%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 5 SSGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELS 63 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY Sbjct 64 SVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYE 123 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 G P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 124 GCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEG 183 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 184 EMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSF 243 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 244 TEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQ 300 Query 3563 CSGV 3566 GV Sbjct 301 MYGV 304
> 1p9u_B B putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 1lvo_D D Replicase, hydrolase domain
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/305 (44%), Positives = 184/305 (60%), Gaps = 4/305 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGVTF 3568 GV Sbjct 297 YGVNL 301
> 1lvo_B B Replicase, hydrolase domain
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 1lvo_C C Replicase, hydrolase domain
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 1p9u_C C putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGV 3566 GV Sbjct 297 YGV 299
> 1p9u_D D putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 256 bits (653), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 135/305 (44%), Positives = 184/305 (60%), Gaps = 4/305 (1%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 3564 SGVTF 3568 GV Sbjct 297 YGVNL 301 Lambda K H a alpha 0.320 0.135 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 299113184020 Database: unitmol_20200603.fasta Posted date: Jun 3, 2020 10:14 AM Number of letters in database: 140,797,486 Number of sequences in database: 524,056 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40