[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens
OX=9606 GN=KPNA2 PE=1 SV=1

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  5h43_A A Importin subunit alpha-1                                    875    0.0   
  4e4v_B B Importin subunit alpha-2                                    874    0.0   
  4e4v_A A Importin subunit alpha-2                                    874    0.0   
  4wv6_A A Importin subunit alpha-1                                    871    0.0   
  3fey_C C Importin subunit alpha-2                                    871    0.0   
  3wpt_B B Importin subunit alpha-1                                    865    0.0   
  3wpt_A A Importin subunit alpha-1                                    864    0.0   
  3fex_C C Importin subunit alpha-2                                    862    0.0   
  1ial_A A IMPORTIN ALPHA                                              850    0.0   
  3tpo_A A Importin subunit alpha-2                                    844    0.0   
  5b56_B B Importin subunit alpha-1                                    843    0.0   
  5b56_A A Importin subunit alpha-1                                    837    0.0   
  1q1s_C C Importin alpha-2 subunit                                    836    0.0   
  3knd_A A Importin subunit alpha-2                                    836    0.0   
  4ba3_A A IMPORTIN SUBUNIT ALPHA-2                                    836    0.0   
  5gxw_A A Importin subunit alpha-1                                    836    0.0   
  1q1t_C C Importin alpha-2 subunit                                    834    0.0   
  3btr_A C Importin subunit alpha-2                                    834    0.0   
  5hhg_B E Importin subunit alpha-1                                    834    0.0   
  6iwa_B C Importin subunit alpha-1                                    834    0.0   
  3l3q_A A Importin subunit alpha-2                                    834    0.0   
  1pjm_B B Importin alpha-2 subunit                                    834    0.0   
  3ve6_A A Importin subunit alpha-2                                    832    0.0   
  4u5n_A A Importin subunit alpha-1                                    832    0.0   
  4u5l_A A Importin subunit alpha-1                                    832    0.0   
  4u5u_A A Importin subunit alpha-1                                    832    0.0   
  4u58_A A Importin subunit alpha-1                                    832    0.0   
  6mjl_A B Importin subunit alpha-1                                    832    0.0   
  4u5o_A A Importin subunit alpha-1                                    832    0.0   
  4u5v_A A Importin subunit alpha-1                                    832    0.0   
  4u5s_A A Importin subunit alpha-1                                    832    0.0   
  5ctt_A A Importin subunit alpha-1                                    832    0.0   
  6p6a_A B Importin subunit alpha-1                                    832    0.0   
  1iq1_C C IMPORTIN ALPHA-2 SUBUNIT                                    832    0.0   
  1pjn_B B Importin alpha-2 subunit                                    832    0.0   
  5wun_A A Importin subunit alpha-1                                    832    0.0   
  4oih_A A Importin subunit alpha-1                                    832    0.0   
  1ejl_C I IMPORTIN ALPHA                                              832    0.0   
  5wum_A A Importin subunit alpha-1                                    832    0.0   
  1ejy_B I IMPORTIN ALPHA                                              832    0.0   
  3zip_A A IMPORTIN SUBUNIT ALPHA-2                                    832    0.0   
  3ziq_A A IMPORTIN SUBUNIT ALPHA-2                                    832    0.0   
  3zio_A A IMPORTIN SUBUNIT ALPHA-2                                    832    0.0   
  3zin_A A IMPORTIN SUBUNIT ALPHA-2                                    832    0.0   
  3zir_A A IMPORTIN SUBUNIT ALPHA-2                                    832    0.0   
  4mz5_C E Importin subunit alpha-1                                    834    0.0   
  4htv_A A Importin subunit alpha-2                                    834    0.0   
  5fc8_B E Importin subunit alpha-1                                    834    0.0   
  3uky_A B Importin subunit alpha-2                                    834    0.0   
  3ukz_A B Importin subunit alpha-2                                    834    0.0   
  3rzx_A A Importin subunit alpha-2                                    834    0.0   
  4u54_A A Importin subunit alpha-1                                    829    0.0   
  3ul0_A B Importin subunit alpha-2                                    832    0.0   
  2ynr_A A IMPORTIN SUBUNIT ALPHA                                      830    0.0   
  5umz_A B Importin subunit alpha-1                                    832    0.0   
  4mz6_C E Importin subunit alpha-1                                    832    0.0   
  6bvt_A E Importin subunit alpha-1                                    832    0.0   
  5u5p_C A Importin subunit alpha-1                                    832    0.0   
  5klr_A B Importin subunit alpha-1                                    832    0.0   
  3ukx_A B Importin subunit alpha-2                                    832    0.0   
  5u5r_A A Importin subunit alpha-1                                    832    0.0   
  3ukw_A B Importin subunit alpha-2                                    832    0.0   
  5svz_A A Importin subunit alpha-1                                    832    0.0   
  3ul1_A B Importin subunit alpha-2                                    832    0.0   
  5klt_A B Importin subunit alpha-1                                    832    0.0   
  5w41_A A Importin subunit alpha-1                                    832    0.0   
  6bw0_B E Importin subunit alpha-1                                    832    0.0   
  6bw1_B E Importin subunit alpha-1                                    832    0.0   
  4uaf_A B Importin subunit alpha-1                                    830    0.0   
  4yi0_A C Importin subunit alpha-1                                    830    0.0   
  5x8n_A A Importin subunit alpha-1                                    830    0.0   
  2c1m_A A IMPORTIN-ALPHA2 SUBUNIT                                     828    0.0   
  7jk7_B B Importin subunit alpha-1                                    830    0.0   
  5k9s_A A Importin subunit alpha-1                                    829    0.0   
  6p6e_A A Importin subunit alpha-1                                    828    0.0   
  3uvu_B A Importin subunit alpha-2                                    830    0.0   
  5w4g_A B Importin subunit alpha-1                                    830    0.0   
  3oqs_B A Importin subunit alpha-2                                    830    0.0   
  5ekg_C A Importin subunit alpha-1                                    830    0.0   
  5e6q_A B Importin subunit alpha-1                                    830    0.0   
  5ekf_C A Importin subunit alpha-1                                    830    0.0   
  3rz9_A A Importin subunit alpha-2                                    830    0.0   
  5w4f_A B Importin subunit alpha-1                                    830    0.0   
  5w4e_A B Importin subunit alpha-1,Importin subunit alpha-1           830    0.0   
  1y2a_A C Importin alpha-2 Subunit                                    826    0.0   
  5d5k_A C Importin subunit alpha-1                                    828    0.0   
  3q5u_A A Importin subunit alpha-2                                    826    0.0   
  3tpm_A A Importin subunit alpha-2                                    825    0.0   
  6iua_A A Importin subunit alpha-1                                    825    0.0   
  6iu7_A A Importin subunit alpha-1                                    825    0.0   
  6k06_B C Importin subunit alpha-1                                    825    0.0   
  7jjm_B B Importin subunit alpha-1                                    825    0.0   
  5v5p_A C Importin subunit alpha-1                                    826    0.0   
  5v5o_A C Importin subunit alpha-1                                    826    0.0   
  5huy_A C Importin subunit alpha-1                                    826    0.0   
  5huw_A C Importin subunit alpha-1                                    826    0.0   
  6d7n_A B Peroxidase,Importin subunit alpha-1                         821    0.0   
  6iw8_B C Importin subunit alpha-1                                    816    0.0   
  6d7m_A B Peroxidase,Importin subunit alpha-1                         818    0.0   
  4zdu_A A Importin subunit alpha-1                                    808    0.0   
  4uae_A A Importin subunit alpha-3                                    470    1e-160
  5xzx_A A Importin subunit alpha-3                                    468    5e-160
  6bwb_A A Importin subunit alpha-3                                    470    5e-160
  6bwa_A A Importin subunit alpha-3                                    470    5e-160
  6bw9_A A Importin subunit alpha-3                                    470    5e-160
  6bvv_A A Importin subunit alpha-3                                    470    5e-160
  6bvz_A A Importin subunit alpha-3                                    470    5e-160
  5tbk_C C Importin subunit alpha-3                                    470    3e-159
  5tbk_G G Importin subunit alpha-3                                    470    3e-159
  5tbk_A A Importin subunit alpha-3                                    470    3e-159
  5tbk_H H Importin subunit alpha-3                                    470    3e-159
  5tbk_D D Importin subunit alpha-3                                    470    4e-159
  5tbk_B B Importin subunit alpha-3                                    470    4e-159
  5tbk_E E Importin subunit alpha-3                                    470    4e-159
  5tbk_F F Importin subunit alpha-3                                    470    4e-159
  7jjl_A A Importin subunit alpha-3                                    464    1e-157
  4uad_A A Importin subunit alpha-7                                    422    8e-141
  1wa5_B B IMPORTIN ALPHA SUBUNIT                                      416    4e-138
  4bqk_A A IMPORTIN SUBUNIT ALPHA-1A                                   407    3e-135
  4bpl_A A IMPORTIN SUBUNIT ALPHA-1A                                   406    3e-135
  4bqk_B B IMPORTIN SUBUNIT ALPHA-1A                                   406    4e-135
  4b8o_A A IMPORTIN SUBUNIT ALPHA-1A                                   406    1e-134
  2yns_B B IMPORTIN SUBUNIT ALPHA-1A                                   406    1e-134
  2yns_A A IMPORTIN SUBUNIT ALPHA-1A                                   406    1e-134
  4b8j_A A IMPORTIN SUBUNIT ALPHA-1A                                   407    2e-134
  4b8p_A A IMPORTIN SUBUNIT ALPHA-1A                                   406    2e-134
  4b8p_B B IMPORTIN SUBUNIT ALPHA-1A                                   406    2e-134
  2jdq_B B IMPORTIN ALPHA-1 SUBUNIT                                    403    4e-134
  2jdq_A A IMPORTIN ALPHA-1 SUBUNIT                                    401    3e-133
  3tj3_C B Importin subunit alpha-1                                    401    3e-133
  3tj3_A A Importin subunit alpha-1                                    401    3e-133
  4rxh_A B Importin subunit alpha                                      401    2e-132
  5vqi_A B Importin subunit alpha                                      401    2e-132
  4b18_A A IMPORTIN SUBUNIT ALPHA-1                                    399    3e-132
  1un0_A A IMPORTIN ALPHA SUBUNIT                                      396    2e-131
  1un0_B B IMPORTIN ALPHA SUBUNIT                                      396    3e-131
  4xzr_B B Importin subunit alpha                                      394    5e-131
  4pvz_B B Importin subunit alpha                                      394    6e-131
  4pvz_A A Importin subunit alpha                                      394    6e-131
  1bk5_A A KARYOPHERIN ALPHA                                           394    7e-131
  1bk5_B B KARYOPHERIN ALPHA                                           394    7e-131
  1bk6_A A KARYOPHERIN ALPHA                                           394    8e-131
  1bk6_D B KARYOPHERIN ALPHA                                           394    8e-131
  1ee4_D B KARYOPHERIN ALPHA                                           392    6e-130
  1ee4_A A KARYOPHERIN ALPHA                                           392    6e-130
  1ee5_A A KARYOPHERIN ALPHA                                           391    8e-130
  5h2x_A A Importin subunit alpha                                      391    8e-130
  5h2w_C C Importin subunit alpha                                      391    1e-129
  5h2w_A A Importin subunit alpha                                      391    1e-129
  2c1t_B B IMPORTIN ALPHA SUBUNIT                                      391    2e-129
  2c1t_A A IMPORTIN ALPHA SUBUNIT                                      391    2e-129
  5t94_B B Importin subunit alpha                                      394    2e-129
  4tnm_A A Importin subunit alpha                                      385    4e-126
  5mfm_A A YIIIM6AII_GS11_(KR)5                                        207    6e-60 
  5mfl_B B (KR)5_GS10_YIIIM6AII                                        207    6e-60 
  5mfl_A A (KR)5_GS10_YIIIM6AII                                        207    6e-60 
  5mfm_D D YIIIM6AII_GS11_(KR)5                                        207    7e-60 
  5mfm_B B YIIIM6AII_GS11_(KR)5                                        207    7e-60 
  5mfm_E E YIIIM6AII_GS11_(KR)5                                        207    7e-60 
  5mfm_C C Importin subunit alpha                                      207    7e-60 
  5mfm_F F YIIIM6AII_GS11_(KR)5                                        207    7e-60 
  5mfl_C C (KR)5_GS10_YIIIM6AII                                        207    8e-60 
  6sa7_B B DARPin-Armadillo fusion C8long83                            207    3e-58 
  6sa7_A A DARPin-Armadillo fusion C8long83                            207    3e-58 
  5mfd_A A YIIIM''6AII                                                 201    4e-58 
  5mfd_C C YIIIM''6AII                                                 201    4e-58 
  5mfd_E E YIIIM''6AII                                                 201    4e-58 
  5mfd_G G YIIIM''6AII                                                 201    4e-58 
  5mfd_I I YIIIM''6AII                                                 201    4e-58 
  5mfd_K K YIIIM''6AII                                                 201    4e-58 
  5mfd_L L YIIIM''6AII                                                 201    4e-58 
  5mfd_J J YIIIM''6AII                                                 201    4e-58 
  6sa8_A A ring-like DARPin-Armadillo fusion H83_D01                   202    2e-55 
  6s9p_B B internal Lock2 fused to target peptide KRKAKITWKR           192    1e-54 
  6s9p_A A internal Lock2 fused to target peptide KRKAKITWKR           192    2e-54 
  6s9o_A A designed Armadillo repeat protein with internal Lock1 ...   190    1e-53 
  6s9o_F F designed Armadillo repeat protein with internal Lock1 ...   190    1e-53 
  6s9o_C C designed Armadillo repeat protein with internal Lock1 ...   189    3e-53 
  6s9o_E E designed Armadillo repeat protein with internal Lock1 ...   189    3e-53 
  6s9o_B B designed Armadillo repeat protein with internal Lock1 ...   189    3e-53 
  6s9o_D D designed Armadillo repeat protein with internal Lock1 ...   187    9e-53 
  5mfh_C C YIIIM5AII                                                   177    1e-49 
  5mfe_A A YIIIM5AII                                                   177    1e-49 
  5mfe_D D YIIIM5AII                                                   177    1e-49 
  5aei_B B DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                 177    1e-49 
  5aei_C C DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                 177    1e-49 
  5mfh_A A YIIIM5AII                                                   177    1e-49 
  5mfh_D D YIIIM5AII                                                   177    2e-49 
  5mfe_B B YIIIM5AII                                                   177    2e-49 
  5mfg_A A YIIIM5AII                                                   177    2e-49 
  5mfh_B B YIIIM5AII                                                   177    2e-49 
  5mfe_C C YIIIM5AII                                                   177    2e-49 
  5aei_A A DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                 177    2e-49 
  5mfc_A A YIIIM5AII                                                   177    2e-49 
  5mfn_A A YIIIM5AII                                                   176    3e-49 
  5mff_B B YIIIM5AII                                                   176    3e-49 
  5mff_A A YIIIM5AII                                                   176    3e-49 
  5mfc_C C YIIIM5AII                                                   176    3e-49 
  5mfn_B B YIIIM5AII                                                   176    3e-49 
  4u2x_F F Importin subunit alpha-6                                    172    3e-49 
  5mff_D D YIIIM5AII                                                   176    4e-49 
  5mff_C C YIIIM5AII                                                   176    4e-49 
  6s9l_B B KR4KLSF Lock1                                               175    1e-48 
  5mfg_C C YIIIM5AII                                                   175    1e-48 
  6s9l_A A KR4KLSF Lock1                                               175    1e-48 
  4v3o_C C YIII_M5_AII                                                 174    1e-48 
  4v3o_A A YIII_M5_AII                                                 174    2e-48 
  4v3o_B B YIII_M5_AII                                                 174    2e-48 
  4v3o_D D YIII_M5_AII                                                 174    2e-48 
  5mfg_B B YIIIM5AII                                                   174    3e-48 
  4rv1_F F Engineered Protein OR497                                    177    5e-48 
  4rv1_C C Engineered Protein OR497                                    176    6e-48 
  4rv1_E E Engineered Protein OR497                                    176    6e-48 
  4rv1_A A Engineered Protein OR497                                    176    7e-48 
  4rv1_D D Engineered Protein OR497                                    176    8e-48 
  4v3r_B B YIII_M5_AII                                                 172    8e-48 
  4v3r_A A YIII_M5_AII                                                 172    8e-48 
  4rv1_B B Engineered Protein OR497                                    176    9e-48 
  4u2x_E E Importin subunit alpha-6                                    169    9e-48 
  4u2x_D D Importin subunit alpha-6                                    167    3e-47 
  6s9n_D D Lock2_KRKRKAKLSF                                            168    3e-46 
  6s9n_C C Lock2_KRKRKAKLSF                                            168    3e-46 
  6s9n_F F Lock2_KRKRKAKLSF                                            168    3e-46 
  6s9n_B B Lock2_KRKRKAKLSF                                            168    3e-46 
  6s9n_A A Lock2_KRKRKAKLSF                                            168    4e-46 
  6s9n_E E Lock2_KRKRKAKLSF                                            168    4e-46 
  6s9m_A A Lock2_KRKRKAKITW                                            168    4e-46 
  6s9m_C C Lock2_KRKRKAKITW                                            168    4e-46 
  6s9m_E E Lock2_KRKRKAKITW                                            168    4e-46 
  6s9m_D D Lock2_KRKRKAKITW                                            168    5e-46 
  6s9m_F F Lock2_KRKRKAKITW                                            168    5e-46 
  6s9m_B B Lock2_KRKRKAKITW                                            168    5e-46 
  4db8_A A Armadillo-repeat Protein                                    158    5e-43 
  4db8_C C Armadillo-repeat Protein                                    158    6e-43 
  4db8_B B Armadillo-repeat Protein                                    158    6e-43 
  4db8_D D Armadillo-repeat Protein                                    158    7e-43 
  4pls_B B Arm00010                                                    159    7e-43 
  4pls_D D Arm00010                                                    158    9e-43 
  4pls_C C Arm00010                                                    158    9e-43 
  4pls_A A Arm00010                                                    158    9e-43 
  4plq_A A Arm00011                                                    158    1e-42 
  4plr_A A Arm00008                                                    158    1e-42 
  4plr_B B Arm00008                                                    158    1e-42 
  4v3q_B B YIII_M4_AII                                                 156    2e-42 
  4v3q_A A YIII_M4_AII                                                 156    2e-42 
  4v3q_C C YIII_M4_AII                                                 155    5e-42 
  4v3q_D D YIII_M4_AII                                                 155    6e-42 
  6sa6_A A DARPin-Armadillo fusion A5                                  154    3e-40 
  5mfg_D D YIIIM5AII                                                   151    3e-40 
  5mfk_B B YIII(Dq.V1)4CPAF                                            143    1e-37 
  4d49_A A ARMADILLO REPEAT PROTEIN ARM00027                           142    1e-37 
  4d49_B B ARMADILLO REPEAT PROTEIN ARM00027                           142    1e-37 
  4d49_E E ARMADILLO REPEAT PROTEIN ARM00027                           142    1e-37 
  4d49_F F ARMADILLO REPEAT PROTEIN ARM00027                           142    1e-37 
  5mfk_A A YIII(Dq.V1)4CPAF                                            142    3e-37 
  4db6_A A Armadillo repeat protein                                    136    1e-35 
  5mfi_B B YIII(Dq.V2)4CqI                                             132    6e-34 
  5mfj_B B YIII(Dq.V2)4CqI                                             132    6e-34 
  5mfj_A A YIII(Dq.V2)4CqI                                             132    7e-34 
  5mfi_A A YIII(Dq.V2)4CqI                                             132    7e-34 
  4rzp_A A Engineered Protein OR366                                    130    6e-33 
  4rzp_B B Engineered Protein OR366                                    130    6e-33 
  4dba_A A Designed Armadillo repeat protein, YIIM3AII                 128    7e-33 
  4dba_D D Designed Armadillo repeat protein, YIIM3AII                 128    7e-33 
  4dba_C C Designed Armadillo repeat protein, YIIM3AII                 128    7e-33 
  4dba_B B Designed Armadillo repeat protein, YIIM3AII                 128    7e-33 
  4hxt_A A De Novo Protein OR329                                       129    1e-32 
  5mfo_A A YIIIM3AIII                                                  126    3e-32 
  5mfo_C C YIIIM3AIII                                                  126    3e-32 
  5mfo_B B YIIIM3AIII                                                  126    3e-32 
  5mfo_F F YIIIM3AIII                                                  126    3e-32 
  5mfo_E E YIIIM3AIII                                                  126    3e-32 
  5mfo_D D YIIIM3AIII                                                  126    3e-32 
  4db9_F F Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  4db9_E E Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  4db9_C C Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  4db9_B B Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  4db9_A A Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  4db9_D D Armadillo repeat protein, YIIIM3AIII                        126    4e-32 
  1qgk_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)                         93.6    5e-22 
  2ru4_A A Armadillo Repeat Protein, N-terminal fragment, YIIM2       89.0    1e-19 
  4d4e_A A ARMADILLO REPEAT PROTEIN ARM00016                          73.2    2e-13 
  4d4e_B B ARMADILLO REPEAT PROTEIN ARM00016                          73.2    2e-13 
  5mfb_B B YIII(Dq)4CqI                                               62.4    9e-10 
  5mfb_A A YIII(Dq)4CqI                                               62.0    1e-09 
  2ru4_B B Armadillo Repeat Protein, C-terminal fragment, MAII        59.3    2e-09 
  2ru5_A B Armadillo repeat protein C-terminal fragment               59.3    2e-09 
  1qgr_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)                         53.1    1e-07 
  6kbm_A A Vacuolar protein 8                                         57.4    1e-07 
  6kbn_A A Vacuolar protein 8                                         57.4    1e-07 
  5xjg_A A Vacuolar protein 8                                         57.4    1e-07 
  5xjg_C C Vacuolar protein 8                                         57.4    1e-07 
  6kbn_C C Vacuolar protein 8                                         57.0    2e-07 
  1qz7_A A Beta-catenin                                               50.1    2e-05 
  1v18_A A BETA-CATENIN                                               48.5    9e-05 
  1th1_A A Beta-catenin                                               48.5    9e-05 
  1i7x_A A BETA-CATENIN                                               48.5    9e-05 
  1th1_B B Beta-catenin                                               48.1    1e-04 
  1m1e_A A Beta-catenin                                               48.1    1e-04 
  1g3j_A A BETA-CATENIN ARMADILLO REPEAT REGION                       48.1    1e-04 
  1t08_A A Beta-catenin                                               48.1    1e-04 
  1g3j_C C BETA-CATENIN ARMADILLO REPEAT REGION                       47.8    1e-04 
  2gl7_A A Beta-catenin                                               47.4    2e-04 
  1i7x_C C BETA-CATENIN                                               47.4    2e-04 
  2z6h_A A Catenin beta-1                                             47.4    2e-04 
  3oux_A A Catenin beta-1                                             47.4    2e-04 
  3ouw_A A Catenin beta-1                                             47.4    2e-04 
  2z6g_A A B-catenin                                                  47.4    2e-04 
  1i7w_C C BETA-CATENIN                                               47.0    2e-04 
  2bct_A A BETA-CATENIN                                               47.0    2e-04 
  4evt_A A Catenin beta-1                                             47.0    2e-04 
  1jpw_E C BETA-CATENIN                                               47.0    2e-04 
  1jpw_C B BETA-CATENIN                                               47.0    2e-04 
  1jpw_A A BETA-CATENIN                                               47.0    2e-04 
  4eva_A A Catenin beta-1                                             47.0    2e-04 
  4evp_A A Catenin beta-1                                             47.0    2e-04 
  2gl7_D D Beta-catenin                                               47.0    3e-04 
  4djs_A A Catenin beta-1                                             47.0    3e-04 
  1luj_A A Catenin beta-1                                             47.0    3e-04 
  4eva_B C Catenin beta-1                                             47.0    3e-04 
  4ev9_A A Catenin beta-1                                             46.6    3e-04 
  4ev8_A A Catenin beta-1                                             46.6    3e-04 
  1i7w_A A BETA-CATENIN                                               46.6    4e-04 
  3bct_A A BETA-CATENIN                                               46.6    4e-04 
  3tx7_A A Catenin beta-1                                             45.8    5e-04 
  1jdh_A A BETA-CATENIN                                               45.4    7e-04 
  5xgc_A A Rap1 GTPase-GDP dissociation stimulator 1                  43.9    0.002 
  1jpp_B B BETA-CATENIN                                               43.5    0.003 
  1jpp_A A BETA-CATENIN                                               43.5    0.003 
  5zhx_D D Rap1 GTPase-GDP dissociation stimulator 1                  42.7    0.005 
  5zhx_B B Rap1 GTPase-GDP dissociation stimulator 1                  42.7    0.005 
  5zhx_C C Rap1 GTPase-GDP dissociation stimulator 1                  42.7    0.005 
  5zhx_A A Rap1 GTPase-GDP dissociation stimulator 1                  42.7    0.005 
  3ifq_A A plakoglobin                                                38.1    0.16  
  3ifq_B B plakoglobin                                                37.7    0.17  
  5wlc_GB SN Utp30                                                    35.4    0.68  
  6lqu_FB RI Ribosome biogenesis protein UTP30                        35.4    0.68  
  6lqp_GB RI Ribosome biogenesis protein UTP30                        35.4    0.68  
  6zqc_CA UZ Ribosome biogenesis protein UTP30                        35.4    0.68  
  6zqb_X UZ Ribosome biogenesis protein UTP30                         35.4    0.68  
  6zqa_W UZ Ribosome biogenesis protein UTP30                         35.4    0.68  
  6ke6_GB RI Ribosome biogenesis protein UTP30                        35.4    0.68  
  5wyj_IB U5 Ribosome biogenesis protein UTP30                        35.4    0.72  
  5wyk_CB U5 Ribosome biogenesis protein UTP30                        35.4    0.72  
  5ydt_A U5 Ribosome biogenesis protein UTP30                         35.4    0.73  
  5ydu_B B Ribosome biogenesis protein UTP30                          35.4    0.73  
  5ydu_A A Ribosome biogenesis protein UTP30                          35.0    0.96  
  3l6y_A A Catenin delta-1                                            34.7    1.9   
  3l6y_E E Catenin delta-1                                            34.3    2.1   
  3l6y_C C Catenin delta-1                                            34.3    2.2   
  3l6x_A A Catenin delta-1                                            34.3    2.2   
  5mfm_H Q YIIIM6AII_GS11_(KR)5                                       33.9    2.6   
  5mfm_G P YIIIM6AII_GS11_(KR)5                                       33.9    2.6   


> 5h43_A A Importin subunit alpha-1
Length=429 Score = 875 bits (2261), Expect = 0.0, Method: Compositional matrix adjust. Identities = 428/428 (100%), Positives = 428/428 (100%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 2 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 61 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 62 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 121 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV Sbjct 122 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 181 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI Sbjct 182 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 241 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 242 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 301 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 302 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 361 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL Sbjct 362 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 421 Query 490 SLIEKYFS 497 SLIEKYFS Sbjct 422 SLIEKYFS 429
> 4e4v_B B Importin subunit alpha-2
Length=485 Score = 874 bits (2259), Expect = 0.0, Method: Compositional matrix adjust. Identities = 427/428 (99%), Positives = 428/428 (100%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 26 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 85 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 86 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 145 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV Sbjct 146 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 205 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI Sbjct 206 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 265 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 266 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 325 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 326 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 385 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVY+ASL Sbjct 386 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYRASL 445 Query 490 SLIEKYFS 497 SLIEKYFS Sbjct 446 SLIEKYFS 453
> 4e4v_A A Importin subunit alpha-2
Length=485 Score = 874 bits (2259), Expect = 0.0, Method: Compositional matrix adjust. Identities = 427/428 (99%), Positives = 428/428 (100%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 26 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 85 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 86 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 145 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV Sbjct 146 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 205 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI Sbjct 206 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 265 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 266 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 325 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 326 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 385 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVY+ASL Sbjct 386 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYRASL 445 Query 490 SLIEKYFS 497 SLIEKYFS Sbjct 446 SLIEKYFS 453
> 4wv6_A A Importin subunit alpha-1
Length=471 Score = 871 bits (2251), Expect = 0.0, Method: Compositional matrix adjust. Identities = 426/426 (100%), Positives = 426/426 (100%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT Sbjct 14 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 73 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 74 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 133 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ Sbjct 134 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 193 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT Sbjct 194 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 253 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 254 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 313 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA Sbjct 314 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 373 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL Sbjct 374 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 433 Query 492 IEKYFS 497 IEKYFS Sbjct 434 IEKYFS 439
> 3fey_C C Importin subunit alpha-2
Length=467 Score = 871 bits (2251), Expect = 0.0, Method: Compositional matrix adjust. Identities = 427/430 (99%), Positives = 427/430 (99%), Gaps = 0/430 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 2 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 61 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 62 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 121 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGSVFRDLVIKYGAVDPLLALLAV SSLACGYLRNLTWTLSNLCRNKNPAPPIDAV Sbjct 122 AGDGSVFRDLVIKYGAVDPLLALLAVXXXSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 181 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI Sbjct 182 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 241 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 242 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 301 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 302 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 361 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL Sbjct 362 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 421 Query 490 SLIEKYFSVE 499 SLIEKYFSVE Sbjct 422 SLIEKYFSVE 431
> 3wpt_B B Importin subunit alpha-1
Length=423 Score = 865 bits (2235), Expect = 0.0, Method: Compositional matrix adjust. Identities = 423/423 (100%), Positives = 423/423 (100%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS Sbjct 1 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 60 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 61 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 120 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP Sbjct 121 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 180 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL Sbjct 181 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 240 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 241 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 300 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT Sbjct 301 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 360 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK Sbjct 361 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 420 Query 495 YFS 497 YFS Sbjct 421 YFS 423
> 3wpt_A A Importin subunit alpha-1
Length=423 Score = 864 bits (2232), Expect = 0.0, Method: Compositional matrix adjust. Identities = 422/422 (100%), Positives = 422/422 (100%), Gaps = 0/422 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS Sbjct 1 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 60 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 61 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 120 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP Sbjct 121 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 180 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL Sbjct 181 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 240 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 241 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 300 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT Sbjct 301 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 360 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK Sbjct 361 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 420 Query 495 YF 496 YF Sbjct 421 YF 422
> 3fex_C C Importin subunit alpha-2
Length=467 Score = 862 bits (2226), Expect = 0.0, Method: Compositional matrix adjust. Identities = 422/427 (99%), Positives = 422/427 (99%), Gaps = 0/427 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSVDDIVKGIN NVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 2 NQGTVNWSVDDIVKGINXXNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 61 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 62 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 121 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGSVFRDLVIKYGAVDPLLALLAV SSLACGYLRNLTWTLSNLCRNKNPAPPIDAV Sbjct 122 AGDGSVFRDLVIKYGAVDPLLALLAVXXXSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 181 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI Sbjct 182 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 241 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 242 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 301 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 302 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 361 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL Sbjct 362 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 421 Query 490 SLIEKYF 496 SLIEKYF Sbjct 422 SLIEKYF 428
> 1ial_A A IMPORTIN ALPHA
Length=453 Score = 850 bits (2195), Expect = 0.0, Method: Compositional matrix adjust. Identities = 413/453 (91%), Positives = 430/453 (95%), Gaps = 0/453 (0%) Query 44 DDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKL 103 D+QMLKRRNVS NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKL Sbjct 1 DEQMLKRRNVSXXXXXXXXXXXXXXXNQGTVNWSVEDIVKGINSNNLESQLQATQAARKL 60 Query 104 LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA 163 LSREKQPPIDNIIRAGLIPKFVSFLG+TDCSPIQFESAWALTNIASGTSEQTKAVVDGGA Sbjct 61 LSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA 120 Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 IPAFISLLASPHAHISEQAVWALGNIAGDGS FRDLVIK+GA+DPLLALLAVPD+S+LAC Sbjct 121 IPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLAC 180 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 GYLRNLTWTLSNLCRNKNPAPP+DAVEQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPN Sbjct 181 GYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPN 240 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 ERI MVVK GVVPQLVKLLGA+ELPIVTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSL Sbjct 241 ERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSL 300 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLV VLSKADFKTQKEA WA+TN Sbjct 301 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITN 360 Query 404 YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM 463 YTSGGTVEQIVYLVHCGIIEPLMNLL+AKDTKII VILDAISNIFQAAEKLGETEKLSIM Sbjct 361 YTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIM 420 Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 IEECGGLDKIEALQ HENESVYKASL+LIEKYF Sbjct 421 IEECGGLDKIEALQRHENESVYKASLNLIEKYF 453
> 3tpo_A A Importin subunit alpha-2
Length=529 Score = 844 bits (2181), Expect = 0.0, Method: Compositional matrix adjust. Identities = 411/453 (91%), Positives = 428/453 (94%), Gaps = 0/453 (0%) Query 44 DDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKL 103 D+QMLKRRNVS NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKL Sbjct 44 DEQMLKRRNVSXXXXXXXXXXXXXXXNQGTVNWSVEDIVKGINSNNLESQLQATQAARKL 103 Query 104 LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA 163 LSREKQPPIDNIIRAGLIPKFVSFLG+TDCSPIQFESAWALTNIASGTSEQTKAVVDGGA Sbjct 104 LSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA 163 Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 IPAFISLLASPHAHISEQAVWALGNIAG GS FRDLVIK+GA+DPLLALLAVPD+S+LAC Sbjct 164 IPAFISLLASPHAHISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLALLAVPDLSTLAC 223 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 GYLRNLTWTLSNLCRNKNPAPP+DAVEQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPN Sbjct 224 GYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPN 283 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 ERI MVVK GVVPQLVKLLGA+ELPIVTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSL Sbjct 284 ERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSL 343 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLV VLSKADFKTQK A WA+TN Sbjct 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKAAAWAITN 403 Query 404 YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM 463 YTSGGTVEQIVYLVHCGIIEPLMNLL+AKDTKII VILDAISNIFQAAEKLGETEKLSIM Sbjct 404 YTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIM 463 Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 IEECGGLDKIEALQ HENESVYKASL+LIEKYF Sbjct 464 IEECGGLDKIEALQRHENESVYKASLNLIEKYF 496
> 5b56_B B Importin subunit alpha-1
Length=460 Score = 843 bits (2179), Expect = 0.0, Method: Compositional matrix adjust. Identities = 408/432 (94%), Positives = 424/432 (98%), Gaps = 0/432 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 2 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 61 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 62 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 121 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 122 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 181 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 182 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 241 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 242 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 301 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 302 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 361 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 362 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 421 Query 491 LIEKYFSVEEEE 502 LIEKYFSVEEEE Sbjct 422 LIEKYFSVEEEE 433
> 5b56_A A Importin subunit alpha-1
Length=460 Score = 837 bits (2162), Expect = 0.0, Method: Compositional matrix adjust. Identities = 405/429 (94%), Positives = 421/429 (98%), Gaps = 0/429 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 1 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 60 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 61 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 120 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 121 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 180 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 181 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 240 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 241 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 300 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 301 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 360 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 361 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 420 Query 490 SLIEKYFSV 498 +LIEKYFSV Sbjct 421 NLIEKYFSV 429
> 1q1s_C C Importin alpha-2 subunit
Length=466 Score = 836 bits (2160), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/429 (94%), Positives = 421/429 (98%), Gaps = 0/429 (0%) Query 69 NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL 128 +NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL Sbjct 6 SNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL 65 Query 129 GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN 188 G+TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN Sbjct 66 GKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN 125 Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA 248 IAGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DA Sbjct 126 IAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDA 185 Query 249 VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP 308 VEQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELP Sbjct 186 VEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELP 245 Query 309 IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 IVTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD Sbjct 246 IVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD 305 Query 369 QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNL 428 QIQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNL Sbjct 306 QIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNL 365 Query 429 LTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS 488 L+AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKAS Sbjct 366 LSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKAS 425 Query 489 LSLIEKYFS 497 L+LIEKYFS Sbjct 426 LNLIEKYFS 434
> 3knd_A A Importin subunit alpha-2
Length=460 Score = 836 bits (2159), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/428 (94%), Positives = 420/428 (98%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 1 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 60 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 61 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 120 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 121 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 180 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 181 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 240 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 241 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 300 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 301 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 360 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 361 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 420 Query 490 SLIEKYFS 497 +LIEKYFS Sbjct 421 NLIEKYFS 428
> 4ba3_A A IMPORTIN SUBUNIT ALPHA-2
Length=496 Score = 836 bits (2159), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/428 (94%), Positives = 420/428 (98%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 37 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 96 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 97 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 156 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 157 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 216 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 217 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 276 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 277 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 336 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 337 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 396 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 397 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 456 Query 490 SLIEKYFS 497 +LIEKYFS Sbjct 457 NLIEKYFS 464
> 5gxw_A A Importin subunit alpha-1
Length=428 Score = 836 bits (2159), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/428 (94%), Positives = 420/428 (98%), Gaps = 0/428 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 1 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 60 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 61 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 120 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 121 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 180 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 181 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 240 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 241 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 300 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 301 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 360 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 361 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 420 Query 490 SLIEKYFS 497 +LIEKYFS Sbjct 421 NLIEKYFS 428
> 1q1t_C C Importin alpha-2 subunit
Length=466 Score = 834 bits (2155), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 7 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 66 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 67 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 126 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 127 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 186 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 187 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 246 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 247 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 306 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 307 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 366 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 367 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 426 Query 490 SLIEKYF 496 +LIEKYF Sbjct 427 NLIEKYF 433
> 3btr_A C Importin subunit alpha-2
Length=427 Score = 834 bits (2155), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 70 NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 129 NQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG Sbjct 1 NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG 60 Query 130 RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 189 +TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI Sbjct 61 KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI 120 Query 190 AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV 249 AGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAV Sbjct 121 AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV 180 Query 250 EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI 309 EQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPI Sbjct 181 EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI 240 Query 310 VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 369 VTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ Sbjct 241 VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ 300 Query 370 IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL 429 IQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL Sbjct 301 IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL 360 Query 430 TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL 489 +AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL Sbjct 361 SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL 420 Query 490 SLIEKYF 496 +LIEKYF Sbjct 421 NLIEKYF 427
> 5hhg_B E Importin subunit alpha-1
Length=427 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 1 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 60 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 61 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 120 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 121 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 180 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 181 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 240 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 241 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 300 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 301 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 360 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 361 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 420 Query 491 LIEKYFS 497 LIEKYFS Sbjct 421 LIEKYFS 427
> 6iwa_B C Importin subunit alpha-1
Length=433 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 6 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 65 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 66 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 125 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 126 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 185 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 186 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 245 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 246 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 305 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 306 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 365 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 366 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 425 Query 491 LIEKYFS 497 LIEKYFS Sbjct 426 LIEKYFS 432
> 3l3q_A A Importin subunit alpha-2
Length=427 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 1 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 60 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 61 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 120 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 121 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 180 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 181 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 240 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 241 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 300 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 301 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 360 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 361 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 420 Query 491 LIEKYFS 497 LIEKYFS Sbjct 421 LIEKYFS 427
> 1pjm_B B Importin alpha-2 subunit
Length=460 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 2 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 61 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 62 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 121 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 122 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 181 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 182 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 241 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 242 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 301 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 302 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 361 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 362 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 421 Query 491 LIEKYFS 497 LIEKYFS Sbjct 422 LIEKYFS 428
> 3ve6_A A Importin subunit alpha-2
Length=426 Score = 832 bits (2150), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 1 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 60 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 61 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 120 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 121 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 180 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 181 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 240 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 241 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 300 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 301 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 360 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 361 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 420 Query 491 LIEKYF 496 LIEKYF Sbjct 421 LIEKYF 426
> 4u5n_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u5l_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u5u_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u58_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 6mjl_A B Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u5o_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u5v_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 4u5s_A A Importin subunit alpha-1
Length=426 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 1 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 60 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 61 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 120 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 121 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 180 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 181 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 240 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 241 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 300 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 301 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 360 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 361 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 420 Query 492 IEKYFS 497 IEKYFS Sbjct 421 IEKYFS 426
> 5ctt_A A Importin subunit alpha-1
Length=447 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 22 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 81 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 82 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 141 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 142 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 201 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 202 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 261 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 262 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 321 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 322 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 381 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 382 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 441 Query 492 IEKYFS 497 IEKYFS Sbjct 442 IEKYFS 447
> 6p6a_A B Importin subunit alpha-1
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 1iq1_C C IMPORTIN ALPHA-2 SUBUNIT
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 1pjn_B B Importin alpha-2 subunit
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 5wun_A A Importin subunit alpha-1
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 4oih_A A Importin subunit alpha-1
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 1ejl_C I IMPORTIN ALPHA
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 5wum_A A Importin subunit alpha-1
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 1ejy_B I IMPORTIN ALPHA
Length=460 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 3zip_A A IMPORTIN SUBUNIT ALPHA-2
Length=461 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 36 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 95 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 96 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 155 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 156 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 215 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 216 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 275 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 276 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 335 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 336 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 395 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 396 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 455 Query 492 IEKYFS 497 IEKYFS Sbjct 456 IEKYFS 461
> 3ziq_A A IMPORTIN SUBUNIT ALPHA-2
Length=461 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 36 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 95 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 96 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 155 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 156 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 215 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 216 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 275 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 276 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 335 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 336 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 395 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 396 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 455 Query 492 IEKYFS 497 IEKYFS Sbjct 456 IEKYFS 461
> 3zio_A A IMPORTIN SUBUNIT ALPHA-2
Length=461 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 36 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 95 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 96 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 155 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 156 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 215 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 216 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 275 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 276 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 335 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 336 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 395 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 396 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 455 Query 492 IEKYFS 497 IEKYFS Sbjct 456 IEKYFS 461
> 3zin_A A IMPORTIN SUBUNIT ALPHA-2
Length=461 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 36 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 95 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 96 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 155 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 156 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 215 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 216 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 275 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 276 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 335 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 336 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 395 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 396 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 455 Query 492 IEKYFS 497 IEKYFS Sbjct 456 IEKYFS 461
> 3zir_A A IMPORTIN SUBUNIT ALPHA-2
Length=461 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 36 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 95 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 96 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 155 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 156 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 215 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 216 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 275 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 276 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 335 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 336 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 395 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 396 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 455 Query 492 IEKYFS 497 IEKYFS Sbjct 456 IEKYFS 461
> 4mz5_C E Importin subunit alpha-1
Length=509 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 4htv_A A Importin subunit alpha-2
Length=509 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 5fc8_B E Importin subunit alpha-1
Length=510 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 3uky_A B Importin subunit alpha-2
Length=510 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 3ukz_A B Importin subunit alpha-2
Length=510 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 3rzx_A A Importin subunit alpha-2
Length=510 Score = 834 bits (2154), Expect = 0.0, Method: Compositional matrix adjust. Identities = 403/427 (94%), Positives = 419/427 (98%), Gaps = 0/427 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYFS 497 LIEKYFS Sbjct 472 LIEKYFS 478
> 4u54_A A Importin subunit alpha-1
Length=425 Score = 829 bits (2141), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 74 VNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDC 133 VNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDC Sbjct 1 VNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDC 60 Query 134 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG 193 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG Sbjct 61 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG 120 Query 194 SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL 253 S FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQIL Sbjct 121 SAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQIL 180 Query 254 PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA 313 PTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPA Sbjct 181 PTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPA 240 Query 314 LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV 373 LRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV Sbjct 241 LRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV 300 Query 374 VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD 433 VNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKD Sbjct 301 VNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKD 360 Query 434 TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIE 493 TKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIE Sbjct 361 TKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIE 420 Query 494 KYFSV 498 KYFSV Sbjct 421 KYFSV 425
> 3ul0_A B Importin subunit alpha-2
Length=510 Score = 832 bits (2150), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 71 QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR 130 QGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+ Sbjct 52 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGK 111 Query 131 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA Sbjct 112 TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 171 Query 191 GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE 250 GDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVE Sbjct 172 GDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVE 231 Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 QILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIV Sbjct 232 QILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIV 291 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 TPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI Sbjct 292 TPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 351 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 QQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+ Sbjct 352 QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS 411 Query 431 AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+ Sbjct 412 AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLN 471 Query 491 LIEKYF 496 LIEKYF Sbjct 472 LIEKYF 477
> 2ynr_A A IMPORTIN SUBUNIT ALPHA
Length=461 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 37 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 96 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 97 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 156 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 157 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 216 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 217 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 276 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 277 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 336 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 337 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 396 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 397 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 456 Query 492 IEKYF 496 IEKYF Sbjct 457 IEKYF 461
> 5umz_A B Importin subunit alpha-1
Length=509 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 4mz6_C E Importin subunit alpha-1
Length=509 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 6bvt_A E Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5u5p_C A Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5klr_A B Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 3ukx_A B Importin subunit alpha-2
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5u5r_A A Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 3ukw_A B Importin subunit alpha-2
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5svz_A A Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 3ul1_A B Importin subunit alpha-2
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5klt_A B Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 5w41_A A Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 6bw0_B E Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 6bw1_B E Importin subunit alpha-1
Length=510 Score = 832 bits (2149), Expect = 0.0, Method: Compositional matrix adjust. Identities = 402/426 (94%), Positives = 418/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYFS 497 IEKYFS Sbjct 473 IEKYFS 478
> 4uaf_A B Importin subunit alpha-1
Length=466 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 9 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 68 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 69 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 128 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 129 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 188 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 189 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 248 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 249 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 308 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 309 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 368 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 369 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 428 Query 492 IEKYF 496 IEKYF Sbjct 429 IEKYF 433
> 4yi0_A C Importin subunit alpha-1
Length=460 Score = 830 bits (2143), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 73 TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD 132 TVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TD Sbjct 4 TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTD 63 Query 133 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 192 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD Sbjct 64 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 123 Query 193 GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI 252 GS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQI Sbjct 124 GSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQI 183 Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTP Sbjct 184 LPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTP 243 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 ALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ Sbjct 244 ALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 303 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 VVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AK Sbjct 304 VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAK 363 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 DTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LI Sbjct 364 DTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLI 423 Query 493 EKYFS 497 EKYFS Sbjct 424 EKYFS 428
> 5x8n_A A Importin subunit alpha-1
Length=460 Score = 830 bits (2143), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 73 TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD 132 TVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TD Sbjct 4 TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTD 63 Query 133 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 192 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD Sbjct 64 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 123 Query 193 GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI 252 GS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQI Sbjct 124 GSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQI 183 Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTP Sbjct 184 LPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTP 243 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 ALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ Sbjct 244 ALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 303 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 VVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AK Sbjct 304 VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAK 363 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 DTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LI Sbjct 364 DTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLI 423 Query 493 EKYFS 497 EKYFS Sbjct 424 EKYFS 428
> 2c1m_A A IMPORTIN-ALPHA2 SUBUNIT
Length=424 Score = 828 bits (2139), Expect = 0.0, Method: Compositional matrix adjust. Identities = 400/424 (94%), Positives = 416/424 (98%), Gaps = 0/424 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 1 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 60 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 61 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 120 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 121 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 180 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 181 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 240 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 241 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 300 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 301 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 360 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 361 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 420 Query 495 YFSV 498 YFSV Sbjct 421 YFSV 424
> 7jk7_B B Importin subunit alpha-1
Length=470 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 11 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 70 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 71 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 130 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 131 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 190 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 191 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 250 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 251 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 310 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 311 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 370 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 371 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 430 Query 492 IEKYF 496 IEKYF Sbjct 431 IEKYF 435
> 5k9s_A A Importin subunit alpha-1
Length=458 Score = 829 bits (2141), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 74 VNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDC 133 VNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDC Sbjct 3 VNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDC 62 Query 134 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG 193 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG Sbjct 63 SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG 122 Query 194 SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL 253 S FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQIL Sbjct 123 SAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQIL 182 Query 254 PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA 313 PTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPA Sbjct 183 PTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPA 242 Query 314 LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV 373 LRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV Sbjct 243 LRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV 302 Query 374 VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD 433 VNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKD Sbjct 303 VNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKD 362 Query 434 TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIE 493 TKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIE Sbjct 363 TKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIE 422 Query 494 KYFSV 498 KYFSV Sbjct 423 KYFSV 427
> 6p6e_A A Importin subunit alpha-1
Length=460 Score = 828 bits (2139), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/426 (94%), Positives = 417/426 (98%), Gaps = 0/426 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 3 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 62 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 63 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 122 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 123 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 182 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 183 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 242 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 243 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 302 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 303 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 362 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESV KASL+L Sbjct 363 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVTKASLNL 422 Query 492 IEKYFS 497 IEKYFS Sbjct 423 IEKYFS 428
> 3uvu_B A Importin subunit alpha-2
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5w4g_A B Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 3oqs_B A Importin subunit alpha-2
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5ekg_C A Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5e6q_A B Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5ekf_C A Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 3rz9_A A Importin subunit alpha-2
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5w4f_A B Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 5w4e_A B Importin subunit alpha-1,Importin subunit alpha-1
Length=510 Score = 830 bits (2144), Expect = 0.0, Method: Compositional matrix adjust. Identities = 401/425 (94%), Positives = 417/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 1y2a_A C Importin alpha-2 Subunit
Length=428 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 6 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 65 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 66 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 125 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 126 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 185 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 186 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 245 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 246 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 305 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 306 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 365 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 366 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 425 Query 495 YFS 497 YFS Sbjct 426 YFS 428
> 5d5k_A C Importin subunit alpha-1
Length=466 Score = 828 bits (2138), Expect = 0.0, Method: Compositional matrix adjust. Identities = 400/424 (94%), Positives = 416/424 (98%), Gaps = 0/424 (0%) Query 73 TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD 132 TVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TD Sbjct 10 TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTD 69 Query 133 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 192 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD Sbjct 70 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 129 Query 193 GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI 252 GS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQI Sbjct 130 GSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQI 189 Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTP Sbjct 190 LPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTP 249 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 ALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ Sbjct 250 ALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 309 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 VVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AK Sbjct 310 VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAK 369 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 DTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LI Sbjct 370 DTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLI 429 Query 493 EKYF 496 EKYF Sbjct 430 EKYF 433
> 3q5u_A A Importin subunit alpha-2
Length=460 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 6 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 65 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 66 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 125 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 126 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 185 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 186 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 245 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 246 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 305 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 306 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 365 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 366 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 425 Query 495 YFS 497 YFS Sbjct 426 YFS 428
> 3tpm_A A Importin subunit alpha-2
Length=422 Score = 825 bits (2130), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/422 (94%), Positives = 414/422 (98%), Gaps = 0/422 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 1 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 60 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 61 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 120 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 121 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 180 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 181 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 240 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 241 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 300 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 301 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 360 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 361 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 420 Query 495 YF 496 YF Sbjct 421 YF 422
> 6iua_A A Importin subunit alpha-1
Length=427 Score = 825 bits (2130), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/422 (94%), Positives = 414/422 (98%), Gaps = 0/422 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 4 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 63 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 64 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 123 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 124 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 183 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 184 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 243 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 244 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 303 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 304 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 363 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 364 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 423 Query 495 YF 496 YF Sbjct 424 YF 425
> 6iu7_A A Importin subunit alpha-1
Length=427 Score = 825 bits (2130), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/422 (94%), Positives = 414/422 (98%), Gaps = 0/422 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 4 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 63 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 64 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 123 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 124 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 183 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 184 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 243 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 244 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 303 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 304 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 363 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 364 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 423 Query 495 YF 496 YF Sbjct 424 YF 425
> 6k06_B C Importin subunit alpha-1
Length=433 Score = 825 bits (2130), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/422 (94%), Positives = 414/422 (98%), Gaps = 0/422 (0%) Query 76 WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSP 135 WSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCSP Sbjct 11 WSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSP 70 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 71 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSA 130 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILPT Sbjct 131 FRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPT 190 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPALR Sbjct 191 LVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALR 250 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 AIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN Sbjct 251 AIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 310 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 HGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDTK Sbjct 311 HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTK 370 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 II VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEKY Sbjct 371 IIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKY 430 Query 496 FS 497 FS Sbjct 431 FS 432
> 7jjm_B B Importin subunit alpha-1
Length=470 Score = 825 bits (2130), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/422 (94%), Positives = 414/422 (98%), Gaps = 0/422 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 14 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 73 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 74 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 133 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 134 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 193 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 194 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 253 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 254 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 313 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 314 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 373 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 374 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 433 Query 495 YF 496 YF Sbjct 434 YF 435
> 5v5p_A C Importin subunit alpha-1
Length=528 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 74 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 133 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 134 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 193 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 194 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 253 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 254 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 313 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 314 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 373 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 374 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 433 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 434 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 493 Query 495 YFS 497 YFS Sbjct 494 YFS 496
> 5v5o_A C Importin subunit alpha-1
Length=528 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 74 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 133 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 134 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 193 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 194 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 253 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 254 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 313 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 314 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 373 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 374 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 433 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 434 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 493 Query 495 YFS 497 YFS Sbjct 494 YFS 496
> 5huy_A C Importin subunit alpha-1
Length=528 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 74 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 133 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 134 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 193 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 194 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 253 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 254 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 313 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 314 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 373 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 374 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 433 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 434 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 493 Query 495 YFS 497 YFS Sbjct 494 YFS 496
> 5huw_A C Importin subunit alpha-1
Length=528 Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/423 (94%), Positives = 415/423 (98%), Gaps = 0/423 (0%) Query 75 NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCS 134 NWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCS Sbjct 74 NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCS 133 Query 135 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 194 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 134 PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS 193 Query 195 VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP 254 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILP Sbjct 194 AFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILP 253 Query 255 TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL 314 TLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPAL Sbjct 254 TLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPAL 313 Query 315 RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 374 RAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV Sbjct 314 RAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV 373 Query 375 NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT 434 NHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDT Sbjct 374 NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDT 433 Query 435 KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 KII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEK Sbjct 434 KIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEK 493 Query 495 YFS 497 YFS Sbjct 494 YFS 496
> 6d7n_A B Peroxidase,Importin subunit alpha-1
Length=510 Score = 821 bits (2120), Expect = 0.0, Method: Compositional matrix adjust. Identities = 399/425 (94%), Positives = 415/425 (98%), Gaps = 0/425 (0%) Query 72 GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT 131 GTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+T Sbjct 53 GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKT 112 Query 132 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 191 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG Sbjct 113 DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG 172 Query 192 DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ 251 DGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQ Sbjct 173 DGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQ 232 Query 252 ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 ILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVT Sbjct 233 ILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT 292 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 PALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEAT TMSNITAGRQDQIQ Sbjct 293 PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATRTMSNITAGRQDQIQ 352 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 QVVNHGLVPFLV VLSKADFKTQKEA A+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+A Sbjct 353 QVVNHGLVPFLVGVLSKADFKTQKEAARAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSA 412 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 KDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+L Sbjct 413 KDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNL 472 Query 492 IEKYF 496 IEKYF Sbjct 473 IEKYF 477
> 6iw8_B C Importin subunit alpha-1
Length=433 Score = 816 bits (2109), Expect = 0.0, Method: Compositional matrix adjust. Identities = 395/422 (94%), Positives = 411/422 (97%), Gaps = 0/422 (0%) Query 76 WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSP 135 WSV+DIVKGINS+ +E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TDCSP Sbjct 11 WSVEDIVKGINSNXLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSP 70 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 71 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSA 130 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRN NPAPP+DAVEQILPT Sbjct 131 FRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNXNPAPPLDAVEQILPT 190 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPALR Sbjct 191 LVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALR 250 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 AIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN Sbjct 251 AIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 310 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 HGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDTK Sbjct 311 HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTK 370 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 II VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ H NESVYKASL+LIEKY Sbjct 371 IIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHXNESVYKASLNLIEKY 430 Query 496 FS 497 FS Sbjct 431 FS 432
> 6d7m_A B Peroxidase,Importin subunit alpha-1
Length=510 Score = 818 bits (2114), Expect = 0.0, Method: Compositional matrix adjust. Identities = 398/424 (94%), Positives = 414/424 (98%), Gaps = 0/424 (0%) Query 73 TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD 132 TVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG+TD Sbjct 54 TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTD 113 Query 133 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD 192 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV ALGNIAGD Sbjct 114 CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVRALGNIAGD 173 Query 193 GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI 252 GS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLT TLSNLCRNKNPAPP+DAVEQI Sbjct 174 GSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTRTLSNLCRNKNPAPPLDAVEQI 233 Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTP Sbjct 234 LPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTP 293 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 ALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ Sbjct 294 ALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 353 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 VVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AK Sbjct 354 VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAK 413 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 DTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LI Sbjct 414 DTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLI 473 Query 493 EKYF 496 EKYF Sbjct 474 EKYF 477
> 4zdu_A A Importin subunit alpha-1
Length=428 Score = 808 bits (2086), Expect = 0.0, Method: Compositional matrix adjust. Identities = 392/421 (93%), Positives = 408/421 (97%), Gaps = 0/421 (0%) Query 76 WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSP 135 WSV+DIVKGINS+N+E+QLQATQAARKLLS PIDNIIRAGLIPKFVSFLG+TDCSP Sbjct 6 WSVEDIVKGINSNNLESQLQATQAARKLLSXXXXXPIDNIIRAGLIPKFVSFLGKTDCSP 65 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS Sbjct 66 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSA 125 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNKNPAPP+DAVEQILPT Sbjct 126 FRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPT 185 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVKLLGA+ELPIVTPALR Sbjct 186 LVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALR 245 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 AIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN Sbjct 246 AIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 305 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 HGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCGIIEPLMNLL+AKDTK Sbjct 306 HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTK 365 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 II VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HENESVYKASL+LIEKY Sbjct 366 IIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKY 425 Query 496 F 496 F Sbjct 426 F 426
> 4uae_A A Importin subunit alpha-3
Length=421 Score = 470 bits (1210), Expect = 1e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 6 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 65 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 66 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 125 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 126 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 181 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 182 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 241 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 242 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 301 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 302 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 361 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 362 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 419 Query 497 S 497 S Sbjct 420 S 420
> 5xzx_A A Importin subunit alpha-3
Length=416 Score = 468 bits (1205), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 225/420 (54%), Positives = 301/420 (72%), Gaps = 6/420 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 3 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 62 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 63 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 122 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 123 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 178 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 179 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 238 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 239 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 298 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 299 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 358 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 359 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 416
> 6bwb_A A Importin subunit alpha-3
Length=459 Score = 470 bits (1210), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 10 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 69 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 70 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 129 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 130 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 185 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 186 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 245 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 246 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 305 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 306 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 365 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 366 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 423 Query 497 S 497 S Sbjct 424 S 424
> 6bwa_A A Importin subunit alpha-3
Length=459 Score = 470 bits (1210), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 10 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 69 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 70 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 129 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 130 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 185 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 186 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 245 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 246 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 305 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 306 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 365 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 366 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 423 Query 497 S 497 S Sbjct 424 S 424
> 6bw9_A A Importin subunit alpha-3
Length=459 Score = 470 bits (1210), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 10 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 69 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 70 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 129 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 130 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 185 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 186 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 245 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 246 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 305 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 306 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 365 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 366 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 423 Query 497 S 497 S Sbjct 424 S 424
> 6bvv_A A Importin subunit alpha-3
Length=459 Score = 470 bits (1210), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 10 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 69 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 70 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 129 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 130 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 185 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 186 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 245 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 246 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 305 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 306 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 365 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 366 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 423 Query 497 S 497 S Sbjct 424 S 424
> 6bvz_A A Importin subunit alpha-3
Length=459 Score = 470 bits (1209), Expect = 5e-160, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 10 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 69 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 70 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 129 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 130 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 185 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 186 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 245 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 246 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 305 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 306 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 365 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 366 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 423 Query 497 S 497 S Sbjct 424 S 424
> 5tbk_C C Importin subunit alpha-3
Length=521 Score = 470 bits (1210), Expect = 3e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_G G Importin subunit alpha-3
Length=521 Score = 470 bits (1210), Expect = 3e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_A A Importin subunit alpha-3
Length=521 Score = 470 bits (1210), Expect = 3e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_H H Importin subunit alpha-3
Length=521 Score = 470 bits (1210), Expect = 3e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_D D Importin subunit alpha-3
Length=521 Score = 470 bits (1209), Expect = 4e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_B B Importin subunit alpha-3
Length=521 Score = 470 bits (1209), Expect = 4e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_E E Importin subunit alpha-3
Length=521 Score = 470 bits (1209), Expect = 4e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 5tbk_F F Importin subunit alpha-3
Length=521 Score = 470 bits (1209), Expect = 4e-159, Method: Compositional matrix adjust. Identities = 226/421 (54%), Positives = 302/421 (72%), Gaps = 6/421 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 72 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 131 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 132 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 191 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 192 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 247 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 248 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 307 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 308 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 367 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 368 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 427 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I+++F Sbjct 428 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF 485 Query 497 S 497 S Sbjct 486 S 486
> 7jjl_A A Importin subunit alpha-3
Length=465 Score = 464 bits (1194), Expect = 1e-157, Method: Compositional matrix adjust. Identities = 224/418 (54%), Positives = 299/418 (72%), Gaps = 6/418 (1%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S++ IV+ +S N QL A QAARKLLS ++ PPID++I++G++P V L R D + Sbjct 16 SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSL 75 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSEQT+AVV A+P F+ LL SPH ++ EQAVWALGNI GDG Sbjct 76 QFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQC 135 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RD VI G V PLL+ ++ S+ +LRN+TW + NLCR+K+P PP++ +++ILP L Sbjct 136 RDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPAL 191 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 L+HH D +L DT WA+SYLTD NE+I MV+ +G+VP LV LL E+ + T ALRA Sbjct 192 CVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRA 251 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH 376 +GNIVTGTDEQTQVV++ AL+ FP+LLT+PK I KEA W +SNITAG Q Q+Q V++ Sbjct 252 VGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA 311 Query 377 GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 LVP ++ +L K DF TQKEA WA++N T G +Q+ YL+ +I P NLLT KD ++ Sbjct 312 NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQV 371 Query 437 ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK 494 + V+LD +SNI + AE E E + +IEECGGL+KIE LQNHENE +YK + +I++ Sbjct 372 VQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQ 427
> 4uad_A A Importin subunit alpha-7
Length=479 Score = 422 bits (1084), Expect = 8e-141, Method: Compositional matrix adjust. Identities = 216/425 (51%), Positives = 286/425 (67%), Gaps = 10/425 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 ++V+ + S + + QL TQ RKLLS+E PPID +I ++ +FV FL R + +QF Sbjct 27 EMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQF 86 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 E+AWALTNIASGTS+QTK V++ GA+P FI LL S + EQAVWALGNIAGD SV RD Sbjct 87 EAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRD 146 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ ++PLL LL S RN W LSNLCR KNP P V LP L R Sbjct 147 YVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSR 202 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D ++LAD CWA+SYL+DGPNE+I V+ +GV +LV+LL ++ + +PALRA+G Sbjct 203 LLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVG 262 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 263 NIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANI 322 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV G I+PL +LLT D+KI+ Sbjct 323 FPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQ 382 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ G+ + +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 383 VALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 442 Query 494 KYFSV 498 YF V Sbjct 443 HYFGV 447
> 1wa5_B B IMPORTIN ALPHA SUBUNIT
Length=530 Score = 416 bits (1070), Expect = 4e-138, Method: Compositional matrix adjust. Identities = 223/489 (46%), Positives = 302/489 (62%), Gaps = 18/489 (4%) Query 26 EMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVN------WSVD 79 E+RRRR VELRKAK+D+ + KRRN + Sbjct 31 ELRRRRDTQQVELRKAKRDEALAKRRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXQELP 90 Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFE 139 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E Sbjct 91 QMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLE 150 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 +AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD Sbjct 151 AAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDY 210 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 V++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L Sbjct 211 VLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKL 265 Query 260 LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN 319 ++ D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GN Sbjct 266 IYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGN 325 Query 320 IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 IVTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+ Sbjct 326 IVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLI 385 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKII 437 P LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 386 PPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRII 445 Query 438 LVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLI 492 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +I Sbjct 446 EVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKII 505 Query 493 EKYFSVEEE 501 E YF EE+ Sbjct 506 ETYFGEEED 514
> 4bqk_A A IMPORTIN SUBUNIT ALPHA-1A
Length=456 Score = 407 bits (1045), Expect = 3e-135, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 3 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 62 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 63 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 122 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 123 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 177 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 178 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 237 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 238 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 297 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 298 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 357 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 358 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 413 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 414 KAVKILEAYW 423
> 4bpl_A A IMPORTIN SUBUNIT ALPHA-1A
Length=454 Score = 406 bits (1044), Expect = 3e-135, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 1 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 60 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 61 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 120 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 121 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 175 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 176 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 235 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 236 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 295 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 296 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 355 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 356 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 411 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 412 KAVKILEAYW 421
> 4bqk_B B IMPORTIN SUBUNIT ALPHA-1A
Length=456 Score = 406 bits (1044), Expect = 4e-135, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 3 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 62 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 63 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 122 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 123 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 177 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 178 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 237 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 238 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 297 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 298 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 357 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 358 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 413 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 414 KAVKILEAYW 423
> 4b8o_A A IMPORTIN SUBUNIT ALPHA-1A
Length=490 Score = 406 bits (1044), Expect = 1e-134, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 37 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 96 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 97 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 156 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 157 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 211 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 212 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 271 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 272 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 331 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 332 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 391 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 392 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 447 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 448 KAVKILEAYW 457
> 2yns_B B IMPORTIN SUBUNIT ALPHA-1A
Length=490 Score = 406 bits (1044), Expect = 1e-134, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 37 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 96 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 97 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 156 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 157 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 211 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 212 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 271 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 272 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 331 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 332 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 391 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 392 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 447 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 448 KAVKILEAYW 457
> 2yns_A A IMPORTIN SUBUNIT ALPHA-1A
Length=490 Score = 406 bits (1044), Expect = 1e-134, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 37 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 96 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 97 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 156 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 157 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 211 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 212 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 271 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 272 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 331 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 332 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 391 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 392 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 447 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 448 KAVKILEAYW 457
> 4b8j_A A IMPORTIN SUBUNIT ALPHA-1A
Length=528 Score = 407 bits (1046), Expect = 2e-134, Method: Compositional matrix adjust. Identities = 215/430 (50%), Positives = 288/430 (67%), Gaps = 19/430 (4%) Query 77 SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI 136 S+ ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D + Sbjct 75 SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQL 134 Query 137 QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF 196 QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD Sbjct 135 QFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKC 194 Query 197 RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL 256 RDLV+ GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L Sbjct 195 RDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPAL 249 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 RL+H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR Sbjct 250 ARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRT 309 Query 317 IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNIVTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N Sbjct 310 VGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN 369 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G++ LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D + Sbjct 370 AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIR 429 Query 436 IILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYK 486 I+ V L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ Sbjct 430 IVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYE 485 Query 487 ASLSLIEKYF 496 ++ ++E Y+ Sbjct 486 KAVKILEAYW 495
> 4b8p_A A IMPORTIN SUBUNIT ALPHA-1A
Length=490 Score = 406 bits (1043), Expect = 2e-134, Method: Compositional matrix adjust. Identities = 214/426 (50%), Positives = 286/426 (67%), Gaps = 19/426 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D +QFE+ Sbjct 41 MIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEA 100 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD RDLV Sbjct 101 AWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLV 160 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 + GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L RL+ Sbjct 161 LANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLI 215 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR +GNI Sbjct 216 HSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNI 275 Query 321 VTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 VTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N G++ Sbjct 276 VTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVINAGII 335 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV 439 LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D +I+ V Sbjct 336 GPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTV 395 Query 440 ILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYKASLS 490 L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ ++ Sbjct 396 CLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYEKAVK 451 Query 491 LIEKYF 496 ++E Y+ Sbjct 452 ILEAYW 457
> 4b8p_B B IMPORTIN SUBUNIT ALPHA-1A
Length=490 Score = 406 bits (1043), Expect = 2e-134, Method: Compositional matrix adjust. Identities = 214/426 (50%), Positives = 286/426 (67%), Gaps = 19/426 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 ++ G+ S + QL+AT RKLLS E+ PPI+ +I++G++P+FV FL R D +QFE+ Sbjct 41 MIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEA 100 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTSE TK V+D GA+P F+ LL S + EQAVWALGN+AGD RDLV Sbjct 101 AWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLV 160 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 + GA+ PLLA L S+ LRN TWTLSN CR K P P + LP L RL+ Sbjct 161 LANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLI 215 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 H +D EVL D CWA+SYL+DG N++I V++ GV P+LV+LL ++ PALR +GNI Sbjct 216 HSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNI 275 Query 321 VTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 VTG D QTQ +ID AL SLLT N K +I+KEA WT+SNITAG +DQIQ V+N G++ Sbjct 276 VTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVINAGII 335 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV 439 LV++L A+F +KEA WA++N TSGG+ +QI YLV G I+PL +LL D +I+ V Sbjct 336 GPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTV 395 Query 440 ILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKIEALQNHENESVYKASLS 490 L+ + NI K+GET+K S MI+E GL+KIE LQ+H+N +Y+ ++ Sbjct 396 CLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYEKAVK 451 Query 491 LIEKYF 496 ++E Y+ Sbjct 452 ILEAYW 457
> 2jdq_B B IMPORTIN ALPHA-1 SUBUNIT
Length=450 Score = 403 bits (1036), Expect = 4e-134, Method: Compositional matrix adjust. Identities = 212/428 (50%), Positives = 285/428 (67%), Gaps = 10/428 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 D+++ I S + E QL ATQ RKLLS+E PPID +I G++ +FV FL R + +QF Sbjct 24 DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF 83 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 ESAW LTNIASG S QT+ V+ GA+P FI LL+S + EQAVWALGNIAGD ++ RD Sbjct 84 ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRD 143 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ + PLL L + + ++ RN W LSNLCR K+P P V L L Sbjct 144 YVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSW 199 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D +VLAD CWA+SYL+DGPN++I V+ GV +LV+LL ++ +V+PALRA+G Sbjct 200 LLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVG 259 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 260 NIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI 319 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+S+L A+F+T+KEA WA+TN TSGG+ EQI YLV G I+PL +LLT D+KI+ Sbjct 320 FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQ 379 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 380 VALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 439 Query 494 KYFSVEEE 501 YF E+E Sbjct 440 HYFGTEDE 447
> 2jdq_A A IMPORTIN ALPHA-1 SUBUNIT
Length=450 Score = 401 bits (1031), Expect = 3e-133, Method: Compositional matrix adjust. Identities = 211/426 (50%), Positives = 283/426 (66%), Gaps = 10/426 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 D+++ I S + E QL ATQ RKLLS+E PPID +I G++ +FV FL R + +QF Sbjct 24 DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF 83 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 ESAW LTNIASG S QT+ V+ GA+P FI LL+S + EQAVWALGNIAGD ++ RD Sbjct 84 ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRD 143 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ + PLL L + + ++ RN W LSNLCR K+P P V L L Sbjct 144 YVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSW 199 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D +VLAD CWA+SYL+DGPN++I V+ GV +LV+LL ++ +V+PALRA+G Sbjct 200 LLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVG 259 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 260 NIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI 319 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+S+L A+F+T+KEA WA+TN TSGG+ EQI YLV G I+PL +LLT D+KI+ Sbjct 320 FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQ 379 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 380 VALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 439 Query 494 KYFSVE 499 YF E Sbjct 440 HYFGTE 445
> 3tj3_C B Importin subunit alpha-1
Length=447 Score = 401 bits (1030), Expect = 3e-133, Method: Compositional matrix adjust. Identities = 211/426 (50%), Positives = 283/426 (66%), Gaps = 10/426 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 D+++ I S + E QL ATQ RKLLS+E PPID +I G++ +FV FL R + +QF Sbjct 21 DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF 80 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 ESAW LTNIASG S QT+ V+ GA+P FI LL+S + EQAVWALGNIAGD ++ RD Sbjct 81 ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRD 140 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ + PLL L + + ++ RN W LSNLCR K+P P V L L Sbjct 141 YVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSW 196 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D +VLAD CWA+SYL+DGPN++I V+ GV +LV+LL ++ +V+PALRA+G Sbjct 197 LLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVG 256 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 257 NIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI 316 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+S+L A+F+T+KEA WA+TN TSGG+ EQI YLV G I+PL +LLT D+KI+ Sbjct 317 FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQ 376 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 377 VALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 436 Query 494 KYFSVE 499 YF E Sbjct 437 HYFGTE 442
> 3tj3_A A Importin subunit alpha-1
Length=447 Score = 401 bits (1030), Expect = 3e-133, Method: Compositional matrix adjust. Identities = 211/426 (50%), Positives = 283/426 (66%), Gaps = 10/426 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 D+++ I S + E QL ATQ RKLLS+E PPID +I G++ +FV FL R + +QF Sbjct 21 DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF 80 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 ESAW LTNIASG S QT+ V+ GA+P FI LL+S + EQAVWALGNIAGD ++ RD Sbjct 81 ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRD 140 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ + PLL L + + ++ RN W LSNLCR K+P P V L L Sbjct 141 YVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSW 196 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D +VLAD CWA+SYL+DGPN++I V+ GV +LV+LL ++ +V+PALRA+G Sbjct 197 LLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVG 256 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 257 NIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI 316 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+S+L A+F+T+KEA WA+TN TSGG+ EQI YLV G I+PL +LLT D+KI+ Sbjct 317 FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQ 376 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 377 VALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 436 Query 494 KYFSVE 499 YF E Sbjct 437 HYFGTE 442
> 4rxh_A B Importin subunit alpha
Length=495 Score = 401 bits (1030), Expect = 2e-132, Method: Compositional matrix adjust. Identities = 209/427 (49%), Positives = 284/427 (67%), Gaps = 15/427 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 +V+G+ SS ++ Q+QAT RKLLS+E+ PPI+ +I+ G++ +FV FL R+ + +QFE+ Sbjct 33 MVEGVFSSEIDKQIQATTKFRKLLSKERNPPIEEVIKTGVVGRFVEFL-RSPHTLVQFEA 91 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASG++ QT+ V++ GA+P F+ LL SP + EQAVWALGNIAGD RD V Sbjct 92 AWALTNIASGSATQTQVVIEAGAVPIFVELLGSPEPDVREQAVWALGNIAGDSPQCRDYV 151 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 + GA+ PLL LL S LRN TWTLSN CR K P P + + LP L +L+ Sbjct 152 LSCGALRPLLTLLG----DSRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLV 207 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D EVL D CWAISYL+DG N++I V++ G+ +LV+LL + + TPALR++GNI Sbjct 208 YSLDDEVLIDACWAISYLSDGSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNI 267 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQV+I+ GAL SLL++ K I+KEA WT+SNITAG QIQ V++ ++P Sbjct 268 VTGDDVQTQVIINCGALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQSVIDANIIP 327 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 L+ +LS AD KT+KEA WA++N TSGG +QI YLV G I+PL +LL D KII Sbjct 328 PLIHLLSHADLKTRKEACWAISNATSGGLQKPDQIRYLVAQGCIKPLCDLLACPDNKIIQ 387 Query 439 VILDAISNIFQAAE--------KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 V LD + NI + E + ++ IEECGG++KI Q + NE +Y + + Sbjct 388 VALDGLENILKVGELDKNAAXXXXXSINRYALFIEECGGMEKIHDCQTNANEEIYMKAYN 447 Query 491 LIEKYFS 497 +IEKYFS Sbjct 448 IIEKYFS 454
> 5vqi_A B Importin subunit alpha
Length=495 Score = 401 bits (1030), Expect = 2e-132, Method: Compositional matrix adjust. Identities = 209/427 (49%), Positives = 284/427 (67%), Gaps = 15/427 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 +V+G+ SS ++ Q+QAT RKLLS+E+ PPI+ +I+ G++ +FV FL R+ + +QFE+ Sbjct 33 MVEGVFSSEIDKQIQATTKFRKLLSKERNPPIEEVIKTGVVGRFVEFL-RSPHTLVQFEA 91 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASG++ QT+ V++ GA+P F+ LL SP + EQAVWALGNIAGD RD V Sbjct 92 AWALTNIASGSATQTQVVIEAGAVPIFVELLGSPEPDVREQAVWALGNIAGDSPQCRDYV 151 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 + GA+ PLL LL S LRN TWTLSN CR K P P + + LP L +L+ Sbjct 152 LSCGALRPLLTLLG----DSRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLV 207 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D EVL D CWAISYL+DG N++I V++ G+ +LV+LL + + TPALR++GNI Sbjct 208 YSLDDEVLIDACWAISYLSDGSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNI 267 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQV+I+ GAL SLL++ K I+KEA WT+SNITAG QIQ V++ ++P Sbjct 268 VTGDDVQTQVIINCGALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQSVIDANIIP 327 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 L+ +LS AD KT+KEA WA++N TSGG +QI YLV G I+PL +LL D KII Sbjct 328 PLIHLLSHADLKTRKEACWAISNATSGGLQKPDQIRYLVAQGCIKPLCDLLACPDNKIIQ 387 Query 439 VILDAISNIFQAAE--------KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS 490 V LD + NI + E + ++ IEECGG++KI Q + NE +Y + + Sbjct 388 VALDGLENILKVGELDKNAAXXXXXSINRYALFIEECGGMEKIHDCQTNANEEIYMKAYN 447 Query 491 LIEKYFS 497 +IEKYFS Sbjct 448 IIEKYFS 454
> 4b18_A A IMPORTIN SUBUNIT ALPHA-1
Length=447 Score = 399 bits (1024), Expect = 3e-132, Method: Compositional matrix adjust. Identities = 210/423 (50%), Positives = 282/423 (67%), Gaps = 10/423 (2%) Query 80 DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQF 138 D+++ I S + E QL ATQ RKLLS+E PPID +I G++ +FV FL R + +QF Sbjct 21 DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF 80 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 ESAW LTNIASG S QT+ V+ GA+P FI LL+S + EQAVWALGNIAGD ++ RD Sbjct 81 ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRD 140 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR 258 V+ + PLL L + + ++ RN W LSNLCR K+P P V L L Sbjct 141 YVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSW 196 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG 318 LL D +VLAD CWA+SYL+DGPN++I V+ GV +LV+LL ++ +V+PALRA+G Sbjct 197 LLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVG 256 Query 319 NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL 378 NIVTG D QTQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + Sbjct 257 NIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI 316 Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 P L+S+L A+F+T+KEA WA+TN TSGG+ EQI YLV G I+PL +LLT D+KI+ Sbjct 317 FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQ 376 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V L+ + NI + E+ + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE Sbjct 377 VALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIE 436 Query 494 KYF 496 YF Sbjct 437 HYF 439
> 1un0_A A IMPORTIN ALPHA SUBUNIT
Length=443 Score = 396 bits (1018), Expect = 2e-131, Method: Compositional matrix adjust. Identities = 208/437 (48%), Positives = 284/437 (65%), Gaps = 13/437 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYFSVEEEE-DQNVVPE 509 YF EE+ D+ + P+ Sbjct 420 TYFGEEEDAVDETMAPQ 436
> 1un0_B B IMPORTIN ALPHA SUBUNIT
Length=443 Score = 396 bits (1017), Expect = 3e-131, Method: Compositional matrix adjust. Identities = 208/437 (48%), Positives = 284/437 (65%), Gaps = 13/437 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYFSVEEEE-DQNVVPE 509 YF EE+ D+ + P+ Sbjct 420 TYFGEEEDAVDETMAPQ 436
> 4xzr_B B Importin subunit alpha
Length=423 Score = 394 bits (1013), Expect = 5e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 6 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 65 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 66 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 125 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 126 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 180 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 181 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 240 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 241 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 300 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 301 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 360 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 361 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 420 Query 494 KYF 496 YF Sbjct 421 TYF 423
> 4pvz_B B Importin subunit alpha
Length=422 Score = 394 bits (1013), Expect = 6e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYF 496 YF Sbjct 420 TYF 422
> 4pvz_A A Importin subunit alpha
Length=422 Score = 394 bits (1013), Expect = 6e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYF 496 YF Sbjct 420 TYF 422
> 1bk5_A A KARYOPHERIN ALPHA
Length=422 Score = 394 bits (1012), Expect = 7e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 4 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 63 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 64 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 123 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 124 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 178 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 179 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 238 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 239 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 298 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 299 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 358 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 359 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 418 Query 494 KYF 496 YF Sbjct 419 TYF 421
> 1bk5_B B KARYOPHERIN ALPHA
Length=422 Score = 394 bits (1012), Expect = 7e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 4 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 63 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 64 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 123 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 124 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 178 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 179 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 238 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 239 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 298 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 299 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 358 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 359 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 418 Query 494 KYF 496 YF Sbjct 419 TYF 421
> 1bk6_A A KARYOPHERIN ALPHA
Length=422 Score = 394 bits (1011), Expect = 8e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 4 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 63 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 64 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 123 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 124 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 178 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 179 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 238 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 239 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 298 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 299 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 358 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 359 VTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 418 Query 494 KYF 496 YF Sbjct 419 TYF 421
> 1bk6_D B KARYOPHERIN ALPHA
Length=422 Score = 394 bits (1011), Expect = 8e-131, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 4 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 63 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 64 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 123 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 124 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 178 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 179 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 238 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 239 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 298 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 299 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 358 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 359 VTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 418 Query 494 KYF 496 YF Sbjct 419 TYF 421
> 1ee4_D B KARYOPHERIN ALPHA
Length=423 Score = 392 bits (1006), Expect = 6e-130, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 276/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 6 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 65 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 66 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 125 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 126 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 180 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 181 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 240 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 241 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 300 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 301 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 360 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 361 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 420 Query 494 KYF 496 YF Sbjct 421 TYF 423
> 1ee4_A A KARYOPHERIN ALPHA
Length=423 Score = 392 bits (1006), Expect = 6e-130, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 276/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 6 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 65 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 66 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 125 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 126 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 180 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 181 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 240 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 241 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 300 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 301 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 360 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 361 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 420 Query 494 KYF 496 YF Sbjct 421 TYF 423
> 1ee5_A A KARYOPHERIN ALPHA
Length=424 Score = 391 bits (1005), Expect = 8e-130, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 276/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 6 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 65 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 66 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 125 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 126 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 180 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 181 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 240 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 241 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 300 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 301 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 360 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 361 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 420 Query 494 KYF 496 YF Sbjct 421 TYF 423
> 5h2x_A A Importin subunit alpha
Length=423 Score = 391 bits (1005), Expect = 8e-130, Method: Compositional matrix adjust. Identities = 204/427 (48%), Positives = 278/427 (65%), Gaps = 20/427 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI---------MIEECGGLDKIEALQNHENESVYKASL 489 V LDA+ NI K+GE +K + IE+ GG++KI Q +EN+ +Y+ + Sbjct 360 VTLDALENIL----KMGEADKEAXXXXXNENADFIEKAGGMEKIFNCQQNENDKIYEKAY 415 Query 490 SLIEKYF 496 +IE YF Sbjct 416 KIIETYF 422
> 5h2w_C C Importin subunit alpha
Length=423 Score = 391 bits (1004), Expect = 1e-129, Method: Compositional matrix adjust. Identities = 204/427 (48%), Positives = 277/427 (65%), Gaps = 20/427 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI---------MIEECGGLDKIEALQNHENESVYKASL 489 V LDA+ NI K+GE +K IE+ GG++KI Q +EN+ +Y+ + Sbjct 360 VTLDALENIL----KMGEADKXXXXXXXNENADFIEKAGGMEKIFNCQQNENDKIYEKAY 415 Query 490 SLIEKYF 496 +IE YF Sbjct 416 KIIETYF 422
> 5h2w_A A Importin subunit alpha
Length=423 Score = 391 bits (1004), Expect = 1e-129, Method: Compositional matrix adjust. Identities = 204/427 (48%), Positives = 278/427 (65%), Gaps = 20/427 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI---------MIEECGGLDKIEALQNHENESVYKASL 489 V LDA+ NI K+GE +K + IE+ GG++KI Q +EN+ +Y+ + Sbjct 360 VTLDALENIL----KMGEADKEAXXXXXNENADFIEKAGGMEKIFNCQQNENDKIYEKAY 415 Query 490 SLIEKYF 496 +IE YF Sbjct 416 KIIETYF 422
> 2c1t_B B IMPORTIN ALPHA SUBUNIT
Length=454 Score = 391 bits (1005), Expect = 2e-129, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 276/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYF 496 YF Sbjct 420 TYF 422
> 2c1t_A A IMPORTIN ALPHA SUBUNIT
Length=454 Score = 391 bits (1005), Expect = 2e-129, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 276/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 5 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 64 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 65 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 124 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 125 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 179 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 180 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 239 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 240 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 299 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A+ KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 300 PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 359 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 360 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 419 Query 494 KYF 496 YF Sbjct 420 TYF 422
> 5t94_B B Importin subunit alpha
Length=542 Score = 394 bits (1013), Expect = 2e-129, Method: Compositional matrix adjust. Identities = 204/423 (48%), Positives = 277/423 (65%), Gaps = 12/423 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT R++LSRE +PPID +I+AG++P+ V F+ +Q E+ Sbjct 92 MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEA 151 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTS QTK VVD A+P FI LL + + EQA+WALGN+AGD + +RD V Sbjct 152 AWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYV 211 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 ++ A++P+L L +S +R TWTLSNLCR K P P V Q LPTL +L+ Sbjct 212 LQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI 266 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 + D E L D CWAISYL+DGP E I V+ + +LV+LL + TPALRA+GNI Sbjct 267 YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI 326 Query 321 VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP 380 VTG D QTQVVI+AG L LL++PK NI+KEA WT+SNITAG +QIQ V++ L+P Sbjct 327 VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP 386 Query 381 FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 LV +L A++KT+KEA WA++N +SGG + I YLV G I+PL +LL D +II Sbjct 387 PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE 446 Query 439 VILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIE 493 V LDA+ NI + E E L+I IE+ GG++KI Q +EN+ +Y+ + +IE Sbjct 447 VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE 506 Query 494 KYF 496 YF Sbjct 507 TYF 509
> 4tnm_A A Importin subunit alpha
Length=531 Score = 385 bits (990), Expect = 4e-126, Method: Compositional matrix adjust. Identities = 200/424 (47%), Positives = 276/424 (65%), Gaps = 12/424 (3%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 +V GI +QL+AT RKLLS E+ PPI+ ++++G++P+ V FL R D +QFE+ Sbjct 80 MVAGIWXXXXXSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVVKFLSRDDFPKLQFEA 139 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 AWALTNIASGTSE T +++ GA+P FI LL+S + EQAVWALGN+AGD RDLV Sbjct 140 AWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLV 199 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 + YGA+ PLL+ + LRN TWTLSN CR K P P + + LP L RL+ Sbjct 200 LSYGAMTPLLSQFN----ENTKLSMLRNATWTLSNFCRGK-PPPAFEQTQPALPVLERLV 254 Query 261 HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI 320 D EVL D CWA+SYL+D N++I V++ GVVP+L++LLG S ++ PALR IGNI Sbjct 255 QSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNI 314 Query 321 VTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 VTG D QTQ+V+D AL +LL N K +I+KEA WT+SNITA QIQ V++ G++ Sbjct 315 VTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAXXXXQIQAVIDAGII 374 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV 439 LV VL A+F+ +KEA W ++N TSG +QI ++V G I+PL +LLT D K++ V Sbjct 375 QSLVWVLQSAEFEVKKEAAWGISNATSGXXHDQIKFMVSQGCIKPLCDLLTCPDLKVVTV 434 Query 440 ILDAISNIFQAAE------KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIE 493 L+A+ NI E GE + MI+E GL+KIE LQ+H+N +Y ++ ++E Sbjct 435 CLEALENILVVGEAEKNLXXXGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILE 494 Query 494 KYFS 497 +++ Sbjct 495 TFWT 498
> 5mfm_A A YIIIM6AII_GS11_(KR)5
Length=348 Score = 207 bits (527), Expect = 6e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 194 bits (492), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 118/298 (40%), Positives = 168/298 (56%), Gaps = 10/298 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG 407 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ G Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLGGG 328 Score = 192 bits (488), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325
> 5mfl_B B (KR)5_GS10_YIIIM6AII
Length=350 Score = 207 bits (527), Expect = 6e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 28 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 86 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 87 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 141 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 142 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 199 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 200 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 259 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 260 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 318 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 319 AGALEKLEQLQSHENEKI 336 Score = 192 bits (489), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 61 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 119 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 120 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 174 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 175 ALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 232 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 233 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 292 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 293 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 340 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 28 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 83 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 84 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 140 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 141 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 200 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 201 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 260 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 261 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 315 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 316 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 347 Score = 45.4 bits (106), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 271 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 329 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 330 SHENEKIQKEAQEAL 344
> 5mfl_A A (KR)5_GS10_YIIIM6AII
Length=350 Score = 207 bits (527), Expect = 6e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 28 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 86 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 87 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 141 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 142 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 199 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 200 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 259 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 260 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 318 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 319 AGALEKLEQLQSHENEKI 336 Score = 192 bits (489), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 61 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 119 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 120 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 174 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 175 ALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 232 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 233 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 292 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 293 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 340 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 28 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 83 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 84 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 140 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 141 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 200 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 201 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 260 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 261 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 315 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 316 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 347 Score = 45.4 bits (106), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 271 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 329 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 330 SHENEKIQKEAQEAL 344
> 5mfm_D D YIIIM6AII_GS11_(KR)5
Length=348 Score = 207 bits (526), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWALGNIAG 191 + + I ++A AL + G Sbjct 308 SHENEKIQKEAQEALEKLGG 327
> 5mfm_B B YIIIM6AII_GS11_(KR)5
Length=348 Score = 207 bits (526), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWALGNIAG 191 + + I ++A AL + G Sbjct 308 SHENEKIQKEAQEALEKLGG 327
> 5mfm_E E YIIIM6AII_GS11_(KR)5
Length=348 Score = 207 bits (526), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWALGNIAG 191 + + I ++A AL + G Sbjct 308 SHENEKIQKEAQEALEKLGG 327
> 5mfm_C C Importin subunit alpha
Length=350 Score = 207 bits (526), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWALGNIAG 191 + + I ++A AL + G Sbjct 308 SHENEKIQKEAQEALEKLGG 327
> 5mfm_F F YIIIM6AII_GS11_(KR)5
Length=348 Score = 207 bits (526), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 238 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWALGNIAG 191 + + I ++A AL + G Sbjct 308 SHENEKIQKEAQEALEKLGG 327
> 5mfl_C C (KR)5_GS10_YIIIM6AII
Length=350 Score = 207 bits (526), Expect = 8e-60, Method: Compositional matrix adjust. Identities = 124/318 (39%), Positives = 184/318 (58%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 28 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 86 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 87 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 141 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 142 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 199 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 200 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 259 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + Sbjct 260 LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE 318 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 319 AGALEKLEQLQSHENEKI 336 Score = 192 bits (488), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 165/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 61 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 119 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 120 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 174 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 175 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 232 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 233 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 292 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 293 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 340 Score = 192 bits (487), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 122/334 (37%), Positives = 186/334 (56%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 28 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 83 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 84 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASG 140 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 141 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 200 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 201 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 260 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 261 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 315 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 316 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 347 Score = 45.4 bits (106), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 271 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 329 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 330 SHENEKIQKEAQEAL 344
> 6sa7_B B DARPin-Armadillo fusion C8long83
Length=510 Score = 207 bits (526), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 121/297 (41%), Positives = 175/297 (59%), Gaps = 10/297 (3%) Query 142 WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVI 201 W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI Sbjct 195 WTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVI 254 Query 202 KYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRL 259 GA+ L+ LL+ P+ L+ W LSN+ N IDA LP LV+L Sbjct 255 DAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQL 307 Query 260 LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN 319 L + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ N Sbjct 308 LSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN 367 Query 320 IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 I +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ V++ G + Sbjct 368 IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGAL 427 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 P LV +LS + + +EA+WA++N SGG EQ + G +E L L + ++ KI Sbjct 428 PALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 483 Score = 198 bits (503), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 124/328 (38%), Positives = 188/328 (57%), Gaps = 16/328 (5%) Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ + + A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 183 SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 237 Query 232 TLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 238 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 295 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 296 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 355 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG Sbjct 356 QILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN 415 Query 410 VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG 469 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G Sbjct 416 -EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGA 468 Query 470 LDKIEALQNHENESVYKASLSLIEKYFS 497 L+K+E LQ+HENE + K + +EK S Sbjct 469 LEKLEQLQSHENEKIQKEAQEALEKLGS 496 Score = 191 bits (484), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 124/322 (39%), Positives = 176/322 (55%), Gaps = 10/322 (3%) Query 87 SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTN 146 SS EN+LQ ++ I +I AG +P V L + +Q E+ WAL+N Sbjct 183 SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EALWALSN 241 Query 147 IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV 206 IASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI GA+ Sbjct 242 IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGAL 301 Query 207 DPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDD 264 L+ LL+ P+ L+ W LSN+ N IDA LP LV+LL + Sbjct 302 PALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPN 354 Query 265 PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT 324 ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G Sbjct 355 EQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG 414 Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 415 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 474 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 475 LQSHENEKIQKEAQEALEKLGS 496 Score = 138 bits (348), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 85/240 (35%), Positives = 135/240 (56%), Gaps = 7/240 (3%) Query 268 LADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQ 327 L + W + + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Sbjct 190 LQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQ 249 Query 328 TQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS 387 Q VIDAGAL LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS Sbjct 250 IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLS 309 Query 388 KADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 + + +EA+WA++N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI Sbjct 310 SPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNI 368 Query 448 FQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVV 507 G E++ +I + G L + L + NE + + +L + S E+ Q V+ Sbjct 369 AS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVI 422
> 6sa7_A A DARPin-Armadillo fusion C8long83
Length=510 Score = 207 bits (526), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 121/297 (41%), Positives = 175/297 (59%), Gaps = 10/297 (3%) Query 142 WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVI 201 W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI Sbjct 195 WTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVI 254 Query 202 KYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRL 259 GA+ L+ LL+ P+ L+ W LSN+ N IDA LP LV+L Sbjct 255 DAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQL 307 Query 260 LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN 319 L + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ N Sbjct 308 LSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN 367 Query 320 IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV 379 I +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ V++ G + Sbjct 368 IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGAL 427 Query 380 PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 P LV +LS + + +EA+WA++N SGG EQ + G +E L L + ++ KI Sbjct 428 PALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 483 Score = 198 bits (503), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 124/328 (38%), Positives = 188/328 (57%), Gaps = 16/328 (5%) Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ + + A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 183 SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 237 Query 232 TLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 238 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 295 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 296 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 355 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG Sbjct 356 QILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN 415 Query 410 VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG 469 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G Sbjct 416 -EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGA 468 Query 470 LDKIEALQNHENESVYKASLSLIEKYFS 497 L+K+E LQ+HENE + K + +EK S Sbjct 469 LEKLEQLQSHENEKIQKEAQEALEKLGS 496 Score = 191 bits (484), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 124/322 (39%), Positives = 176/322 (55%), Gaps = 10/322 (3%) Query 87 SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTN 146 SS EN+LQ ++ I +I AG +P V L + +Q E+ WAL+N Sbjct 183 SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EALWALSN 241 Query 147 IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV 206 IASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI GA+ Sbjct 242 IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGAL 301 Query 207 DPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDD 264 L+ LL+ P+ L+ W LSN+ N IDA LP LV+LL + Sbjct 302 PALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPN 354 Query 265 PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT 324 ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G Sbjct 355 EQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG 414 Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 415 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 474 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 475 LQSHENEKIQKEAQEALEKLGS 496 Score = 138 bits (348), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 85/240 (35%), Positives = 135/240 (56%), Gaps = 7/240 (3%) Query 268 LADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQ 327 L + W + + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Sbjct 190 LQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQ 249 Query 328 TQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS 387 Q VIDAGAL LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS Sbjct 250 IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLS 309 Query 388 KADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 + + +EA+WA++N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI Sbjct 310 SPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNI 368 Query 448 FQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVV 507 G E++ +I + G L + L + NE + + +L + S E+ Q V+ Sbjct 369 AS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVI 422
> 5mfd_A A YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_C C YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_E E YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_G G YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 187 bits (476), Expect = 6e-53, Method: Compositional matrix adjust. Identities = 122/322 (38%), Positives = 179/322 (56%), Gaps = 15/322 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEA 397 G + L + S + K QKEA Sbjct 297 AGALEKLEQLQSHENEKIQKEA 318 Score = 182 bits (463), Expect = 5e-51, Method: Compositional matrix adjust. Identities = 117/334 (35%), Positives = 180/334 (54%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 42.7 bits (99), Expect = 0.004, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 308 SHENEKIQKEAQEAL 322
> 5mfd_I I YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_K K YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_L L YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 5mfd_J J YIIIM''6AII
Length=328 Score = 201 bits (512), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 121/318 (38%), Positives = 180/318 (57%), Gaps = 11/318 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 + NI +G +QIQ V++ G +P LV +LS + + +EA+W + N SGG EQ + Sbjct 238 LGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE 296 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L L + ++ KI Sbjct 297 AGALEKLEQLQSHENEKI 314 Score = 188 bits (478), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 124/331 (37%), Positives = 182/331 (55%), Gaps = 15/331 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 8 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 65 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 123 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 124 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 176 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 177 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 236 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +Q Q V Sbjct 237 TLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKE 296 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 G + L + S + K QKEA A+ S Sbjct 297 AGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 183 bits (464), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 118/336 (35%), Positives = 181/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 N SGG EQI ++ G + L+ LL++ + +I+ L + NI G +K + Sbjct 239 GNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327
> 6sa8_A A ring-like DARPin-Armadillo fusion H83_D01
Length=671 Score = 202 bits (514), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 127/328 (39%), Positives = 184/328 (56%), Gaps = 10/328 (3%) Query 87 SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTN 146 SS EN+LQ ++ I +I AG +P V L + +Q E+ WAL+N Sbjct 188 SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EALWALSN 246 Query 147 IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV 206 IASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI GA+ Sbjct 247 IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGAL 306 Query 207 DPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDD 264 L+ LL+ P+ L+ W LSN+ N IDA LP LV+LL + Sbjct 307 PALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPN 359 Query 265 PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT 324 ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G Sbjct 360 EQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG 419 Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ V++ G +P LV Sbjct 420 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQ 479 Query 385 VLSKADFKTQKEAVWAVTNYTSGGTVEQ 412 +LS + + Q EA + N +G +Q Sbjct 480 LLSSPNEQIQDEAEKTLLNIANGSEEQQ 507 Score = 182 bits (461), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 111/282 (39%), Positives = 162/282 (57%), Gaps = 10/282 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 255 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 313 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 314 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 368 Query 232 TLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 369 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 426 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 427 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 486 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF 391 IQ EA T+ NI G ++Q + V + G + +L+ + +K F Sbjct 487 QIQDEAEKTLLNIANGSEEQQKAVYDAGALKYLLIIAAKRGF 528 Score = 160 bits (404), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 103/284 (36%), Positives = 159/284 (56%), Gaps = 11/284 (4%) Query 226 LRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 L+N WTL N+ N IDA LP LV+LL + ++L + WA+S + G N Sbjct 195 LQNALWTLGNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGN 252 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL L Sbjct 253 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQL 312 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N Sbjct 313 LSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN 372 Query 404 YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM 463 SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G E++ + Sbjct 373 IASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIAS-----GGNEQIQAV 426 Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVV 507 I + G L + L + NE + + +L + S E+ Q V+ Sbjct 427 I-DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVI 469 Score = 71.2 bits (173), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 1/116 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 423 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 481 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR 227 +SP+ I ++A L NIA + V GA+ LL + A + YLR Sbjct 482 SSPNEQIQDEAEKTLLNIANGSEEQQKAVYDAGALKYLLIIAAKRGFADRVRLYLR 537
> 6s9p_B B internal Lock2 fused to target peptide KRKAKITWKR
Length=344 Score = 192 bits (489), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 122/316 (39%), Positives = 181/316 (57%), Gaps = 7/316 (2%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L LR L + N+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEA-LRALQQI--AMGGNE 121 Query 241 NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK 300 IDA LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+ Sbjct 122 QIQAVIDAG--ALPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQ 179 Query 301 LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS 360 LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +S Sbjct 180 LLSSPNEQILQFALIALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS 239 Query 361 NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG 420 NI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G Sbjct 240 NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAG 298 Query 421 IIEPLMNLLTAKDTKI 436 +E L L + ++ KI Sbjct 299 ALEKLEQLQSHENEKI 314 Score = 176 bits (446), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 118/334 (35%), Positives = 182/334 (54%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + A+ + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALRALQQIAMG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I + A +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQFALIALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 + +E G L+K+E LQ+HENE + K + +EK Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 170 bits (430), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 112/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+ AL IA G+ VI GA+ L+ LL+ P+ LA Sbjct 98 SSPNEQILQEALRALQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILASAL-----G 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 L+N+ N+ IDA LP LV+LL + ++L A+S + G NE+I V Sbjct 153 ALANIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQFALIALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 308 SHENEKIQKEAQEAL 322
> 6s9p_A A internal Lock2 fused to target peptide KRKAKITWKR
Length=344 Score = 192 bits (489), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 122/316 (39%), Positives = 181/316 (57%), Gaps = 7/316 (2%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L LR L + N+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEA-LRALQQI--AMGGNE 121 Query 241 NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK 300 IDA LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+ Sbjct 122 QIQAVIDAG--ALPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQ 179 Query 301 LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS 360 LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +S Sbjct 180 LLSSPNEQILQFALIALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS 239 Query 361 NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG 420 NI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G Sbjct 240 NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAG 298 Query 421 IIEPLMNLLTAKDTKI 436 +E L L + ++ KI Sbjct 299 ALEKLEQLQSHENEKI 314 Score = 177 bits (448), Expect = 9e-49, Method: Compositional matrix adjust. Identities = 119/336 (35%), Positives = 183/336 (54%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + A+ + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALRALQQIAMG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I + A +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQFALIALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 + +E G L+K+E LQ+HENE + K + +EK S Sbjct 294 V--KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 172 bits (437), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 115/300 (38%), Positives = 165/300 (55%), Gaps = 10/300 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+ AL IA G+ VI GA+ L+ LL+ P+ LA Sbjct 98 SSPNEQILQEALRALQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILASAL-----G 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 L+N+ N+ IDA LP LV+LL + ++L A+S + G NE+I V Sbjct 153 ALANIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQFALIALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 330
> 6s9o_A A designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 190 bits (482), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 122/339 (36%), Positives = 186/339 (55%), Gaps = 16/339 (5%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N I AV LP LV+LL + ++L + WA+ + Sbjct 62 ----ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALRNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE 458 WA++N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G + Sbjct 236 WALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQ 290 Query 459 KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 K + ++E G L+K+E LQ+HENE + K + +EK S Sbjct 291 KQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 186 bits (472), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 119/299 (40%), Positives = 168/299 (56%), Gaps = 10/299 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG 408 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ S G Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHG 329
> 6s9o_F F designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 190 bits (482), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 122/339 (36%), Positives = 186/339 (55%), Gaps = 16/339 (5%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N I AV LP LV+LL + ++L + WA+ + Sbjct 62 ----ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALRNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE 458 WA++N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G + Sbjct 236 WALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQ 290 Query 459 KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 K + ++E G L+K+E LQ+HENE + K + +EK S Sbjct 291 KQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 186 bits (473), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 119/300 (40%), Positives = 169/300 (56%), Gaps = 10/300 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 330
> 6s9o_C C designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 189 bits (480), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 121/337 (36%), Positives = 185/337 (55%), Gaps = 16/337 (5%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N I AV LP LV+LL + ++L + WA+ + Sbjct 62 ----ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALRNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE 458 WA++N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G + Sbjct 236 WALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQ 290 Query 459 KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 K + ++E G L+K+E LQ+HENE + K + +EK Sbjct 291 KQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 184 bits (466), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 164/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 45.1 bits (105), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 308 SHENEKIQKEAQEAL 322
> 6s9o_E E designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 189 bits (479), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 121/336 (36%), Positives = 185/336 (55%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N I AV LP LV+LL + ++L + WA+ + G Sbjct 62 -ILQEALWALSNIASGGNE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALRNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 ++E G L+K+E LQ+HENE + K + +EK S Sbjct 294 --VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 187 bits (475), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 119/300 (40%), Positives = 169/300 (56%), Gaps = 10/300 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 330
> 6s9o_B B designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 189 bits (479), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 121/336 (36%), Positives = 185/336 (55%), Gaps = 16/336 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N I AV LP LV+LL + ++L + WA+ + G Sbjct 62 -ILQEALWALSNIASGGNE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALRNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 ++E G L+K+E LQ+HENE + K + +EK S Sbjct 294 --VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 327 Score = 187 bits (475), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 119/300 (40%), Positives = 169/300 (56%), Gaps = 10/300 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 I +EA W +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 330
> 6s9o_D D designed Armadillo repeat protein with internal Lock1
fused to target peptide KRKRKLKFKR Length=344 Score = 187 bits (476), Expect = 9e-53, Method: Compositional matrix adjust. Identities = 120/334 (36%), Positives = 185/334 (55%), Gaps = 16/334 (5%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+ + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALRNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I++ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I + A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS 461 +N SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K + Sbjct 239 SNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA 293 Query 462 IMIEECGGLDKIEALQNHENESVYKASLSLIEKY 495 ++E G L+K+E LQ+HENE + K + +EK Sbjct 294 --VKEAGALEKLEQLQSHENEKIQKEAQEALEKL 325 Score = 184 bits (467), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 116/288 (40%), Positives = 164/288 (57%), Gaps = 10/288 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNL 229 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ + S A G L N+ Sbjct 98 SSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNI 157 Query 230 TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 N+ IDA LP LV+LL + ++L WA+S + G NE+I V Sbjct 158 A-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE 270 Query 350 NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 271 QILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 318 Score = 45.4 bits (106), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 249 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 307 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 308 SHENEKIQKEAQEAL 322
> 5mfh_C C YIIIM5AII
Length=286 Score = 177 bits (450), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 175 bits (443), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (406), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfe_A A YIIIM5AII
Length=286 Score = 177 bits (450), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 175 bits (443), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (406), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfe_D D YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5aei_B B DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5aei_C C DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfh_A A YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 102/278 (37%), Positives = 151/278 (54%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + Sbjct 62 ----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 WA++N SGG EQ + G +E L L + ++ KI Sbjct 236 WALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfh_D D YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.19, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfe_B B YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.19, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfg_A A YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.19, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfh_B B YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.19, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfe_C C YIIIM5AII
Length=286 Score = 177 bits (449), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.4 bits (85), Expect = 0.19, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5aei_A A DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII
Length=286 Score = 177 bits (448), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (441), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (406), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfc_A A YIIIM5AII
Length=286 Score = 177 bits (448), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 111/288 (39%), Positives = 160/288 (56%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (409), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 102/278 (37%), Positives = 151/278 (54%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + Sbjct 62 ----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 WA++N SGG EQ + G +E L L + ++ KI Sbjct 236 WALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 37.7 bits (86), Expect = 0.13, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfn_A A YIIIM5AII
Length=286 Score = 176 bits (447), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (440), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mff_B B YIIIM5AII
Length=286 Score = 176 bits (447), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (440), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mff_A A YIIIM5AII
Length=286 Score = 176 bits (447), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (440), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (406), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfc_C C YIIIM5AII
Length=286 Score = 176 bits (447), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (440), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 162 bits (409), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 102/278 (37%), Positives = 151/278 (54%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + Sbjct 62 ----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 WA++N SGG EQ + G +E L L + ++ KI Sbjct 236 WALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfn_B B YIIIM5AII
Length=286 Score = 176 bits (447), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 174 bits (440), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/242 (40%), Positives = 148/242 (61%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EK 494 EK Sbjct 281 EK 282 Score = 160 bits (405), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.17, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 4u2x_F F Importin subunit alpha-6
Length=175 Score = 172 bits (437), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 86/174 (49%), Positives = 120/174 (69%), Gaps = 5/174 (3%) Query 328 TQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS 387 TQV+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + P L+ +L Sbjct 1 TQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQ 60 Query 388 KADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 KA+F+T+KEA WA+TN TSGGT EQI YLV G I+PL +LLT D+KI+ V L+ + NI Sbjct 61 KAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENI 120 Query 448 FQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 + E+ + + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE YF Sbjct 121 LRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYF 174 Score = 50.4 bits (119), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 31/105 (30%), Positives = 47/105 (45%), Gaps = 4/105 (4%) Query 115 IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP 174 I+ +P + L I+ E+ W ++NI +G Q +AV+D P I +L Sbjct 4 ILNCSALPCLLHLLSSPK-ESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKA 62 Query 175 HAHISEQAVWALGNIAGDGS--VFRDLVIKYGAVDPLLALLAVPD 217 ++A WA+ N G+ R LV G + PL LL V D Sbjct 63 EFRTRKEAAWAITNATSGGTPEQIRYLV-ALGCIKPLCDLLTVMD 106 Score = 50.4 bits (119), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 9/151 (6%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP L+ LL + + CW +S +T G +I V+ + P L+++L +E Sbjct 10 LPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKE 69 Query 313 ALRAIGNIVT-GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT-AGRQDQI 370 A AI N + GT EQ + ++ G + LLT + I + A + NI G Q+ Sbjct 70 AAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESK 129 Query 371 QQVVNHGLVPFLVSV-----LSKADFKTQKE 396 Q + G+ P+ + L K +F E Sbjct 130 QNGI--GINPYCALIEEAYGLDKIEFLQSHE 158 Score = 40.8 bits (94), Expect = 0.007, Method: Compositional matrix adjust. Identities = 39/177 (22%), Positives = 69/177 (39%), Gaps = 50/177 (28%) Query 155 TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI-AGDGSVFRDLVIKYGAVDPLLALL 213 T+ +++ A+P + LL+SP I ++A W + NI AG+ + + + Sbjct 1 TQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAV-------------- 46 Query 214 AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW 273 IDA I P L+ +L + + W Sbjct 47 --------------------------------IDA--NIFPVLIEILQKAEFRTRKEAAW 72 Query 274 AISYLTDGPN-ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ 329 AI+ T G E+I +V G + L LL + IV AL + NI+ +++++ Sbjct 73 AITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESK 129
> 5mff_D D YIIIM5AII
Length=286 Score = 176 bits (446), Expect = 4e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 173 bits (439), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (404), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mff_C C YIIIM5AII
Length=286 Score = 176 bits (446), Expect = 4e-49, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 65 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +SNI +G +Q Q V G + L + S + K QKEA Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 276 Score = 173 bits (439), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 160 bits (404), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 101/275 (37%), Positives = 150/275 (55%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 +N SGG EQ + G +E L L + ++ KI Sbjct 239 SNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280 Score = 37.4 bits (85), Expect = 0.18, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9l_B B KR4KLSF Lock1
Length=286 Score = 175 bits (443), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 112/288 (39%), Positives = 157/288 (55%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + W L NIASG +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILS 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L W LSN+ Sbjct 65 SALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQLAL-----WALSNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 171 bits (432), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 104/274 (38%), Positives = 160/274 (58%), Gaps = 11/274 (4%) Query 226 LRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 L++ W L N+ N+ IDA LP LV+LL + ++L+ A+S + G N Sbjct 21 LQSALWKLRNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILSSALGALSNIASGGN 78 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL L Sbjct 79 EQIQAVIDAGALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQL 138 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N Sbjct 139 LSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN 198 Query 404 YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM 463 SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ Sbjct 199 IASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV- 252 Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 +E G L+K+E LQ+HENE + K + +EK S Sbjct 253 -KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 161 bits (408), Expect = 9e-44, Method: Compositional matrix adjust. Identities = 104/278 (37%), Positives = 152/278 (55%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--M 218 G +P + L SP + A+W L NIA G+ VI GA+ L+ LL+ P+ + Sbjct 3 GSELPQMVQQLNSPDQQELQSALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI 62 Query 219 SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 S A G L N+ N+ IDA LP LV+LL + ++L WA+S + Sbjct 63 LSSALGALSNIA-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 WA++N SGG EQ + G +E L L + ++ KI Sbjct 236 WALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272
> 5mfg_C C YIIIM5AII
Length=286 Score = 175 bits (443), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 106/265 (40%), Positives = 151/265 (57%), Gaps = 9/265 (3%) Query 144 LTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKY 203 L+ IASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI Sbjct 28 LSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDA 87 Query 204 GAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLH 261 GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+LL Sbjct 88 GALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLS 140 Query 262 HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV 321 + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ NI Sbjct 141 SPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIA 200 Query 322 TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPF 381 +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + Sbjct 201 SGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEK 260 Query 382 LVSVLSKADFKTQKEAVWAVTNYTS 406 L + S + K QKEA A+ S Sbjct 261 LEQLQSHENEKIQKEAQEALEKLQS 285 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 97/245 (40%), Positives = 149/245 (61%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (411), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 98/246 (40%), Positives = 141/246 (57%), Gaps = 10/246 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL L ++ Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENE 270 Query 350 NIQKEA 355 IQKEA Sbjct 271 KIQKEA 276 Score = 155 bits (392), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 141/253 (56%), Gaps = 10/253 (4%) Query 186 LGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPA 243 L IA G+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ Sbjct 28 LSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQ 82 Query 244 PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG 303 IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL Sbjct 83 AVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLS 140 Query 304 ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT 363 + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI Sbjct 141 SPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIA 200 Query 364 AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIE 423 +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E Sbjct 201 SGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALE 259 Query 424 PLMNLLTAKDTKI 436 L L + ++ KI Sbjct 260 KLEQLQSHENEKI 272 Score = 111 bits (278), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 70/195 (36%), Positives = 111/195 (57%), Gaps = 7/195 (4%) Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 ALR + I +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 24 ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 83 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 84 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 142 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G E++ +I + G L + L + NE + + +L + Sbjct 143 NEQILQEALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWAL 196 Query 493 EKYFSVEEEEDQNVV 507 S E+ Q V+ Sbjct 197 SNIASGGNEQIQAVI 211 Score = 45.4 bits (106), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280
> 6s9l_A A KR4KLSF Lock1
Length=286 Score = 175 bits (443), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 112/288 (39%), Positives = 156/288 (54%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + W L NIASG +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILS 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L W LSN+ Sbjct 65 SALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQLAL-----WALSNIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 +SNI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 171 bits (432), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 104/274 (38%), Positives = 159/274 (58%), Gaps = 11/274 (4%) Query 226 LRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 L++ W L N+ N I AV LP LV+LL + ++L+ A+S + G N Sbjct 21 LQSALWKLRNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGN 78 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL L Sbjct 79 EQIQAVIDAGALPALVQLLSSPNEQILQLALWALSNIASGGNEQIQAVIDAGALPALVQL 138 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N Sbjct 139 LSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN 198 Query 404 YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM 463 SGG EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ Sbjct 199 IASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV- 252 Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEKYFS 497 +E G L+K+E LQ+HENE + K + +EK S Sbjct 253 -KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 161 bits (407), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 104/278 (37%), Positives = 152/278 (55%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD--M 218 G +P + L SP + A+W L NIA G+ VI GA+ L+ LL+ P+ + Sbjct 3 GSELPQMVQQLNSPDQQELQSALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI 62 Query 219 SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 S A G L N+ N+ IDA LP LV+LL + ++L WA+S + Sbjct 63 LSSALGALSNIA-----SGGNEQIQAVIDA--GALPALVQLLSSPNEQILQLALWALSNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 WA++N SGG EQ + G +E L L + ++ KI Sbjct 236 WALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272
> 4v3o_C C YIII_M5_AII
Length=289 Score = 174 bits (442), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 107/279 (38%), Positives = 155/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 10 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 69 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 123 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 124 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 181 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 241 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 + NI +G +Q Q V G + L + S + K QKEA Sbjct 242 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 280 Score = 164 bits (414), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 91/243 (37%), Positives = 142/243 (58%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 52 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 111 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 112 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 171 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 172 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 230 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 231 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 284 Query 493 EKY 495 EK Sbjct 285 EKL 287 Score = 156 bits (394), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 99/278 (36%), Positives = 147/278 (53%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 120 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 239 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G +E L L + ++ KI Sbjct 240 WTLGNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 276 Score = 43.1 bits (100), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 211 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 269 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 270 SHENEKIQKEAQEAL 284
> 4v3o_A A YIII_M5_AII
Length=289 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 107/279 (38%), Positives = 155/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 10 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 69 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 123 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 124 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 181 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 241 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 + NI +G +Q Q V G + L + S + K QKEA Sbjct 242 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 280 Score = 164 bits (414), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 91/243 (37%), Positives = 142/243 (58%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 52 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 111 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 112 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 171 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 172 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 230 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 231 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 284 Query 493 EKY 495 EK Sbjct 285 EKL 287 Score = 158 bits (400), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 105/289 (36%), Positives = 158/289 (55%), Gaps = 15/289 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 12 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 69 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 127 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 128 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 180 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 181 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 240 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA 364 +GNI +G +EQ Q V +AGAL L ++ IQKEA + + A Sbjct 241 TLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQA 289 Score = 156 bits (394), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 99/278 (36%), Positives = 147/278 (53%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 120 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 239 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G +E L L + ++ KI Sbjct 240 WTLGNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 276
> 4v3o_B B YIII_M5_AII
Length=289 Score = 174 bits (442), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 107/279 (38%), Positives = 155/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 10 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 69 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 123 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 124 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 181 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 241 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 + NI +G +Q Q V G + L + S + K QKEA Sbjct 242 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 280 Score = 164 bits (414), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 91/243 (37%), Positives = 142/243 (58%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 52 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 111 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 112 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 171 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 172 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 230 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 231 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 284 Query 493 EKY 495 EK Sbjct 285 EKL 287 Score = 158 bits (400), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 105/289 (36%), Positives = 158/289 (55%), Gaps = 15/289 (5%) Query 80 DIVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ 137 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 12 QMVQQLNSPD-QQELQS--ALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 138 FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR 197 E+ W L NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G+ Sbjct 69 -EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQI 127 Query 198 DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPT 255 VI GA+ L+ LL+ P+ L+ WTL N+ N+ IDA LP Sbjct 128 QAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPA 180 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ AL Sbjct 181 LVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 240 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA 364 +GNI +G +EQ Q V +AGAL L ++ IQKEA + + A Sbjct 241 TLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQA 289 Score = 156 bits (394), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 99/278 (36%), Positives = 147/278 (53%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 120 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 239 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G +E L L + ++ KI Sbjct 240 WTLGNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 276
> 4v3o_D D YIII_M5_AII
Length=289 Score = 174 bits (441), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 107/279 (38%), Positives = 155/279 (56%), Gaps = 10/279 (4%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG +EQ +AV+D GA+PA + LL+SP+ I + Sbjct 10 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ 68 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 69 EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 123 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + W + + G NE+I V+ G +P L Sbjct 124 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPAL 181 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 241 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 + NI +G +Q Q V G + L + S + K QKEA Sbjct 242 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 280 Score = 163 bits (413), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 91/242 (38%), Positives = 142/242 (59%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 52 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 111 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 112 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 171 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 172 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 230 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 231 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 284 Query 493 EK 494 EK Sbjct 285 EK 286 Score = 155 bits (393), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 99/278 (36%), Positives = 147/278 (53%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N+ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 120 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 239 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G +E L L + ++ KI Sbjct 240 WTLGNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 276 Score = 42.7 bits (99), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 211 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 269 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 270 SHENEKIQKEAQEAL 284
> 5mfg_B B YIIIM5AII
Length=286 Score = 174 bits (440), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 104/256 (41%), Positives = 148/256 (58%), Gaps = 9/256 (4%) Query 144 LTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKY 203 L+ IASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ VI Sbjct 28 LSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDA 87 Query 204 GAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLH 261 GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+LL Sbjct 88 GALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLS 140 Query 262 HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV 321 + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ AL A+ NI Sbjct 141 SPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIA 200 Query 322 TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPF 381 +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + Sbjct 201 SGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEK 260 Query 382 LVSVLSKADFKTQKEA 397 L + S + K QKEA Sbjct 261 LEQLQSHENEKIQKEA 276 Score = 173 bits (439), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/243 (40%), Positives = 148/243 (61%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKY 495 EK Sbjct 281 EKL 283 Score = 162 bits (409), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 98/246 (40%), Positives = 141/246 (57%), Gaps = 10/246 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N+ IDA LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL L ++ Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENE 270 Query 350 NIQKEA 355 IQKEA Sbjct 271 KIQKEA 276 Score = 155 bits (391), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 141/253 (56%), Gaps = 10/253 (4%) Query 186 LGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPA 243 L IA G+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ Sbjct 28 LSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQ 82 Query 244 PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG 303 IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL Sbjct 83 AVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLS 140 Query 304 ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT 363 + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI Sbjct 141 SPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIA 200 Query 364 AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIE 423 +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E Sbjct 201 SGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALE 259 Query 424 PLMNLLTAKDTKI 436 L L + ++ KI Sbjct 260 KLEQLQSHENEKI 272 Score = 45.4 bits (106), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 207 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 265 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 266 SHENEKIQKEAQEAL 280
> 4rv1_F F Engineered Protein OR497
Length=420 Score = 177 bits (448), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 166 bits (419), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 119/364 (33%), Positives = 184/364 (51%), Gaps = 29/364 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGG 408 SGG Sbjct 408 KSGG 411 Score = 157 bits (398), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 108/332 (33%), Positives = 169/332 (51%), Gaps = 17/332 (5%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 +V G +E L+ LLT+ D+++ A++NI Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANI 323 Score = 115 bits (287), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/231 (32%), Positives = 122/231 (53%), Gaps = 7/231 (3%) Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL D E + ++ + GP I +V G V LVKLL +++ + A R Sbjct 7 LVKLLTSTDSETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAAR 66 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 A+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I+ +V+ Sbjct 67 ALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVD 126 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G V LV +L+ D + QKEA A+ N SG E I +V G +E L+ LLT+ D++ Sbjct 127 AGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKAIVDAGGVEVLVKLLTSTDSE 185 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK 486 + A++NI G T + ++ + GG++ + L + V K Sbjct 186 VQKEAARALANIAS-----GPTSAIKAIV-DAGGVEVLVKLLTSTDSEVQK 230
> 4rv1_C C Engineered Protein OR497
Length=420 Score = 176 bits (447), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 166 bits (419), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 119/364 (33%), Positives = 184/364 (51%), Gaps = 29/364 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGG 408 SGG Sbjct 408 KSGG 411 Score = 157 bits (397), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 115/371 (31%), Positives = 184/371 (50%), Gaps = 23/371 (6%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA 475 +V G +E L+ LLT+ D+++ A++NI G E + ++ + GG++ + Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANIAS-----GPDEAIKAIV-DAGGVEVLVK 345 Query 476 LQNHENESVYK 486 L + V K Sbjct 346 LLTSTDSEVQK 356
> 4rv1_E E Engineered Protein OR497
Length=420 Score = 176 bits (447), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 166 bits (419), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 119/364 (33%), Positives = 184/364 (51%), Gaps = 29/364 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGG 408 SGG Sbjct 408 KSGG 411 Score = 157 bits (397), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 115/371 (31%), Positives = 184/371 (50%), Gaps = 23/371 (6%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA 475 +V G +E L+ LLT+ D+++ A++NI G E + ++ + GG++ + Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANIAS-----GPDEAIKAIV-DAGGVEVLVK 345 Query 476 LQNHENESVYK 486 L + V K Sbjct 346 LLTSTDSEVQK 356
> 4rv1_A A Engineered Protein OR497
Length=420 Score = 176 bits (446), Expect = 7e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 165 bits (418), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 119/364 (33%), Positives = 184/364 (51%), Gaps = 29/364 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGG 408 SGG Sbjct 408 KSGG 411 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 115/371 (31%), Positives = 184/371 (50%), Gaps = 23/371 (6%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA 475 +V G +E L+ LLT+ D+++ A++NI G E + ++ + GG++ + Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANIAS-----GPDEAIKAIV-DAGGVEVLVK 345 Query 476 LQNHENESVYK 486 L + V K Sbjct 346 LLTSTDSEVQK 356
> 4rv1_D D Engineered Protein OR497
Length=420 Score = 176 bits (446), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 165 bits (418), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 120/368 (33%), Positives = 186/368 (51%), Gaps = 29/368 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGGTVEQ 412 SGG +E Sbjct 408 KSGGWLEH 415 Score = 157 bits (396), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 108/332 (33%), Positives = 169/332 (51%), Gaps = 17/332 (5%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 +V G +E L+ LLT+ D+++ A++NI Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANI 323 Score = 114 bits (286), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 75/231 (32%), Positives = 122/231 (53%), Gaps = 7/231 (3%) Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL D E + ++ + GP I +V G V LVKLL +++ + A R Sbjct 7 LVKLLTSTDSETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAAR 66 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 A+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I+ +V+ Sbjct 67 ALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVD 126 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G V LV +L+ D + QKEA A+ N SG E I +V G +E L+ LLT+ D++ Sbjct 127 AGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKAIVDAGGVEVLVKLLTSTDSE 185 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK 486 + A++NI G T + ++ + GG++ + L + V K Sbjct 186 VQKEAARALANIAS-----GPTSAIKAIV-DAGGVEVLVKLLTSTDSEVQK 230
> 4v3r_B B YIII_M5_AII
Length=286 Score = 172 bits (437), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 108/288 (38%), Positives = 156/288 (54%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 ++ IDA LP LV+LL + ++L + W + + G +E+I V+ G +P L Sbjct 120 DEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 + NI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 164 bits (414), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 92/245 (38%), Positives = 143/245 (58%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G +E+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 108 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 152 bits (384), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 145/275 (53%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ ++ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGDEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 +E+I V+ G +P LV+LL + I+ AL +GNI +G DEQ Q VIDAGAL Sbjct 119 GDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G +E L L + ++ KI Sbjct 239 GNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272
> 4v3r_A A YIII_M5_AII
Length=286 Score = 172 bits (437), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 108/288 (38%), Positives = 156/288 (54%), Gaps = 10/288 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L+ IASG EQ +AV+D GA+PA + LL+SP+ I + Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 +A+W LGNIA G VI GA+ L+ LL+ P+ L+ WTL N+ Sbjct 65 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 ++ IDA LP LV+LL + ++L + W + + G +E+I V+ G +P L Sbjct 120 DEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT Sbjct 178 VQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWT 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 + NI +G +Q Q V G + L + S + K QKEA A+ S Sbjct 238 LGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 285 Score = 164 bits (414), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 92/245 (38%), Positives = 143/245 (58%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G +E+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 108 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 152 bits (384), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 145/275 (53%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ ++ IDA LP LV+LL + ++L + W + + G Sbjct 62 -ILQEALWTLGNIASGGDEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 +E+I V+ G +P LV+LL + I+ AL +GNI +G DEQ Q VIDAGAL Sbjct 119 GDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 179 QLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 238 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G +E L L + ++ KI Sbjct 239 GNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI 272
> 4rv1_B B Engineered Protein OR497
Length=420 Score = 176 bits (446), Expect = 9e-48, Method: Compositional matrix adjust. Identities = 124/366 (34%), Positives = 189/366 (52%), Gaps = 22/366 (6%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L + P I I+ AG + V L TD S Sbjct 46 VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SE 101 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 102 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 161 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-- 253 ++ G V+ L+ LL D + L+N+ P A++ I+ Sbjct 162 AIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDA 211 Query 254 ---PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 LV+LL D EV + A++ + GP+E I +V G V LVKLL +++ + Sbjct 212 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 271 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I Sbjct 272 KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI 331 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT 430 + +V+ G V LV +L+ D + QKEA A+ N SG T I +V G +E L LLT Sbjct 332 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLT 390 Query 431 AKDTKI 436 + D+++ Sbjct 391 STDSEV 396 Score = 165 bits (417), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 120/368 (33%), Positives = 186/368 (51%), Gaps = 29/368 (8%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 70 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 118 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG E KA+VD G + + Sbjct 119 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 177 Query 170 LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNL 229 LL S + + ++A AL NIA + ++ G V+ L+ LL D + Sbjct 178 LLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEA 232 Query 230 TWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLADTCWAISYLTDGPNE 284 L+N+ P +A++ I+ LV+LL D EV + A++ + GP+E Sbjct 233 ARALANIASG-----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 287 Query 285 RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL 344 I +V G V LVKLL +++ + A RA+ NI +G DE + ++DAG + V LL Sbjct 288 AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLL 347 Query 345 TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY 404 T+ + +QKEA ++NI +G I+ +V+ G V L +L+ D + QKEA A+ N Sbjct 348 TSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENI 407 Query 405 TSGGTVEQ 412 SGG +E Sbjct 408 KSGGWLEH 415 Score = 157 bits (396), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 108/332 (33%), Positives = 169/332 (51%), Gaps = 17/332 (5%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA ++ G V+ L+ LL D + L+N+ Sbjct 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG- 116 Query 241 NPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV 295 P +A++ I + LV+LL D EV + A++ + GP+E I +V G V Sbjct 117 ----PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGV 172 Query 296 PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 LVKLL +++ + A RA+ NI +G + ++DAG + V LLT+ + +QKEA Sbjct 173 EVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLVKLLTSTDSEVQKEA 232 Query 356 TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY 415 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG E I Sbjct 233 ARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKA 291 Query 416 LVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 +V G +E L+ LLT+ D+++ A++NI Sbjct 292 IVDAGGVEVLVKLLTSTDSEVQKEAARALANI 323 Score = 114 bits (286), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 75/231 (32%), Positives = 122/231 (53%), Gaps = 7/231 (3%) Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LV+LL D E + ++ + GP I +V G V LVKLL +++ + A R Sbjct 7 LVKLLTSTDSETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAAR 66 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN 375 A+ NI +G DE + ++DAG + V LLT+ + +QKEA ++NI +G + I+ +V+ Sbjct 67 ALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVD 126 Query 376 HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 G V LV +L+ D + QKEA A+ N SG E I +V G +E L+ LLT+ D++ Sbjct 127 AGGVEVLVKLLTSTDSEVQKEAARALANIASGPD-EAIKAIVDAGGVEVLVKLLTSTDSE 185 Query 436 IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK 486 + A++NI G T + ++ + GG++ + L + V K Sbjct 186 VQKEAARALANIAS-----GPTSAIKAIV-DAGGVEVLVKLLTSTDSEVQK 230
> 4u2x_E E Importin subunit alpha-6
Length=175 Score = 169 bits (427), Expect = 9e-48, Method: Compositional matrix adjust. Identities = 84/172 (49%), Positives = 118/172 (69%), Gaps = 5/172 (3%) Query 330 VVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA 389 V+++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + P L+ +L KA Sbjct 3 VILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKA 62 Query 390 DFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQ 449 +F+T+KEA WA+TN TSGGT EQI YLV G I+PL +LLT D+KI+ V L+ + NI + Sbjct 63 EFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILR 122 Query 450 AAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 E+ + + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE YF Sbjct 123 LGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYF 174 Score = 50.4 bits (119), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 9/151 (6%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP L+ LL + + CW +S +T G +I V+ + P L+++L +E Sbjct 10 LPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKE 69 Query 313 ALRAIGNIVT-GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT-AGRQDQI 370 A AI N + GT EQ + ++ G + LLT + I + A + NI G Q+ Sbjct 70 AAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESK 129 Query 371 QQVVNHGLVPFLVSV-----LSKADFKTQKE 396 Q + G+ P+ + L K +F E Sbjct 130 QNGI--GINPYCALIEEAYGLDKIEFLQSHE 158 Score = 50.4 bits (119), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 31/105 (30%), Positives = 47/105 (45%), Gaps = 4/105 (4%) Query 115 IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP 174 I+ +P + L I+ E+ W ++NI +G Q +AV+D P I +L Sbjct 4 ILNCSALPCLLHLLSSPK-ESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKA 62 Query 175 HAHISEQAVWALGNIAGDGS--VFRDLVIKYGAVDPLLALLAVPD 217 ++A WA+ N G+ R LV G + PL LL V D Sbjct 63 EFRTRKEAAWAITNATSGGTPEQIRYLV-ALGCIKPLCDLLTVMD 106 Score = 40.4 bits (93), Expect = 0.010, Method: Compositional matrix adjust. Identities = 36/134 (27%), Positives = 60/134 (45%), Gaps = 10/134 (7%) Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTL 256 +++ A+ LL LL+ P S + WT+SN+ IDA I P L Sbjct 3 VILNCSALPCLLHLLSSPKES-----IRKEACWTVSNITAGNRAQIQAVIDA--NIFPVL 55 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPN-ERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 + +L + + WAI+ T G E+I +V G + L LL + IV AL Sbjct 56 IEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALN 115 Query 316 AIGNIVTGTDEQTQ 329 + NI+ +++++ Sbjct 116 GLENILRLGEQESK 129
> 4u2x_D D Importin subunit alpha-6
Length=175 Score = 167 bits (423), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 5/171 (3%) Query 331 VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKAD 390 +++ AL LL++PK +I+KEA WT+SNITAG + QIQ V++ + P L+ +L KA+ Sbjct 4 ILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAE 63 Query 391 FKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA 450 F+T+KEA WA+TN TSGGT EQI YLV G I+PL +LLT D+KI+ V L+ + NI + Sbjct 64 FRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRL 123 Query 451 AEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYF 496 E+ + + I +IEE GLDKIE LQ+HEN+ +Y+ + LIE YF Sbjct 124 GEQESKQXXIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYF 174 Score = 51.2 bits (121), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 9/151 (6%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP L+ LL + + CW +S +T G +I V+ + P L+++L +E Sbjct 10 LPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKE 69 Query 313 ALRAIGNIVT-GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT-AGRQDQI 370 A AI N + GT EQ + ++ G + LLT + I + A + NI G Q+ Sbjct 70 AAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESK 129 Query 371 QQVVNHGLVPFLVSV-----LSKADFKTQKE 396 Q + G+ P+ + L K +F E Sbjct 130 QXXI--GINPYCALIEEAYGLDKIEFLQSHE 158 Score = 50.4 bits (119), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 31/105 (30%), Positives = 47/105 (45%), Gaps = 4/105 (4%) Query 115 IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP 174 I+ +P + L I+ E+ W ++NI +G Q +AV+D P I +L Sbjct 4 ILNCSALPCLLHLLSSPK-ESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKA 62 Query 175 HAHISEQAVWALGNIAGDGS--VFRDLVIKYGAVDPLLALLAVPD 217 ++A WA+ N G+ R LV G + PL LL V D Sbjct 63 EFRTRKEAAWAITNATSGGTPEQIRYLV-ALGCIKPLCDLLTVMD 106 Score = 40.8 bits (94), Expect = 0.007, Method: Compositional matrix adjust. Identities = 40/137 (29%), Positives = 58/137 (42%), Gaps = 11/137 (8%) Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLV 257 ++ A+ LL LL+ P S + WT+SN+ IDA I P L+ Sbjct 4 ILNCSALPCLLHLLSSPKES-----IRKEACWTVSNITAGNRAQIQAVIDA--NIFPVLI 56 Query 258 RLLHHDDPEVLADTCWAISYLTDGPN-ERIGMVVKTGVVPQLVKLLGASELPIVTPALRA 316 +L + + WAI+ T G E+I +V G + L LL + IV AL Sbjct 57 EILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNG 116 Query 317 IGNIV-TGTDEQTQVVI 332 + NI+ G E Q I Sbjct 117 LENILRLGEQESKQXXI 133
> 6s9n_D D Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (411), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 156/291 (54%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.99, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9n_C C Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (411), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 156/291 (54%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.99, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9n_F F Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (411), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 156/291 (54%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.99, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9n_B B Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (411), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 156/291 (54%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.99, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9n_A A Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.99, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9n_E E Lock2_KRKRKAKLSF
Length=302 Score = 168 bits (426), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.4 bits (80), Expect = 0.83, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_A A Lock2_KRKRKAKITW
Length=302 Score = 168 bits (426), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.97, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_C C Lock2_KRKRKAKITW
Length=302 Score = 168 bits (426), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 0.97, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_E E Lock2_KRKRKAKITW
Length=302 Score = 168 bits (426), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (409), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.4 bits (80), Expect = 0.76, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_D D Lock2_KRKRKAKITW
Length=302 Score = 168 bits (425), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 1.0, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_F F Lock2_KRKRKAKITW
Length=302 Score = 168 bits (425), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (410), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 155/291 (53%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 241 NPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N I AV LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NE--QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 1.0, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 6s9m_B B Lock2_KRKRKAKITW
Length=302 Score = 168 bits (425), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 96/245 (39%), Positives = 148/245 (60%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++LA A++ + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQF 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 227 NEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 280 Query 493 EKYFS 497 EK S Sbjct 281 EKLQS 285 Score = 162 bits (409), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 108/291 (37%), Positives = 156/291 (54%), Gaps = 10/291 (3%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 +P+ V L D +Q + L IA G +EQ +AV+D GA+PA + LL+SP+ I Sbjct 6 LPQMVQQLNSPDQQELQ-SALRKLQQIAMGGNEQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-- 238 A+ AL NIA G+ VI GA+ L+ LL+ P+ L + L+N+ Sbjct 65 SALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALI-----ALANIASGG 119 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 N+ IDA LP LV+LL + ++L + WA+S + G NE+I V+ G +P L Sbjct 120 NEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPAL 177 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 V+LL + I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W Sbjct 178 VQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA 237 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT 409 +SNI +G +Q Q V G + L + S + K QKEA A+ S G+ Sbjct 238 LSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSHGS 288 Score = 35.0 bits (79), Expect = 1.0, Method: Compositional matrix adjust. Identities = 32/129 (25%), Positives = 62/129 (48%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ + GG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLQQIAMGGN-EQIQAVIDAGALPALVQLLSSPNEQILA 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A++NI G E++ +I + G L + L + NE + + +L + S Sbjct 65 SALGALANIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQFALIALANIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 4db8_A A Armadillo-repeat Protein
Length=252 Score = 158 bits (399), Expect = 5e-43, Method: Compositional matrix adjust. Identities = 96/244 (39%), Positives = 146/244 (60%), Gaps = 9/244 (4%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSS 191 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + Sbjct 192 PNEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEA 245 Query 492 IEKY 495 +EK Sbjct 246 LEKL 249 Score = 129 bits (323), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 81/223 (36%), Positives = 127/223 (57%), Gaps = 11/223 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVR 258 I GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+ Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQ 187 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 188 LLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 230 Score = 124 bits (311), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 85/239 (36%), Positives = 119/239 (50%), Gaps = 9/239 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P L S A I DG+ VI GA+ L+ LL+ P+ Sbjct 11 GSELPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQ- 69 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + Sbjct 70 ----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNI 123 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 124 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 183 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 LL++P I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 184 ALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 242 Score = 46.2 bits (108), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 173 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 231 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 232 SHENEKIQKEAQEAL 246
> 4db8_C C Armadillo-repeat Protein
Length=252 Score = 158 bits (399), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 96/244 (39%), Positives = 146/244 (60%), Gaps = 9/244 (4%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSS 191 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + Sbjct 192 PNEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEA 245 Query 492 IEKY 495 +EK Sbjct 246 LEKL 249 Score = 129 bits (323), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 81/223 (36%), Positives = 127/223 (57%), Gaps = 11/223 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVR 258 I GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+ Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQ 187 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 188 LLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 230 Score = 124 bits (311), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 80/211 (38%), Positives = 113/211 (54%), Gaps = 9/211 (4%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR 366 I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G Sbjct 152 EQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG 211 Query 367 QDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +Q Q V G + L + S + K QKEA Sbjct 212 NEQKQAVKEAGALEKLEQLQSHENEKIQKEA 242 Score = 46.6 bits (109), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 173 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 231 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 232 SHENEKIQKEAQEAL 246
> 4db8_B B Armadillo-repeat Protein
Length=252 Score = 158 bits (399), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 96/244 (39%), Positives = 146/244 (60%), Gaps = 9/244 (4%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSS 191 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + Sbjct 192 PNEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEA 245 Query 492 IEKY 495 +EK Sbjct 246 LEKL 249 Score = 129 bits (323), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 81/223 (36%), Positives = 127/223 (57%), Gaps = 11/223 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVR 258 I GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+ Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQ 187 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 188 LLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 230 Score = 124 bits (311), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 80/211 (38%), Positives = 113/211 (54%), Gaps = 9/211 (4%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR 366 I+ AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G Sbjct 152 EQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG 211 Query 367 QDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 +Q Q V G + L + S + K QKEA Sbjct 212 NEQKQAVKEAGALEKLEQLQSHENEKIQKEA 242 Score = 46.6 bits (109), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 173 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 231 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 232 SHENEKIQKEAQEAL 246
> 4db8_D D Armadillo-repeat Protein
Length=252 Score = 158 bits (399), Expect = 7e-43, Method: Compositional matrix adjust. Identities = 96/244 (39%), Positives = 146/244 (60%), Gaps = 9/244 (4%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSS 191 Query 432 KDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSL 491 + +I+ L A+SNI G +K + ++E G L+K+E LQ+HENE + K + Sbjct 192 PNEQILQEALWALSNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEA 245 Query 492 IEKY 495 +EK Sbjct 246 LEKL 249 Score = 128 bits (322), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 81/223 (36%), Positives = 127/223 (57%), Gaps = 11/223 (5%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVR 258 I GA+ L+ LL+ P+ L+ W LSN+ N+ IDA LP LV+ Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQ 187 Query 259 LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 188 LLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 230 Score = 124 bits (311), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 85/239 (36%), Positives = 119/239 (50%), Gaps = 9/239 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P L S A I DG+ VI GA+ L+ LL+ P+ Sbjct 11 GSELPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQ- 69 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ W LSN+ N+ IDA LP LV+LL + ++L + WA+S + Sbjct 70 ----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNI 123 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 124 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALP 183 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA 397 LL++P I +EA W +SNI +G +Q Q V G + L + S + K QKEA Sbjct 184 ALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 242 Score = 46.2 bits (108), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 173 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 231 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 232 SHENEKIQKEAQEAL 246
> 4pls_B B Arm00010
Length=281 Score = 159 bits (401), Expect = 7e-43, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 36 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 94 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 95 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 149 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 150 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 207 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 208 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 267 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 268 KIQKEAQEALEKI 280 Score = 150 bits (380), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 45 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 104 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 105 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 164 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 165 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 223 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 224 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 277 Query 493 EK 494 EK Sbjct 278 EK 279 Score = 150 bits (378), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 143/275 (52%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 58 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N I AV LP LV+LL + ++L + W + + G Sbjct 59 -ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG 115 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 116 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 175 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 176 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 235 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G L L ++ + KI Sbjct 236 GNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 269
> 4pls_D D Arm00010
Length=281 Score = 158 bits (400), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 36 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 94 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 95 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 149 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 150 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 207 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 208 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 267 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 268 KIQKEAQEALEKI 280 Score = 150 bits (380), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 45 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 104 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 105 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 164 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 165 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 223 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 224 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 277 Query 493 EK 494 EK Sbjct 278 EK 279 Score = 149 bits (377), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 143/275 (52%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 58 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N I AV LP LV+LL + ++L + W + + G Sbjct 59 -ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG 115 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 116 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 175 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 176 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 235 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G L L ++ + KI Sbjct 236 GNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 269
> 4pls_C C Arm00010
Length=281 Score = 158 bits (400), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 36 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 94 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 95 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 149 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 150 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 207 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 208 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 267 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 268 KIQKEAQEALEKI 280 Score = 150 bits (380), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 45 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 104 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 105 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 164 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 165 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 223 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 224 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 277 Query 493 EK 494 EK Sbjct 278 EK 279 Score = 149 bits (377), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 143/275 (52%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 58 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N I AV LP LV+LL + ++L + W + + G Sbjct 59 -ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG 115 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 116 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 175 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 176 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 235 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G L L ++ + KI Sbjct 236 GNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 269
> 4pls_A A Arm00010
Length=281 Score = 158 bits (400), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 36 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 94 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 95 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 149 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 150 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 207 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 208 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 267 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 268 KIQKEAQEALEKI 280 Score = 150 bits (380), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 45 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 104 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 105 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 164 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 165 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 223 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 224 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 277 Query 493 EK 494 EK Sbjct 278 EK 279 Score = 149 bits (377), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 97/275 (35%), Positives = 143/275 (52%), Gaps = 10/275 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 58 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N I AV LP LV+LL + ++L + W + + G Sbjct 59 -ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG 115 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 116 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 175 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+W + Sbjct 176 QLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTL 235 Query 402 TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 N SGG EQ + G L L ++ + KI Sbjct 236 GNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 269
> 4plq_A A Arm00011
Length=284 Score = 158 bits (400), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 153 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 270 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 271 KIQKEAQEALEKI 283 Score = 151 bits (381), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 98/278 (35%), Positives = 144/278 (52%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 3 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 61 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N I AV LP LV+LL + ++L + W + + Sbjct 62 ----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNI 115 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 116 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 175 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 176 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 235 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G L L ++ + KI Sbjct 236 WTLGNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 272 Score = 151 bits (381), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 108 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 227 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 280 Query 493 EK 494 EK Sbjct 281 EK 282
> 4plr_A A Arm00008
Length=289 Score = 158 bits (400), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 44 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 102 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 103 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 157 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 158 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 215 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 216 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 275 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 276 KIQKEAQEALEKI 288 Score = 151 bits (381), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 98/278 (35%), Positives = 144/278 (52%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 8 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 66 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N I AV LP LV+LL + ++L + W + + Sbjct 67 ----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNI 120 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 121 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 180 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 181 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 240 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G L L ++ + KI Sbjct 241 WTLGNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 277 Score = 150 bits (380), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 53 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 112 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 113 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 172 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 173 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 231 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 232 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 285 Query 493 EK 494 EK Sbjct 286 EK 287
> 4plr_B B Arm00008
Length=289 Score = 158 bits (400), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 96/253 (38%), Positives = 138/253 (55%), Gaps = 10/253 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV+D GA+PA + LL Sbjct 44 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLL 102 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 103 SSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 157 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 TL N+ N I AV LP LV+LL + ++L + W + + G NE+I V Sbjct 158 TLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAV 215 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT 349 + G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGA L ++P Sbjct 216 IDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNE 275 Query 350 NIQKEATWTMSNI 362 IQKEA + I Sbjct 276 KIQKEAQEALEKI 288 Score = 151 bits (381), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 98/278 (35%), Positives = 144/278 (52%), Gaps = 10/278 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 8 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ- 66 Query 221 LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ N I AV LP LV+LL + ++L + W + + Sbjct 67 ----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNI 120 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 121 ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALP 180 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +QIQ V++ G +P LV +LS + + +EA+ Sbjct 181 ALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEAL 240 Query 399 WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 W + N SGG EQ + G L L ++ + KI Sbjct 241 WTLGNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI 277 Score = 150 bits (380), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 87/242 (36%), Positives = 137/242 (57%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + W + + G NE+I V+ G +P LV+LL + I+ Sbjct 53 LPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 112 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 113 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 172 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 173 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 231 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K ++ +E G +E LQ+ NE + K + + Sbjct 232 NEQILQEALWTLGNIASG----GNEQKQAV--KEAGAEPALEQLQSSPNEKIQKEAQEAL 285 Query 493 EK 494 EK Sbjct 286 EK 287
> 4v3q_B B YIII_M4_AII
Length=247 Score = 156 bits (395), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 91/245 (37%), Positives = 141/245 (58%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G +E+I V+ G +P LV+LL + I+ Sbjct 10 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 69 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 70 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 129 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 130 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 188 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 189 NEQILQEALWTLGNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 242 Query 493 EKYFS 497 EK S Sbjct 243 EKLQS 247 Score = 127 bits (320), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 86/248 (35%), Positives = 124/248 (50%), Gaps = 9/248 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ ++ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G +E+I V+ G +P LV+LL + I+ AL +GNI +G DEQ Q VIDAGAL Sbjct 120 ASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +Q Q V G + L + S + K QKEA Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQ 239 Query 399 WAVTNYTS 406 A+ S Sbjct 240 EALEKLQS 247 Score = 112 bits (281), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 78/225 (35%), Positives = 121/225 (54%), Gaps = 15/225 (7%) Query 81 IVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 13 MVQQLNSPD-QQELQS--ALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ- 68 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 E+ W L NIASG EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G Sbjct 69 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQ 128 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTL 256 VI GA+ L+ LL+ P+ L+ WTL N+ ++ IDA LP L Sbjct 129 AVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPAL 181 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 V+LL + ++L + W + + G NE+ V + G + +L +L Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQL 226 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 169 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 227 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 228 SHENEKIQKEAQEAL 242
> 4v3q_A A YIII_M4_AII
Length=247 Score = 156 bits (395), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 91/245 (37%), Positives = 141/245 (58%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G +E+I V+ G +P LV+LL + I+ Sbjct 10 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 69 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 70 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 129 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 130 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 188 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 189 NEQILQEALWTLGNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 242 Query 493 EKYFS 497 EK S Sbjct 243 EKLQS 247 Score = 127 bits (320), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 86/248 (35%), Positives = 124/248 (50%), Gaps = 9/248 (4%) Query 161 GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS 220 G +P + L SP + A+ L IA G VI GA+ L+ LL+ P+ Sbjct 7 GSELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQ- 65 Query 221 LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 L+ WTL N+ ++ IDA LP LV+LL + ++L + W + + Sbjct 66 ----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNI 119 Query 279 TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA 338 G +E+I V+ G +P LV+LL + I+ AL +GNI +G DEQ Q VIDAGAL Sbjct 120 ASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALP 179 Query 339 VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV 398 LL++P I +EA WT+ NI +G +Q Q V G + L + S + K QKEA Sbjct 180 ALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQ 239 Query 399 WAVTNYTS 406 A+ S Sbjct 240 EALEKLQS 247 Score = 112 bits (281), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 78/225 (35%), Positives = 121/225 (54%), Gaps = 15/225 (7%) Query 81 IVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 13 MVQQLNSPD-QQELQS--ALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ- 68 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 E+ W L NIASG EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G Sbjct 69 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQ 128 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTL 256 VI GA+ L+ LL+ P+ L+ WTL N+ ++ IDA LP L Sbjct 129 AVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPAL 181 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 V+LL + ++L + W + + G NE+ V + G + +L +L Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQL 226 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 169 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 227 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 228 SHENEKIQKEAQEAL 242
> 4v3q_C C YIII_M4_AII
Length=247 Score = 155 bits (392), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 90/243 (37%), Positives = 140/243 (58%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G +E+I V+ G +P LV+LL + I+ Sbjct 10 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 69 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 70 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 129 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 130 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 188 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 189 NEQILQEALWTLGNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 242 Query 493 EKY 495 EK Sbjct 243 EKL 245 Score = 112 bits (281), Expect = 7e-27, Method: Compositional matrix adjust. Identities = 78/225 (35%), Positives = 121/225 (54%), Gaps = 15/225 (7%) Query 81 IVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 13 MVQQLNSPD-QQELQS--ALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ- 68 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 E+ W L NIASG EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G Sbjct 69 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQ 128 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTL 256 VI GA+ L+ LL+ P+ L+ WTL N+ ++ IDA LP L Sbjct 129 AVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPAL 181 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 V+LL + ++L + W + + G NE+ V + G + +L +L Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQL 226 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 169 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 227 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 228 SHENEKIQKEAQEAL 242
> 4v3q_D D YIII_M4_AII
Length=247 Score = 155 bits (391), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 90/242 (37%), Positives = 140/242 (58%), Gaps = 7/242 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G +E+I V+ G +P LV+LL + I+ Sbjct 10 LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQE 69 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G DEQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 70 ALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQA 129 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 130 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSP 188 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 189 NEQILQEALWTLGNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 242 Query 493 EK 494 EK Sbjct 243 EK 244 Score = 112 bits (281), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 78/225 (35%), Positives = 121/225 (54%), Gaps = 15/225 (7%) Query 81 IVKGINSSNVENQLQATQAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +V+ +NS + + +LQ+ A RKL ++ I +I AG +P V L + +Q Sbjct 13 MVQQLNSPD-QQELQS--ALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQ- 68 Query 139 ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD 198 E+ W L NIASG EQ +AV+D GA+PA + LL+SP+ I ++A+W LGNIA G Sbjct 69 EALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQ 128 Query 199 LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTL 256 VI GA+ L+ LL+ P+ L+ WTL N+ ++ IDA LP L Sbjct 129 AVIDAGALPALVQLLSSPNEQ-----ILQEALWTLGNIASGGDEQIQAVIDAG--ALPAL 181 Query 257 VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 V+LL + ++L + W + + G NE+ V + G + +L +L Sbjct 182 VQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQL 226 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 169 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 227 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 228 SHENEKIQKEAQEAL 242
> 6sa6_A A DARPin-Armadillo fusion A5
Length=397 Score = 154 bits (389), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 90/245 (37%), Positives = 140/245 (57%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 L LV L+ +D +++ + W + G N RI V+ G +P LV+LL + I+ Sbjct 159 LAALVLKLNANDDQIIQEALWKLGNHASGGNLRIQWVIDAGALPALVQLLSSPNEQILQE 218 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL +GNI +G +EQ Q VIDAGAL LL++P I +EA WT+ NI +G +QIQ Sbjct 219 ALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQA 278 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+W + N SGG EQI ++ G + L+ LL++ Sbjct 279 VIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSP 337 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 + +I+ L + NI G +K + ++E G L+K+E LQ+HENE + K + + Sbjct 338 NEQILQEALWTLGNIASG----GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEAL 391 Query 493 EKYFS 497 EK S Sbjct 392 EKLQS 396 Score = 136 bits (343), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 89/243 (37%), Positives = 129/243 (53%), Gaps = 10/243 (4%) Query 115 IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP 174 + R + V L D IQ E+ W L N ASG + + + V+D GA+PA + LL+SP Sbjct 153 VARLAELAALVLKLNANDDQIIQ-EALWKLGNHASGGNLRIQWVIDAGALPALVQLLSSP 211 Query 175 HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 + I ++A+W LGNIA G+ VI GA+ L+ LL+ P+ L+ WTL Sbjct 212 NEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWTLG 266 Query 235 NLCRNKNP--APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 N+ N IDA LP LV+LL + ++L + W + + G NE+I V+ Sbjct 267 NIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDA 324 Query 293 GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ 352 G +P LV+LL + I+ AL +GNI +G +EQ Q V +AGAL L ++ IQ Sbjct 325 GALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 384 Query 353 KEA 355 KEA Sbjct 385 KEA 387 Score = 131 bits (330), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 87/245 (36%), Positives = 127/245 (52%), Gaps = 9/245 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 + A + L + I ++A+W LGN A G++ VI GA+ L+ LL+ P+ Sbjct 159 LAALVLKLNANDDQIIQEALWKLGNHASGGNLRIQWVIDAGALPALVQLLSSPNEQ---- 214 Query 224 GYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ WTL N+ N IDA LP LV+LL + ++L + W + + G Sbjct 215 -ILQEALWTLGNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWTLGNIASG 271 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL +GNI +G +EQ Q VIDAGAL Sbjct 272 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALV 331 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA WT+ NI +G +Q Q V G + L + S + K QKEA A+ Sbjct 332 QLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEAL 391 Query 402 TNYTS 406 S Sbjct 392 EKLQS 396 Score = 61.2 bits (147), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 46/157 (29%), Positives = 81/157 (52%), Gaps = 7/157 (4%) Query 351 IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV 410 I +EA W + N +G +IQ V++ G +P LV +LS + + +EA+W + N SGG Sbjct 173 IIQEALWKLGNHASGGNLRIQWVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN- 231 Query 411 EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 EQI ++ G + L+ LL++ + +I+ L + NI G E++ +I + G L Sbjct 232 EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIAS-----GGNEQIQAVI-DAGAL 285 Query 471 DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVV 507 + L + NE + + +L + S E+ Q V+ Sbjct 286 PALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVI 322 Score = 42.4 bits (98), Expect = 0.005, Method: Compositional matrix adjust. Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ W L NIASG +EQ +AV + GA+ L Sbjct 318 IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQKQAVKEAGALEKLEQLQ 376 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 377 SHENEKIQKEAQEAL 391
> 5mfg_D D YIIIM5AII
Length=286 Score = 151 bits (382), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 93/247 (38%), Positives = 136/247 (55%), Gaps = 9/247 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ VI GA+ L+ LL+ P+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ---- 61 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDG 281 L+ W LSN+ N I AV LP LV+LL + ++L + WA+S + G Sbjct 62 -ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 282 PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP 341 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAGAL Sbjct 119 GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV 178 Query 342 SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 LL++P I +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA+ Sbjct 179 QLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL 238 Query 402 TNYTSGG 408 +N SGG Sbjct 239 SNIASGG 245 Score = 150 bits (378), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 80/195 (41%), Positives = 122/195 (63%), Gaps = 1/195 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQI ++ G + L+ LL++ Sbjct 168 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSP 226 Query 433 DTKIILVILDAISNI 447 + +I+ L A+SNI Sbjct 227 NEQILQEALWALSNI 241 Score = 138 bits (347), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 84/214 (39%), Positives = 122/214 (57%), Gaps = 10/214 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV 289 LSN+ N I AV LP LV+LL + ++L + WA+S + G NE+I V Sbjct 153 ALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 210 Query 290 VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTG 323 + G +P LV+LL + I+ AL A+ NI +G Sbjct 211 IDAGALPALVQLLSSPNEQILQEALWALSNIASG 244 Score = 79.3 bits (194), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 1/82 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 165 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 223 Query 172 ASPHAHISEQAVWALGNIAGDG 193 +SP+ I ++A+WAL NIA G Sbjct 224 SSPNEQILQEALWALSNIASGG 245 Score = 38.5 bits (88), Expect = 0.086, Method: Compositional matrix adjust. Identities = 34/129 (26%), Positives = 64/129 (50%), Gaps = 7/129 (5%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 +P +V L+ D + + A+ ++ SGG EQI ++ G + L+ LL++ + +I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQ 64 Query 439 VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV 498 L A+SNI G E++ +I + G L + L + NE + + +L + S Sbjct 65 EALWALSNIAS-----GGNEQIQAVI-DAGALPALVQLLSSPNEQILQEALWALSNIASG 118 Query 499 EEEEDQNVV 507 E+ Q V+ Sbjct 119 GNEQIQAVI 127
> 5mfk_B B YIII(Dq.V1)4CPAF
Length=243 Score = 143 bits (360), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/245 (35%), Positives = 135/245 (55%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKYFS 497 E + S Sbjct 239 EAFNS 243 Score = 114 bits (286), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 125/251 (50%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ + S Sbjct 233 NAQAALEAFNS 243 Score = 90.5 bits (223), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.012, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 4d49_A A ARMADILLO REPEAT PROTEIN ARM00027
Length=243 Score = 142 bits (359), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/245 (35%), Positives = 135/245 (55%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKYFS 497 E + S Sbjct 239 EAFNS 243 Score = 114 bits (285), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 125/251 (50%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ + S Sbjct 233 NAQAALEAFNS 243 Score = 90.1 bits (222), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 4d49_B B ARMADILLO REPEAT PROTEIN ARM00027
Length=243 Score = 142 bits (359), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/245 (35%), Positives = 135/245 (55%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKYFS 497 E + S Sbjct 239 EAFNS 243 Score = 114 bits (285), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 125/251 (50%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ + S Sbjct 233 NAQAALEAFNS 243 Score = 90.1 bits (222), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 4d49_E E ARMADILLO REPEAT PROTEIN ARM00027
Length=243 Score = 142 bits (359), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/245 (35%), Positives = 135/245 (55%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKYFS 497 E + S Sbjct 239 EAFNS 243 Score = 114 bits (285), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 125/251 (50%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ + S Sbjct 233 NAQAALEAFNS 243 Score = 90.1 bits (222), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 4d49_F F ARMADILLO REPEAT PROTEIN ARM00027
Length=243 Score = 142 bits (359), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/245 (35%), Positives = 135/245 (55%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKYFS 497 E + S Sbjct 239 EAFNS 243 Score = 114 bits (285), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 125/251 (50%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ + S Sbjct 233 NAQAALEAFNS 243 Score = 90.1 bits (222), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 5mfk_A A YIII(Dq.V1)4CPAF
Length=243 Score = 142 bits (357), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 84/243 (35%), Positives = 134/243 (55%), Gaps = 7/243 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + KEA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + KEAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 185 SEEVIKEAVWAIANIASGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 238 Query 493 EKY 495 E + Sbjct 239 EAF 241 Score = 112 bits (281), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 77/250 (31%), Positives = 124/250 (50%), Gaps = 21/250 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIKEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + KEA W ++NI +G + Q++ G +P L + S A+ + QK Sbjct 173 ALSPLVKLLDDASEEVIKEAVWAIANIASGNNEMKQKLEEAGALPALEKLQSHANEEVQK 232 Query 396 EAVWAVTNYT 405 A A+ + Sbjct 233 NAQAALEAFN 242 Score = 90.1 bits (222), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIKEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E + + G +P L KL Sbjct 205 EMKQKLEEAGALPALEKL 222 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L I+ E+ WA+ NIASG +E + + + GA+PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIK-EAVWAIANIASGNNEMKQKLEEAGALPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 + + + + A AL Sbjct 224 SHANEEVQKNAQAAL 238
> 4db6_A A Armadillo repeat protein
Length=210 Score = 136 bits (343), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 78/203 (38%), Positives = 123/203 (61%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L+K+E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLE 186 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+HENE + K + +EK S Sbjct 187 QLQSHENEKIQKEAQEALEKLQS 209 Score = 131 bits (329), Expect = 8e-34, Method: Compositional matrix adjust. Identities = 72/184 (39%), Positives = 108/184 (59%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L L + + Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSHE 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 112 bits (280), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 73/191 (38%), Positives = 101/191 (53%), Gaps = 5/191 (3%) Query 216 PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI 275 PD L LR L+ S N+ IDA LP LV+LL + ++L + WA+ Sbjct 24 PDQQELQSA-LRKLSQIASG--GNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWAL 78 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 S + G NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q VIDAG Sbjct 79 SNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAG 138 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL LL++P I +EA W +SNI +G +Q Q V G + L + S + K QK Sbjct 139 ALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQK 198 Query 396 EAVWAVTNYTS 406 EA A+ S Sbjct 199 EAQEALEKLQS 209 Score = 98.2 bits (243), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 59/167 (35%), Positives = 89/167 (53%), Gaps = 6/167 (4%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL 278 LSN+ N L L +L H++ ++ + A+ L Sbjct 161 ALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKL 207
> 5mfi_B B YIII(Dq.V2)4CqI
Length=243 Score = 132 bits (332), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + +EA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + +EAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI G E++ +EE G +E LQ+ NE V K + + + Sbjct 185 SEEVIQEAVWAIANIAS-----GNNEQIQ-KLEEAGAEPALEKLQSSPNEEVQKNAQAAL 238 Query 493 EKYFS 497 E S Sbjct 239 EALNS 243 Score = 112 bits (280), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIQEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + +EA W ++NI +G +QIQ++ G P L + S + + QK Sbjct 173 ALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLEEAGAEPALEKLQSSPNEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ S Sbjct 233 NAQAALEALNS 243 Score = 94.7 bits (234), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 63/198 (32%), Positives = 96/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIQEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E+I + + G P L KL Sbjct 205 EQIQKLEEAGAEPALEKL 222 Score = 48.1 bits (113), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + + + GA PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLEEAGAEPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 +SP+ + + A AL Sbjct 224 SSPNEEVQKNAQAAL 238
> 5mfj_B B YIII(Dq.V2)4CqI
Length=243 Score = 132 bits (332), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + +EA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + +EAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI G E++ +EE G +E LQ+ NE V K + + + Sbjct 185 SEEVIQEAVWAIANIAS-----GNNEQIQ-KLEEAGAEPALEKLQSSPNEEVQKNAQAAL 238 Query 493 EKYFS 497 E S Sbjct 239 EALNS 243 Score = 112 bits (280), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIQEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + +EA W ++NI +G +QIQ++ G P L + S + + QK Sbjct 173 ALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLEEAGAEPALEKLQSSPNEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ S Sbjct 233 NAQAALEALNS 243 Score = 94.7 bits (234), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 63/198 (32%), Positives = 96/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIQEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E+I + + G P L KL Sbjct 205 EQIQKLEEAGAEPALEKL 222 Score = 48.1 bits (113), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + + + GA PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLEEAGAEPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 +SP+ + + A AL Sbjct 224 SSPNEEVQKNAQAAL 238
> 5mfj_A A YIII(Dq.V2)4CqI
Length=243 Score = 132 bits (332), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + +EA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + +EAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI G E++ +EE G +E LQ+ NE V K + + + Sbjct 185 SEEVIQEAVWAIANIAS-----GNNEQIQ-KLEEAGAEPALEKLQSSPNEEVQKNAQAAL 238 Query 493 EKYFS 497 E S Sbjct 239 EALNS 243 Score = 112 bits (280), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIQEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + +EA W ++NI +G +QIQ++ G P L + S + + QK Sbjct 173 ALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLEEAGAEPALEKLQSSPNEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ S Sbjct 233 NAQAALEALNS 243 Score = 94.4 bits (233), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 63/198 (32%), Positives = 96/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIQEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E+I + + G P L KL Sbjct 205 EQIQKLEEAGAEPALEKL 222 Score = 48.1 bits (113), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + + + GA PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLEEAGAEPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 +SP+ + + A AL Sbjct 224 SSPNEEVQKNAQAAL 238
> 5mfi_A A YIII(Dq.V2)4CqI
Length=243 Score = 132 bits (332), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI +G +EQ Q +I+AGAL+ LL + + +EA W ++NI +G +QIQ+ Sbjct 66 AVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + +EAVWA+ N SG EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI G E++ +EE G +E LQ+ NE V K + + + Sbjct 185 SEEVIQEAVWAIANIAS-----GNNEQIQ-KLEEAGAEPALEKLQSSPNEEVQKNAQAAL 238 Query 493 EKYFS 497 E S Sbjct 239 EALNS 243 Score = 112 bits (280), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 21/251 (8%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL--DDASE--- 60 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAI 275 ++ W ++N+ N EQI L LV+LL EV+ + WAI Sbjct 61 EVIQEAVWAIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAI 112 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G NE+I +++ G + LVKLL + ++ A+ AI NI +G +EQ Q +I+AG Sbjct 113 ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAG 172 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK 395 AL+ LL + + +EA W ++NI +G +QIQ++ G P L + S + + QK Sbjct 173 ALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLEEAGAEPALEKLQSSPNEEVQK 232 Query 396 EAVWAVTNYTS 406 A A+ S Sbjct 233 NAQAALEALNS 243 Score = 94.4 bits (233), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 63/198 (32%), Positives = 96/198 (48%), Gaps = 22/198 (11%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + +++ GA+ + LL Sbjct 39 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLIEAGALSPLVKLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 + ++AVWA+ NIA + +I+ GA+ PL+ LL D S ++ W Sbjct 98 DDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLL--DDASE---EVIQEAVW 152 Query 232 TLSNLCRNKNPAPPIDAVEQI--------LPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 ++N+ N EQI L LV+LL EV+ + WAI+ + G N Sbjct 153 AIANIASGNN--------EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN 204 Query 284 ERIGMVVKTGVVPQLVKL 301 E+I + + G P L KL Sbjct 205 EQIQKLEEAGAEPALEKL 222 Score = 48.1 bits (113), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG + V L IQ E+ WA+ NIASG +EQ + + + GA PA L Sbjct 165 IQKLIEAGALSPLVKLLDDASEEVIQ-EAVWAIANIASGNNEQIQKLEEAGAEPALEKLQ 223 Query 172 ASPHAHISEQAVWAL 186 +SP+ + + A AL Sbjct 224 SSPNEEVQKNAQAAL 238
> 4rzp_A A Engineered Protein OR366
Length=252 Score = 130 bits (326), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 80/245 (33%), Positives = 129/245 (53%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 L LV LL HDD + + ++ + G I V+ G + +LV+LL + + Sbjct 4 LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDDSKVQQE 63 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A RA+ NI +G DE + VIDAGAL LLT+ + +Q+EA ++NI +G + I+Q Sbjct 64 AARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQ 123 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G + LV +L+ D K Q+EA A+ N SG E I ++ G +E L+ LLT Sbjct 124 VIDAGALEKLVELLTHDDSKVQQEAARALANIASGND-EAIKQVIDAGALEKLVELLTHD 182 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 D+K+ A++NI G T + +I + G L+K++ L H++ V + + + Sbjct 183 DSKVQQEAARALANIAS-----GNTSAIKQVI-DAGALEKLQELLTHDDSKVQQEAQRAL 236 Query 493 EKYFS 497 E S Sbjct 237 ENIKS 241 Score = 120 bits (300), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 80/247 (32%), Positives = 124/247 (50%), Gaps = 11/247 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIA-GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA 222 + + LL + ++A L IA G+ S + VI GA++ L+ LL D Sbjct 4 LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQ-VIDAGALEKLVELLTHDD----- 57 Query 223 CGYLRNLTWTLSNLCRNKNPAPP--IDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD 280 + L+N+ + A IDA L LV LL HDD +V + A++ + Sbjct 58 SKVQQEAARALANIASGNDEAIKQVIDA--GALEKLVELLTHDDSKVQQEAARALANIAS 115 Query 281 GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF 340 G +E I V+ G + +LV+LL + + A RA+ NI +G DE + VIDAGAL Sbjct 116 GNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKL 175 Query 341 PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWA 400 LLT+ + +Q+EA ++NI +G I+QV++ G + L +L+ D K Q+EA A Sbjct 176 VELLTHDDSKVQQEAARALANIASGNTSAIKQVIDAGALEKLQELLTHDDSKVQQEAQRA 235 Query 401 VTNYTSG 407 + N SG Sbjct 236 LENIKSG 242 Score = 115 bits (288), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 80/270 (30%), Positives = 118/270 (44%), Gaps = 50/270 (19%) Query 98 QAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT 155 +AAR L ++ I +I AG + K V L D S +Q E+A AL NIASG E Sbjct 21 EAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDD-SKVQQEAARALANIASGNDEAI 79 Query 156 KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV 215 K V+D GA+ + LL + + ++A AL NIA VI GA++ L+ LL Sbjct 80 KQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKLVELLT- 138 Query 216 PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI 275 HDD +V + A+ Sbjct 139 ----------------------------------------------HDDSKVQQEAARAL 152 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G +E I V+ G + +LV+LL + + A RA+ NI +G + VIDAG Sbjct 153 ANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNTSAIKQVIDAG 212 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAG 365 AL LLT+ + +Q+EA + NI +G Sbjct 213 ALEKLQELLTHDDSKVQQEAQRALENIKSG 242
> 4rzp_B B Engineered Protein OR366
Length=252 Score = 130 bits (326), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 80/245 (33%), Positives = 129/245 (53%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 L LV LL HDD + + ++ + G I V+ G + +LV+LL + + Sbjct 4 LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDDSKVQQE 63 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A RA+ NI +G DE + VIDAGAL LLT+ + +Q+EA ++NI +G + I+Q Sbjct 64 AARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQ 123 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G + LV +L+ D K Q+EA A+ N SG E I ++ G +E L+ LLT Sbjct 124 VIDAGALEKLVELLTHDDSKVQQEAARALANIASGND-EAIKQVIDAGALEKLVELLTHD 182 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 D+K+ A++NI G T + +I + G L+K++ L H++ V + + + Sbjct 183 DSKVQQEAARALANIAS-----GNTSAIKQVI-DAGALEKLQELLTHDDSKVQQEAQRAL 236 Query 493 EKYFS 497 E S Sbjct 237 ENIKS 241 Score = 120 bits (300), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 80/247 (32%), Positives = 124/247 (50%), Gaps = 11/247 (4%) Query 164 IPAFISLLASPHAHISEQAVWALGNIA-GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA 222 + + LL + ++A L IA G+ S + VI GA++ L+ LL D Sbjct 4 LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQ-VIDAGALEKLVELLTHDD----- 57 Query 223 CGYLRNLTWTLSNLCRNKNPAPP--IDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD 280 + L+N+ + A IDA L LV LL HDD +V + A++ + Sbjct 58 SKVQQEAARALANIASGNDEAIKQVIDA--GALEKLVELLTHDDSKVQQEAARALANIAS 115 Query 281 GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF 340 G +E I V+ G + +LV+LL + + A RA+ NI +G DE + VIDAGAL Sbjct 116 GNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKL 175 Query 341 PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWA 400 LLT+ + +Q+EA ++NI +G I+QV++ G + L +L+ D K Q+EA A Sbjct 176 VELLTHDDSKVQQEAARALANIASGNTSAIKQVIDAGALEKLQELLTHDDSKVQQEAQRA 235 Query 401 VTNYTSG 407 + N SG Sbjct 236 LENIKSG 242 Score = 115 bits (288), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 80/270 (30%), Positives = 118/270 (44%), Gaps = 50/270 (19%) Query 98 QAARKL--LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT 155 +AAR L ++ I +I AG + K V L D S +Q E+A AL NIASG E Sbjct 21 EAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDD-SKVQQEAARALANIASGNDEAI 79 Query 156 KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV 215 K V+D GA+ + LL + + ++A AL NIA VI GA++ L+ LL Sbjct 80 KQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKLVELLT- 138 Query 216 PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI 275 HDD +V + A+ Sbjct 139 ----------------------------------------------HDDSKVQQEAARAL 152 Query 276 SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG 335 + + G +E I V+ G + +LV+LL + + A RA+ NI +G + VIDAG Sbjct 153 ANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNTSAIKQVIDAG 212 Query 336 ALAVFPSLLTNPKTNIQKEATWTMSNITAG 365 AL LLT+ + +Q+EA + NI +G Sbjct 213 ALEKLQELLTHDDSKVQQEAQRALENIKSG 242
> 4dba_A A Designed Armadillo repeat protein, YIIM3AII
Length=210 Score = 128 bits (322), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 74/201 (37%), Positives = 119/201 (59%), Gaps = 7/201 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+ + L + ++ A R I++ +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L+K+E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLE 186 Query 475 ALQNHENESVYKASLSLIEKY 495 LQ+HENE + K + +EK Sbjct 187 QLQSHENEKIQKEAQEALEKL 207 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 3/185 (2%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L L + Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSH 191 Query 432 KDTKI 436 ++ KI Sbjct 192 ENEKI 196 Score = 110 bits (276), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 0/145 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 56 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 115 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 116 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 175 Query 373 VVNHGLVPFLVSVLSKADFKTQKEA 397 V G + L + S + K QKEA Sbjct 176 VKEAGALEKLEQLQSHENEKIQKEA 200 Score = 105 bits (261), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 I GA+ L+ LL+ P+ L+ W LSN+ N L L +L Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 189 Query 261 HHDDPEVLADTCWAISYL 278 H++ ++ + A+ L Sbjct 190 SHENEKIQKEAQEALEKL 207 Score = 94.0 bits (232), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 62/169 (37%), Positives = 89/169 (53%), Gaps = 9/169 (5%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 I+ AL A+ NI +G +EQ Q V +AGAL L ++ IQKEA Sbjct 152 EQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 200
> 4dba_D D Designed Armadillo repeat protein, YIIM3AII
Length=210 Score = 128 bits (322), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 74/201 (37%), Positives = 119/201 (59%), Gaps = 7/201 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+ + L + ++ A R I++ +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L+K+E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLE 186 Query 475 ALQNHENESVYKASLSLIEKY 495 LQ+HENE + K + +EK Sbjct 187 QLQSHENEKIQKEAQEALEKL 207 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 3/185 (2%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L L + Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSH 191 Query 432 KDTKI 436 ++ KI Sbjct 192 ENEKI 196 Score = 110 bits (276), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 0/145 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 56 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 115 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 116 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 175 Query 373 VVNHGLVPFLVSVLSKADFKTQKEA 397 V G + L + S + K QKEA Sbjct 176 VKEAGALEKLEQLQSHENEKIQKEA 200 Score = 105 bits (261), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 I GA+ L+ LL+ P+ L+ W LSN+ N L L +L Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 189 Query 261 HHDDPEVLADTCWAISYL 278 H++ ++ + A+ L Sbjct 190 SHENEKIQKEAQEALEKL 207 Score = 94.0 bits (232), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 62/169 (37%), Positives = 89/169 (53%), Gaps = 9/169 (5%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 I+ AL A+ NI +G +EQ Q V +AGAL L ++ IQKEA Sbjct 152 EQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 200
> 4dba_C C Designed Armadillo repeat protein, YIIM3AII
Length=210 Score = 128 bits (322), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 74/201 (37%), Positives = 119/201 (59%), Gaps = 7/201 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+ + L + ++ A R I++ +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L+K+E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLE 186 Query 475 ALQNHENESVYKASLSLIEKY 495 LQ+HENE + K + +EK Sbjct 187 QLQSHENEKIQKEAQEALEKL 207 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 3/185 (2%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L L + Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSH 191 Query 432 KDTKI 436 ++ KI Sbjct 192 ENEKI 196 Score = 110 bits (276), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 0/145 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 56 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 115 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 116 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 175 Query 373 VVNHGLVPFLVSVLSKADFKTQKEA 397 V G + L + S + K QKEA Sbjct 176 VKEAGALEKLEQLQSHENEKIQKEA 200 Score = 105 bits (261), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 I GA+ L+ LL+ P+ L+ W LSN+ N L L +L Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 189 Query 261 HHDDPEVLADTCWAISYL 278 H++ ++ + A+ L Sbjct 190 SHENEKIQKEAQEALEKL 207 Score = 94.0 bits (232), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 62/169 (37%), Positives = 89/169 (53%), Gaps = 9/169 (5%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 I+ AL A+ NI +G +EQ Q V +AGAL L ++ IQKEA Sbjct 152 EQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 200
> 4dba_B B Designed Armadillo repeat protein, YIIM3AII
Length=210 Score = 128 bits (322), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 74/201 (37%), Positives = 119/201 (59%), Gaps = 7/201 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+ + L + ++ A R I++ +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L+K+E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLE 186 Query 475 ALQNHENESVYKASLSLIEKY 495 LQ+HENE + K + +EK Sbjct 187 QLQSHENEKIQKEAQEALEKL 207 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 3/185 (2%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 72 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ 371 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 73 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQ 132 Query 372 QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA 431 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L L + Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSH 191 Query 432 KDTKI 436 ++ KI Sbjct 192 ENEKI 196 Score = 110 bits (276), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 0/145 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 56 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 115 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 116 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 175 Query 373 VVNHGLVPFLVSVLSKADFKTQKEA 397 V G + L + S + K QKEA Sbjct 176 VKEAGALEKLEQLQSHENEKIQKEA 200 Score = 105 bits (261), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 17 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 74 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV 200 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ V Sbjct 75 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAV 134 Query 201 IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL 260 I GA+ L+ LL+ P+ L+ W LSN+ N L L +L Sbjct 135 IDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 189 Query 261 HHDDPEVLADTCWAISYL 278 H++ ++ + A+ L Sbjct 190 SHENEKIQKEAQEALEKL 207 Score = 94.0 bits (232), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 62/169 (37%), Positives = 89/169 (53%), Gaps = 9/169 (5%) Query 189 IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKNPAPPI 246 I DG+ VI GA+ L+ LL+ P+ L+ W LSN+ N+ I Sbjct 39 ILSDGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVI 93 Query 247 DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE 306 DA LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + Sbjct 94 DAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 151 Query 307 LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA 355 I+ AL A+ NI +G +EQ Q V +AGAL L ++ IQKEA Sbjct 152 EQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA 200
> 4hxt_A A De Novo Protein OR329
Length=256 Score = 129 bits (323), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 91/292 (31%), Positives = 135/292 (46%), Gaps = 48/292 (16%) Query 121 IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE 180 + K V L TD S Q E+A L IASG + KA+VD G + + LL S + + + Sbjct 4 VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 181 QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK 240 +A AL NIA P A+ A+ D + Sbjct 63 EAARALANIASG---------------PDEAIKAIVDAGGV------------------- 88 Query 241 NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK 300 LV+LL D EV + A++ + GP+E I +V G V LVK Sbjct 89 -------------EVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 135 Query 301 LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS 360 LL +++ + A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA ++ Sbjct 136 LLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALA 195 Query 361 NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ 412 NI +G I+ +V+ G V L +L+ D + QKEA A+ N SGG +E Sbjct 196 NIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENIKSGGWLEH 247 Score = 122 bits (305), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 72/198 (36%), Positives = 111/198 (56%), Gaps = 3/198 (2%) Query 241 NPAPPIDAVEQI--LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL 298 PA I A+ + LV+LL D EV + A++ + GP+E I +V G V L Sbjct 32 GPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVL 91 Query 299 VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT 358 VKLL +++ + A RA+ NI +G DE + ++DAG + V LLT+ + +QKEA Sbjct 92 VKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARA 151 Query 359 MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH 418 ++NI +G + I+ +V+ G V LV +L+ D + QKEA A+ N SG T I +V Sbjct 152 LANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVD 210 Query 419 CGIIEPLMNLLTAKDTKI 436 G +E L LLT+ D+++ Sbjct 211 AGGVEVLQKLLTSTDSEV 228 Score = 110 bits (275), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 88/290 (30%), Positives = 130/290 (45%), Gaps = 53/290 (18%) Query 78 VDDIVKGINSSNVENQLQATQAARKLLSREKQPP--IDNIIRAGLIPKFVSFLGRTDCSP 135 V+ +VK + S++ E Q +AAR L P I I+ AG + V L TD S Sbjct 4 VEKLVKLLTSTDSETQ---KEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTD-SE 59 Query 136 IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 +Q E+A AL NIASG E KA+VD G + + LL S + + ++A AL NIA Sbjct 60 VQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDE 119 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 ++ G V+ L+ L LT T Sbjct 120 AIKAIVDAGGVEVLVKL----------------LTST----------------------- 140 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 D EV + A++ + GP+E I +V G V LVKLL +++ + A R Sbjct 141 --------DSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAAR 192 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG 365 A+ NI +G + ++DAG + V LLT+ + +QKEA + NI +G Sbjct 193 ALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENIKSG 242 Score = 60.8 bits (146), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 14/144 (10%) Query 52 NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP- 110 N++S PD+A + + V+ +VK + S++ E Q +AAR L + P Sbjct 112 NIASGPDEAIKAIVDA--------GGVEVLVKLLTSTDSEVQ---KEAARALANIASGPD 160 Query 111 -PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS 169 I I+ AG + V L TD S +Q E+A AL NIASG + KA+VD G + Sbjct 161 EAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQK 219 Query 170 LLASPHAHISEQAVWALGNIAGDG 193 LL S + + ++A AL NI G Sbjct 220 LLTSTDSEVQKEAQRALENIKSGG 243 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 24/69 (35%), Positives = 37/69 (54%), Gaps = 1/69 (1%) Query 379 VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL 438 V LV +L+ D +TQKEA + SG I +V G +E L+ LLT+ D+++ Sbjct 4 VEKLVKLLTSTDSETQKEAARDLAEIASG-PASAIKAIVDAGGVEVLVKLLTSTDSEVQK 62 Query 439 VILDAISNI 447 A++NI Sbjct 63 EAARALANI 71
> 5mfo_A A YIIIM3AIII
Length=202 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 123 bits (309), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+ NE + K + +EK S Sbjct 179 QLQSSPNEKIQKEAQEALEKIQS 201 Score = 114 bits (285), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 0/154 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 V G P L + S + K QKEA A+ S Sbjct 168 VKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQS 201 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 56.2 bits (134), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 5mfo_C C YIIIM3AIII
Length=202 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 123 bits (309), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+ NE + K + +EK S Sbjct 179 QLQSSPNEKIQKEAQEALEKIQS 201 Score = 114 bits (285), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 0/154 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 V G P L + S + K QKEA A+ S Sbjct 168 VKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQS 201 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 56.2 bits (134), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 5mfo_B B YIIIM3AIII
Length=202 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 123 bits (309), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+ NE + K + +EK S Sbjct 179 QLQSSPNEKIQKEAQEALEKIQS 201 Score = 114 bits (285), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 0/154 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 V G P L + S + K QKEA A+ S Sbjct 168 VKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQS 201 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 56.2 bits (134), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 5mfo_F F YIIIM3AIII
Length=202 Score = 126 bits (317), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 123 bits (309), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+ NE + K + +EK S Sbjct 179 QLQSSPNEKIQKEAQEALEKIQS 201 Score = 114 bits (285), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 0/154 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 V G P L + S + K QKEA A+ S Sbjct 168 VKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQS 201 Score = 96.3 bits (238), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 84.7 bits (208), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 55.8 bits (133), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 5mfo_E E YIIIM3AIII
Length=202 Score = 126 bits (316), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 123 bits (309), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 7/203 (3%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEKYFS 497 LQ+ NE + K + +EK S Sbjct 179 QLQSSPNEKIQKEAQEALEKIQS 201 Score = 114 bits (284), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 0/154 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP LV+LL + ++L + WA+S + G NE+I V+ G +P LV+LL + I+ Sbjct 48 LPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 107 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q Sbjct 108 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQA 167 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS 406 V G P L + S + K QKEA A+ S Sbjct 168 VKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQS 201 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 56.2 bits (134), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 5mfo_D D YIIIM3AIII
Length=202 Score = 126 bits (316), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 126 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 184 Query 433 DTKI 436 + KI Sbjct 185 NEKI 188 Score = 122 bits (307), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 65 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 66 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 124 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 125 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 178 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 179 QLQSSPNEKIQKEAQEALEK 198 Score = 96.3 bits (238), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 39 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 97 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 98 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 152 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 153 ALSNIASGGN 162 Score = 84.7 bits (208), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 81 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 139 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 140 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 185 Score = 55.8 bits (133), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 123 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 181 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 182 SSPNEKIQKEAQEALEKI 199
> 4db9_F F Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 4db9_E E Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 4db9_C C Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 4db9_B B Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 4db9_A A Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 4db9_D D Armadillo repeat protein, YIIIM3AIII
Length=210 Score = 126 bits (316), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 1/184 (1%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I V+ G +P LV+LL + I+ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G +QIQ Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 V++ G +P LV +LS + + +EA+WA++N SGG EQ + G L L ++ Sbjct 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSP 192 Query 433 DTKI 436 + KI Sbjct 193 NEKI 196 Score = 122 bits (307), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 73/200 (37%), Positives = 117/200 (59%), Gaps = 7/200 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +PQ+V+ L + + + ALR + I +G +EQ Q VIDAGAL LL++P I +E Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73 Query 355 ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV 414 A W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQI Sbjct 74 ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQ 132 Query 415 YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE 474 ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G +E Sbjct 133 AVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAEPALE 186 Query 475 ALQNHENESVYKASLSLIEK 494 LQ+ NE + K + +EK Sbjct 187 QLQSSPNEKIQKEAQEALEK 206 Score = 96.7 bits (239), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 53/130 (41%), Positives = 76/130 (58%), Gaps = 6/130 (5%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 47 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 105 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW 231 +SP+ I ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W Sbjct 106 SSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALW 160 Query 232 TLSNLCRNKN 241 LSN+ N Sbjct 161 ALSNIASGGN 170 Score = 85.1 bits (209), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV+D GA+PA + LL Sbjct 89 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLL 147 Query 172 ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD 217 +SP+ I ++A+WAL NIA G+ + V + GA L L + P+ Sbjct 148 SSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPN 193 Score = 56.2 bits (134), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA PA L Sbjct 131 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGAEPALEQLQ 189 Query 172 ASPHAHISEQAVWALGNI 189 +SP+ I ++A AL I Sbjct 190 SSPNEKIQKEAQEALEKI 207
> 1qgk_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)
Length=44 Score = 93.6 bits (231), Expect = 5e-22, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%) Query 11 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS 54 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS Sbjct 1 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS 44
> 2ru4_A A Armadillo Repeat Protein, N-terminal fragment, YIIM2
Length=115 Score = 89.0 bits (219), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 45/115 (39%), Positives = 70/115 (61%), Gaps = 0/115 (0%) Query 293 GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ 352 G +PQ+ + L + ++ A R I++ +EQ Q VIDAGAL LL++P I Sbjct 1 GELPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQIL 60 Query 353 KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG 407 +EA W +SNI +G +QIQ V++ G +P LV +LS + + +EA+WA++N SG Sbjct 61 QEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG 115 Score = 85.9 bits (211), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 46/110 (42%), Positives = 72/110 (65%), Gaps = 2/110 (2%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES 140 + + +NS +++ QL AT+ ++LS + I +I AG +P V L + +Q E+ Sbjct 6 MTQQLNSDDMQEQLSATRKFSQILS-DGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EA 63 Query 141 AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA 190 WAL+NIASG +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA Sbjct 64 LWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIA 113 Score = 82.8 bits (203), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 49/114 (43%), Positives = 68/114 (60%), Gaps = 2/114 (2%) Query 253 LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT 311 LP + + L+ DD E L+ T L+DG NE+I V+ G +P LV+LL + I+ Sbjct 3 LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQ 61 Query 312 PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG 365 AL A+ NI +G +EQ Q VIDAGAL LL++P I +EA W +SNI +G Sbjct 62 EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG 115 Score = 70.1 bits (170), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 6/119 (5%) Query 119 GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI 178 G +P+ L D Q + + I S +EQ +AV+D GA+PA + LL+SP+ I Sbjct 1 GELPQMTQQLNSDDMQE-QLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQI 59 Query 179 SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC 237 ++A+WAL NIA G+ VI GA+ L+ LL+ P+ L+ W LSN+ Sbjct 60 LQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIA 113 Score = 60.8 bits (146), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 36/96 (38%), Positives = 58/96 (60%), Gaps = 1/96 (1%) Query 352 QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE 411 Q AT S I + +QIQ V++ G +P LV +LS + + +EA+WA++N SGG E Sbjct 18 QLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-E 76 Query 412 QIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI 447 QI ++ G + L+ LL++ + +I+ L A+SNI Sbjct 77 QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNI 112 Score = 32.7 bits (73), Expect = 2.0, Method: Compositional matrix adjust. Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 1/39 (3%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG 150 I +I AG +P V L + +Q E+ WAL+NIASG Sbjct 78 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASG 115
> 4d4e_A A ARMADILLO REPEAT PROTEIN ARM00016
Length=251 Score = 73.2 bits (178), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 78/245 (32%), Positives = 126/245 (51%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKN 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI G +EQ Q +I+AGAL+ LL + + K A ++NI AG +QIQ+ Sbjct 74 AVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQK 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + K A + G EQI L+ G + PL+ LL Sbjct 134 LIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDA 192 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 193 SEEVIKNAVAAIANIAAGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 246 Query 493 EKYFS 497 E + S Sbjct 247 EAFNS 251 Score = 47.8 bits (112), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 73/243 (30%), Positives = 116/243 (48%), Gaps = 5/243 (2%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D +S Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL---DDASEEV 70 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 N+ I+A L LV+LL EV+ + AI+ + G N Sbjct 71 IKNAVAAIANIAAGNNEQIQKLIEA--GALSPLVKLLDDASEEVIKNAVAAIANIAAGNN 128 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I +++ G + LVKLL + ++ A+ AI NI G +EQ Q +I+AGAL+ L Sbjct 129 EQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKL 188 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L + + K A ++NI AG + Q++ G +P L + S A+ + QK A A+ Sbjct 189 LDDASEEVIKNAVAAIANIAAGNNEMKQKLEEAGALPALEKLQSHANEEVQKNAQAALEA 248 Query 404 YTS 406 + S Sbjct 249 FNS 251
> 4d4e_B B ARMADILLO REPEAT PROTEIN ARM00016
Length=251 Score = 73.2 bits (178), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 78/245 (32%), Positives = 126/245 (51%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKN 73 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI G +EQ Q +I+AGAL+ LL + + K A ++NI AG +QIQ+ Sbjct 74 AVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQK 133 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + K A + G EQI L+ G + PL+ LL Sbjct 134 LIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDA 192 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI ++ + +EE G L +E LQ+H NE V K + + + Sbjct 193 SEEVIKNAVAAIANIAAGNNEMKQK------LEEAGALPALEKLQSHANEEVQKNAQAAL 246 Query 493 EKYFS 497 E + S Sbjct 247 EAFNS 251 Score = 47.8 bits (112), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 73/243 (30%), Positives = 116/243 (48%), Gaps = 5/243 (2%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D +S Sbjct 14 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL---DDASEEV 70 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 N+ I+A L LV+LL EV+ + AI+ + G N Sbjct 71 IKNAVAAIANIAAGNNEQIQKLIEA--GALSPLVKLLDDASEEVIKNAVAAIANIAAGNN 128 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I +++ G + LVKLL + ++ A+ AI NI G +EQ Q +I+AGAL+ L Sbjct 129 EQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKL 188 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L + + K A ++NI AG + Q++ G +P L + S A+ + QK A A+ Sbjct 189 LDDASEEVIKNAVAAIANIAAGNNEMKQKLEEAGALPALEKLQSHANEEVQKNAQAALEA 248 Query 404 YTS 406 + S Sbjct 249 FNS 251
> 5mfb_B B YIII(Dq)4CqI
Length=243 Score = 62.4 bits (150), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 78/245 (32%), Positives = 124/245 (51%), Gaps = 7/245 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKN 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI G +EQ Q +I+AGAL+ LL + + K A ++NI AG +QIQ+ Sbjct 66 AVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + K A + G EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI 492 ++I + AI+NI + + +KL EE G +E LQ+ NE V K + + + Sbjct 185 SEEVIKNAVAAIANIAAGNNE--QIQKL----EEAGAEPALEKLQSSPNEEVQKNAQAAL 238 Query 493 EKYFS 497 E S Sbjct 239 EALNS 243 Score = 47.8 bits (112), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 74/243 (30%), Positives = 115/243 (47%), Gaps = 5/243 (2%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D +S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL---DDASEEV 62 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 N+ I+A L LV+LL EV+ + AI+ + G N Sbjct 63 IKNAVAAIANIAAGNNEQIQKLIEA--GALSPLVKLLDDASEEVIKNAVAAIANIAAGNN 120 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I +++ G + LVKLL + ++ A+ AI NI G +EQ Q +I+AGAL+ L Sbjct 121 EQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKL 180 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 L + + K A ++NI AG +QIQ++ G P L + S + + QK A A+ Sbjct 181 LDDASEEVIKNAVAAIANIAAGNNEQIQKLEEAGAEPALEKLQSSPNEEVQKNAQAALEA 240 Query 404 YTS 406 S Sbjct 241 LNS 243
> 5mfb_A A YIII(Dq)4CqI
Length=243 Score = 62.0 bits (149), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 76/234 (32%), Positives = 119/234 (51%), Gaps = 7/234 (3%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP 312 LP +V+ L+ D + L +S + G NE+I +++ G + LVKLL + ++ Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKN 65 Query 313 ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ 372 A+ AI NI G +EQ Q +I+AGAL+ LL + + K A ++NI AG +QIQ+ Sbjct 66 AVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQK 125 Query 373 VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK 432 ++ G + LV +L A + K A + G EQI L+ G + PL+ LL Sbjct 126 LIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDA 184 Query 433 DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK 486 ++I + AI+NI + + +KL EE G +E LQ+ NE V K Sbjct 185 SEEVIKNAVAAIANIAAGNNE--QIQKL----EEAGAEPALEKLQSSPNEEVQK 232 Score = 46.6 bits (109), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 73/238 (31%), Positives = 114/238 (48%), Gaps = 5/238 (2%) Query 164 IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC 223 +P + L SP + A+ L IA G+ +I+ GA+ PL+ LL D +S Sbjct 6 LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLL---DDASEEV 62 Query 224 GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN 283 N+ I+A L LV+LL EV+ + AI+ + G N Sbjct 63 IKNAVAAIANIAAGNNEQIQKLIEA--GALSPLVKLLDDASEEVIKNAVAAIANIAAGNN 120 Query 284 ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL 343 E+I +++ G + LVKLL + ++ A+ AI NI G +EQ Q +I+AGAL+ L Sbjct 121 EQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKL 180 Query 344 LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV 401 L + + K A ++NI AG +QIQ++ G P L + S + + QK A A+ Sbjct 181 LDDASEEVIKNAVAAIANIAAGNNEQIQKLEEAGAEPALEKLQSSPNEEVQKNAQAAL 238
> 2ru4_B B Armadillo Repeat Protein, C-terminal fragment, MAII
Length=84 Score = 59.3 bits (142), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%) Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%) Query 152 SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPL 209 +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ + V + GA++ L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKL 59 Score = 58.5 bits (140), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%) Query 283 NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS 342 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 343 LLTNPKTNIQKEATWTMSNITA 364 L ++ IQKEA + + + Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 48.1 bits (113), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 5 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 63 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 64 SHENEKIQKEAQEAL 78 Score = 48.1 bits (113), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%) Query 368 DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN 427 +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQ 61 Query 428 LLTAKDTKI 436 L + ++ KI Sbjct 62 LQSHENEKI 70 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 6/87 (7%) Query 411 EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAL 56 Query 471 DKIEALQNHENESVYKASLSLIEKYFS 497 +K+E LQ+HENE + K + +EK S Sbjct 57 EKLEQLQSHENEKIQKEAQEALEKLQS 83 Score = 38.5 bits (88), Expect = 0.014, Method: Compositional matrix adjust. Identities = 17/49 (35%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LP LV+LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 14 LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 62
> 2ru5_A B Armadillo repeat protein C-terminal fragment
Length=84 Score = 59.3 bits (142), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%) Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%) Query 152 SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPL 209 +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ + V + GA++ L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKL 59 Score = 58.5 bits (140), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%) Query 283 NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS 342 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 343 LLTNPKTNIQKEATWTMSNITA 364 L ++ IQKEA + + + Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 48.1 bits (113), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 5 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 63 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 64 SHENEKIQKEAQEAL 78 Score = 48.1 bits (113), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%) Query 368 DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN 427 +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQ 61 Query 428 LLTAKDTKI 436 L + ++ KI Sbjct 62 LQSHENEKI 70 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 6/87 (7%) Query 411 EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAL 56 Query 471 DKIEALQNHENESVYKASLSLIEKYFS 497 +K+E LQ+HENE + K + +EK S Sbjct 57 EKLEQLQSHENEKIQKEAQEALEKLQS 83 Score = 38.5 bits (88), Expect = 0.014, Method: Compositional matrix adjust. Identities = 17/49 (35%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LP LV+LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 14 LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 62
> 1qgr_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)
Length=27 Score = 53.1 bits (126), Expect = 1e-07, Method: Composition-based stats. Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 0/24 (0%) Query 28 RRRRIEVNVELRKAKKDDQMLKRR 51 RRRRIEVNVELRKAKKDDQMLKRR Sbjct 1 RRRRIEVNVELRKAKKDDQMLKRR 24
> 6kbm_A A Vacuolar protein 8
Length=506 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%) Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 ++L ++ LL DP++ C A+ L NE ++V+ G + L+ + + + Sbjct 76 EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ 134 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A+ I N+ T D + ++ +GAL L + +Q+ AT + N+T +++ Sbjct 135 CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR- 192 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 +++VN G VP LVS+LS D Q A++N Sbjct 193 KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN 225 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 78/350 (22%), Positives = 151/350 (43%), Gaps = 17/350 (5%) Query 123 KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA 182 K ++ L +D +Q +A A I Q V + + LL S I A Sbjct 41 KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA 96 Query 183 VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP 242 ALGN+A + + L+++ G ++PL+ + + D + C N ++NL + Sbjct 97 CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN 150 Query 243 APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL 302 I ++P L +L V + A+ +T R +V G VP LV LL Sbjct 151 KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL 208 Query 303 GASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 +++ + A+ NI + ++ + ++ SL+ +P + ++ +AT + N Sbjct 209 SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN 268 Query 362 ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI 421 + + Q++ +V G +P LV ++ +V + N + E ++ V G Sbjct 269 LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF 325 Query 422 IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 ++PL+ LL KD++ I + + N+ ++EK + S +E+C L Sbjct 326 LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL 375 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE 139 ++ + NVE Q A L +R+ I +G LIP ++ L ++ +Q Sbjct 122 LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN 177 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 + AL N+ + + E K +V+ GA+P +SLL+S + AL NIA D + + Sbjct 178 ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK-- 234 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 K +P L V M S + T L NL + + I LP LV+L Sbjct 235 --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL 291 Query 260 LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI 317 + D P VLA + NE G++V G + LV+LL + I A+ + Sbjct 292 IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL 349 Query 318 GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV 374 N+ +++ + ++GA+ L + ++Q E + + + + D ++ + Sbjct 350 RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI 409 Query 375 NHGLVPFLVS 384 L+P S Sbjct 410 LDALIPMTFS 419
> 6kbn_A A Vacuolar protein 8
Length=563 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%) Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 ++L ++ LL DP++ C A+ L NE ++V+ G + L+ + + + Sbjct 70 EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ 128 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A+ I N+ T D + ++ +GAL L + +Q+ AT + N+T +++ Sbjct 129 CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR- 186 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 +++VN G VP LVS+LS D Q A++N Sbjct 187 KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN 219 Score = 53.5 bits (127), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 78/350 (22%), Positives = 151/350 (43%), Gaps = 17/350 (5%) Query 123 KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA 182 K ++ L +D +Q +A A I Q V + + LL S I A Sbjct 35 KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA 90 Query 183 VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP 242 ALGN+A + + L+++ G ++PL+ + + D + C N ++NL + Sbjct 91 CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN 144 Query 243 APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL 302 I ++P L +L V + A+ +T R +V G VP LV LL Sbjct 145 KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL 202 Query 303 GASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 +++ + A+ NI + ++ + ++ SL+ +P + ++ +AT + N Sbjct 203 SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN 262 Query 362 ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI 421 + + Q++ +V G +P LV ++ +V + N + E ++ V G Sbjct 263 LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF 319 Query 422 IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 ++PL+ LL KD++ I + + N+ ++EK + S +E+C L Sbjct 320 LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL 369 Score = 53.1 bits (126), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE 139 ++ + NVE Q A L +R+ I +G LIP ++ L ++ +Q Sbjct 116 LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN 171 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 + AL N+ + + E K +V+ GA+P +SLL+S + AL NIA D + + Sbjct 172 ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK-- 228 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 K +P L V M S + T L NL + + I LP LV+L Sbjct 229 --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL 285 Query 260 LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI 317 + D P VLA + NE G++V G + LV+LL + I A+ + Sbjct 286 IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL 343 Query 318 GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV 374 N+ +++ + ++GA+ L + ++Q E + + + + D ++ + Sbjct 344 RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI 403 Query 375 NHGLVPFLVS 384 L+P S Sbjct 404 LDALIPMTFS 413
> 5xjg_A A Vacuolar protein 8
Length=506 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%) Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 ++L ++ LL DP++ C A+ L NE ++V+ G + L+ + + + Sbjct 76 EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ 134 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A+ I N+ T D + ++ +GAL L + +Q+ AT + N+T +++ Sbjct 135 CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR- 192 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 +++VN G VP LVS+LS D Q A++N Sbjct 193 KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN 225 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 78/350 (22%), Positives = 151/350 (43%), Gaps = 17/350 (5%) Query 123 KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA 182 K ++ L +D +Q +A A I Q V + + LL S I A Sbjct 41 KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA 96 Query 183 VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP 242 ALGN+A + + L+++ G ++PL+ + + D + C N ++NL + Sbjct 97 CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN 150 Query 243 APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL 302 I ++P L +L V + A+ +T R +V G VP LV LL Sbjct 151 KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL 208 Query 303 GASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 +++ + A+ NI + ++ + ++ SL+ +P + ++ +AT + N Sbjct 209 SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN 268 Query 362 ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI 421 + + Q++ +V G +P LV ++ +V + N + E ++ V G Sbjct 269 LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF 325 Query 422 IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 ++PL+ LL KD++ I + + N+ ++EK + S +E+C L Sbjct 326 LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL 375 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE 139 ++ + NVE Q A L +R+ I +G LIP ++ L ++ +Q Sbjct 122 LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN 177 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 + AL N+ + + E K +V+ GA+P +SLL+S + AL NIA D + + Sbjct 178 ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK-- 234 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 K +P L V M S + T L NL + + I LP LV+L Sbjct 235 --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL 291 Query 260 LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI 317 + D P VLA + NE G++V G + LV+LL + I A+ + Sbjct 292 IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL 349 Query 318 GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV 374 N+ +++ + ++GA+ L + ++Q E + + + + D ++ + Sbjct 350 RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI 409 Query 375 NHGLVPFLVS 384 L+P S Sbjct 410 LDALIPMTFS 419
> 5xjg_C C Vacuolar protein 8
Length=506 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%) Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 ++L ++ LL DP++ C A+ L NE ++V+ G + L+ + + + Sbjct 76 EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ 134 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A+ I N+ T D + ++ +GAL L + +Q+ AT + N+T +++ Sbjct 135 CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR- 192 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 +++VN G VP LVS+LS D Q A++N Sbjct 193 KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN 225 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 78/350 (22%), Positives = 151/350 (43%), Gaps = 17/350 (5%) Query 123 KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA 182 K ++ L +D +Q +A A I Q V + + LL S I A Sbjct 41 KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA 96 Query 183 VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP 242 ALGN+A + + L+++ G ++PL+ + + D + C N ++NL + Sbjct 97 CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN 150 Query 243 APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL 302 I ++P L +L V + A+ +T R +V G VP LV LL Sbjct 151 KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL 208 Query 303 GASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 +++ + A+ NI + ++ + ++ SL+ +P + ++ +AT + N Sbjct 209 SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN 268 Query 362 ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI 421 + + Q++ +V G +P LV ++ +V + N + E ++ V G Sbjct 269 LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF 325 Query 422 IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 ++PL+ LL KD++ I + + N+ ++EK + S +E+C L Sbjct 326 LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL 375 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE 139 ++ + NVE Q A L +R+ I +G LIP ++ L ++ +Q Sbjct 122 LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN 177 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 + AL N+ + + E K +V+ GA+P +SLL+S + AL NIA D + + Sbjct 178 ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK-- 234 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 K +P L V M S + T L NL + + I LP LV+L Sbjct 235 --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL 291 Query 260 LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI 317 + D P VLA + NE G++V G + LV+LL + I A+ + Sbjct 292 IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL 349 Query 318 GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV 374 N+ +++ + ++GA+ L + ++Q E + + + + D ++ + Sbjct 350 RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI 409 Query 375 NHGLVPFLVS 384 L+P S Sbjct 410 LDALIPMTFS 419
> 6kbn_C C Vacuolar protein 8
Length=563 Score = 57.0 bits (136), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%) Query 251 QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV 310 ++L ++ LL DP++ C A+ L NE ++V+ G + L+ + + + Sbjct 70 EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ 128 Query 311 TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI 370 A+ I N+ T D + ++ +GAL L + +Q+ AT + N+T +++ Sbjct 129 CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR- 186 Query 371 QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN 403 +++VN G VP LVS+LS D Q A++N Sbjct 187 KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN 219 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 78/350 (22%), Positives = 151/350 (43%), Gaps = 17/350 (5%) Query 123 KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA 182 K ++ L +D +Q +A A I Q V + + LL S I A Sbjct 35 KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA 90 Query 183 VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP 242 ALGN+A + + L+++ G ++PL+ + + D + C N ++NL + Sbjct 91 CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN 144 Query 243 APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL 302 I ++P L +L V + A+ +T R +V G VP LV LL Sbjct 145 KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL 202 Query 303 GASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 +++ + A+ NI + ++ + ++ SL+ +P + ++ +AT + N Sbjct 203 SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN 262 Query 362 ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI 421 + + Q++ +V G +P LV ++ +V + N + E ++ V G Sbjct 263 LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF 319 Query 422 IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 ++PL+ LL KD++ I + + N+ ++EK + S +E+C L Sbjct 320 LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL 369 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%) Query 81 IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE 139 ++ + NVE Q A L +R+ I +G LIP ++ L ++ +Q Sbjct 116 LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN 171 Query 140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL 199 + AL N+ + + E K +V+ GA+P +SLL+S + AL NIA D + + Sbjct 172 ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK-- 228 Query 200 VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL 259 K +P L V M S + T L NL + + I LP LV+L Sbjct 229 --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL 285 Query 260 LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI 317 + D P VLA + NE G++V G + LV+LL + I A+ + Sbjct 286 IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL 343 Query 318 GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV 374 N+ +++ + ++GA+ L + ++Q E + + + + D ++ + Sbjct 344 RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI 403 Query 375 NHGLVPFLVS 384 L+P S Sbjct 404 LDALIPMTFS 413
> 1qz7_A A Beta-catenin
Length=533 Score = 50.1 bits (118), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 77/313 (25%), Positives = 128/313 (41%), Gaps = 43/313 (14%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 144 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 199 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 200 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 254 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 255 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 311 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 312 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 369 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV 401 + W + T G + NH G +P LV +L +A TQ+ Sbjct 370 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT---- 419 Query 402 TNYTSGGTVEQIV 414 + GGT +Q V Sbjct 420 ---SMGGTQQQFV 429 Score = 42.4 bits (98), Expect = 0.007, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 60 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 118 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 119 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 178 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 179 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 235 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 236 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 290 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 291 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 345
> 1v18_A A BETA-CATENIN
Length=538 Score = 48.5 bits (114), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE--AVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRXXXXX 422 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 423 XXXQFVEGVRMEEIV 437 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1th1_A A Beta-catenin
Length=532 Score = 48.5 bits (114), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 144 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 199 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 200 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 254 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 255 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 311 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 312 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 369 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEA--VW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 370 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSXXX 423 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 424 XXXQFVEGVRMEEIV 438 Score = 42.0 bits (97), Expect = 0.008, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 60 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 118 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 119 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 178 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 179 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 235 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 236 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 290 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 291 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 345
> 1i7x_A A BETA-CATENIN
Length=538 Score = 48.5 bits (114), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEA--VW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSXXX 422 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 423 XXXXFVEGVRMEEIV 437 Score = 42.4 bits (98), Expect = 0.007, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1th1_B B Beta-catenin
Length=532 Score = 48.1 bits (113), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 144 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 199 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 200 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 254 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 255 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 311 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 312 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 369 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEA--VW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 370 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSXXX 423 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 424 XXXQFVEGVRMEEIV 438 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 60 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 118 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 119 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 178 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 179 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 235 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 236 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 290 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 291 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 345
> 1m1e_A A Beta-catenin
Length=538 Score = 48.1 bits (113), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 422 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 423 XXXQFVEGVRMEEIV 437 Score = 42.0 bits (97), Expect = 0.008, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1g3j_A A BETA-CATENIN ARMADILLO REPEAT REGION
Length=532 Score = 48.1 bits (113), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 144 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 199 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 200 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 254 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 255 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 311 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 312 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 369 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE--AVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 370 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRXXXXX 423 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 424 XXXXFVEGVRMEEIV 438 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 60 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 118 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 119 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 178 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 179 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 235 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 236 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 290 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 291 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 345
> 1t08_A A Beta-catenin
Length=519 Score = 48.1 bits (113), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 131 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 186 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 187 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 241 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 242 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 298 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 299 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 356 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 357 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 410 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 411 XXXQFVEGVRMEEIV 425 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 47 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 105 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 106 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 165 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 166 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 222 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 223 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 277 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 278 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 332
> 1g3j_C C BETA-CATENIN ARMADILLO REPEAT REGION
Length=532 Score = 47.8 bits (112), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 144 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 199 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 200 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 254 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 255 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 311 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 312 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 369 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV 401 + W + T G + NH G +P LV +L +A TQ+ Sbjct 370 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGX 423 Query 402 T--NYTSGGTVEQIV 414 + G +E+IV Sbjct 424 XXQQFVEGVRMEEIV 438
> 2gl7_A A Beta-catenin
Length=550 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 140 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 195 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 196 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 250 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 251 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 307 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 308 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 365 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 366 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 419 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 420 XXXXFVEGVRMEEIV 434 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 56 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 114 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 115 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 174 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 175 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 231 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 232 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 286 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 287 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 341
> 1i7x_C C BETA-CATENIN
Length=538 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 422 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 423 XXXXFVEGVRMEEIV 437 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 2z6h_A A Catenin beta-1
Length=644 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/295 (24%), Positives = 121/295 (41%), Gaps = 36/295 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 139 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 194 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 195 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 249 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 250 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 306 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 307 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 364 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE 396 + W + T G + NH G +P LV +L +A TQ+ Sbjct 365 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR 413 Score = 42.0 bits (97), Expect = 0.011, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 55 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 113 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 114 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 173 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 174 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 230 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 231 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 285 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 286 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 340
> 3oux_A A Catenin beta-1
Length=540 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 145 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 200 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 201 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 255 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 256 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 312 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 313 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 370 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 371 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 418 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 61 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 119 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 120 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 179 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 180 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 236 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 237 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 291 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 292 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 346
> 3ouw_A A Catenin beta-1
Length=540 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 145 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 200 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 201 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 255 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 256 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 312 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 313 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 370 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 371 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 418 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 61 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 119 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 120 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 179 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 180 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 236 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 237 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 291 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 292 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 346
> 2z6g_A A B-catenin
Length=780 Score = 47.4 bits (111), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 75/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 275 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 330 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 331 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 385 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 386 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 442 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + + Q V + G L V LL P Sbjct 443 IEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYG-LPVVVKLLHPP- 500 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEA--VW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 501 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSXXX 554 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 555 XXXQFVEGVRMEEIV 569 Score = 45.4 bits (106), Expect = 0.001, Method: Compositional matrix adjust. Identities = 88/374 (24%), Positives = 152/374 (41%), Gaps = 77/374 (21%) Query 46 QMLKRR--NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKL 103 QMLK N+ ++ DDA ++ ++ K +N E+Q+ +AA + Sbjct 129 QMLKHAVVNLINYQDDAE-----------LATRAIPELTKLLND---EDQVVVNKAAVMV 174 Query 104 --LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AV 158 LS+ K+ I+R+ P+ VS + RT + E+A + S + A+ Sbjct 175 HQLSK-KEASRHAIMRS---PQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAI 230 Query 159 VDGGAIPAFISLLASP-----------------HAHISEQAVWALGNIAGDGSVFRDLVI 201 G IPA +++L SP H ++ AV G + ++ + Sbjct 231 FKSGGIPALVNMLGSPVDSVLFHAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNV 290 Query 202 KYGAVDP-LLALLAVPDMSS----LACG-------YLRNLT-----WTLS------NLCR 238 K+ A+ L +LA + S LA G +R T WT S ++C Sbjct 291 KFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS 350 Query 239 NKNPAPPIDAVEQILPTLVRLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVP 296 + PA Q L LH DP + L C W + L+D ++ GM G++ Sbjct 351 SNKPAIVEAGGMQALG-----LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLG 402 Query 297 QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKE 354 LV+LLG+ ++ +VT A + N+ + +V G + V L + +I + Sbjct 403 TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP 462 Query 355 ATWTMSNITAGRQD 368 A + ++T+ QD Sbjct 463 AICALRHLTSRHQD 476
> 1i7w_C C BETA-CATENIN
Length=538 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/295 (24%), Positives = 121/295 (41%), Gaps = 36/295 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE 396 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR 417 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 2bct_A A BETA-CATENIN
Length=516 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 127 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 182 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 183 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 237 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 238 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 294 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 295 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 352 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 353 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 400 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 43 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 101 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 102 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 161 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 162 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 218 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 219 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 273 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 274 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 328
> 4evt_A A Catenin beta-1
Length=538 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416 Score = 42.0 bits (97), Expect = 0.009, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1jpw_E C BETA-CATENIN
Length=540 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 146 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 201 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 202 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 256 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 257 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 313 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 314 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 371 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 372 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 425 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 426 XXXXFVEGVRMEEIV 440 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 62 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 120 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 121 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 180 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 181 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 237 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 238 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 292 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 293 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 347
> 1jpw_C B BETA-CATENIN
Length=540 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 146 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 201 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 202 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 256 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 257 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 313 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 314 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 371 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 372 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 425 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 426 XXXXFVEGVRMEEIV 440 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 62 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 120 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 121 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 180 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 181 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 237 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 238 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 292 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 293 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 347
> 1jpw_A A BETA-CATENIN
Length=540 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 146 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 201 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 202 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 256 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 257 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 313 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 314 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 371 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 372 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 425 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 426 XXXXFVEGVRMEEIV 440 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 62 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 120 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 121 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 180 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 181 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 237 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 238 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 292 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 293 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 347
> 4eva_A A Catenin beta-1
Length=538 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 4evp_A A Catenin beta-1
Length=538 Score = 47.0 bits (110), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416
> 2gl7_D D Beta-catenin
Length=550 Score = 47.0 bits (110), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 128/315 (41%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 140 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 195 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 196 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 250 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 251 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 307 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 308 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 365 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW 399 + W + T G + NH G +P LV +L +A TQ+ Sbjct 366 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX 419 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 420 XXXXFVEGVRMEEIV 434 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 56 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 114 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 115 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 174 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 175 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 231 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 232 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 286 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 287 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 341
> 4djs_A A Catenin beta-1
Length=518 Score = 47.0 bits (110), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 129 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 184 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 185 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 239 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 240 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 296 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 297 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 354 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 355 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 402 Score = 42.0 bits (97), Expect = 0.010, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 45 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 103 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 104 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 163 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 164 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 220 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 221 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 275 Query 316 AIGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 276 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 330
> 1luj_A A Catenin beta-1
Length=514 Score = 47.0 bits (110), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 127 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 182 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 183 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 237 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 238 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 294 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 295 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 352 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 353 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 400 Score = 41.6 bits (96), Expect = 0.011, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 43 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 101 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 102 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 161 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 162 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 218 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 219 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 273 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 274 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 328
> 4eva_B C Catenin beta-1
Length=538 Score = 47.0 bits (110), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416
> 4ev9_A A Catenin beta-1
Length=538 Score = 46.6 bits (109), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 4ev8_A A Catenin beta-1
Length=538 Score = 46.6 bits (109), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1i7w_A A BETA-CATENIN
Length=538 Score = 46.6 bits (109), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 416 Score = 41.6 bits (96), Expect = 0.014, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 3bct_A A BETA-CATENIN
Length=522 Score = 46.6 bits (109), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 72/294 (24%), Positives = 121/294 (41%), Gaps = 36/294 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 84 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 139 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 140 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 194 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 195 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 251 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 252 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 309 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK 395 + W + T G + NH G +P LV +L +A TQ+ Sbjct 310 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR 357
> 3tx7_A A Catenin beta-1
Length=527 Score = 45.8 bits (107), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 127/315 (40%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 140 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 195 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 196 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 250 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 251 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 307 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 308 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 365 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQ--KEAVW 399 + W + T G + NH G +P LV +L +A TQ Sbjct 366 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQXXXXXXX 419 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 420 XXXQFVEGVRMEEIV 434 Score = 41.6 bits (96), Expect = 0.014, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 56 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 114 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 115 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 174 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 175 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 231 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 232 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 286 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 287 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 341
> 1jdh_A A BETA-CATENIN
Length=529 Score = 45.4 bits (106), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 76/315 (24%), Positives = 127/315 (40%), Gaps = 38/315 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 142 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 197 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 198 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 252 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 253 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 309 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 310 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 367 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQ--KEAVW 399 + W + T G + NH G +P LV +L +A TQ Sbjct 368 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQXXXXXXX 421 Query 400 AVTNYTSGGTVEQIV 414 + G +E+IV Sbjct 422 XXXXFVEGVRMEEIV 436 Score = 41.6 bits (96), Expect = 0.013, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 58 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 116 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 117 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 176 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 177 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 233 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 234 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 288 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 289 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 343
> 5xgc_A A Rap1 GTPase-GDP dissociation stimulator 1
Length=503 Score = 43.9 bits (102), Expect = 0.002, Method: Compositional matrix adjust. Identities = 75/341 (22%), Positives = 145/341 (43%), Gaps = 45/341 (13%) Query 159 VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL----- 213 VD G I + LL S + Q ALGNI D + +I G + L+ LL Sbjct 31 VDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQ 90 Query 214 --AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT 271 A+ +M +A G L+ L +K + E+++ + + HD E++ + Sbjct 91 NAALTEMCLVAFG-------NLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEV 143 Query 272 CWAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------ 324 ++ N+ I + +V+ G+V L++++ + + + I + TG+ Sbjct 144 LAPLA-----ENDAIKLQLVEAGLVECLLEIV---QQKVDSDKEDDITELKTGSDLMVLL 195 Query 325 ---DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLV 379 DE Q + + G +VF +L+ P N Q + ++ R D +V++G+V Sbjct 196 LLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIV 255 Query 380 PFLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK 435 L+ +L + + Q A+ A+ N V ++ G+ E ++ L ++ Sbjct 256 EKLMDLLDRHVEDGNVTVQHAALSALRNLAI--PVINKAKMLSAGVTEAVLKFLKSEMPP 313 Query 436 IILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD 471 + +L + + +AAE+LG+ KL ++E C D Sbjct 314 VQFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD 354 Score = 37.4 bits (85), Expect = 0.24, Method: Compositional matrix adjust. Identities = 39/150 (26%), Positives = 66/150 (44%), Gaps = 11/150 (7%) Query 244 PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG 303 P +DA ++ LV+LL+ D EVL T A+ + + ++ GV+P LVKLLG Sbjct 29 PCVDA--GLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLG 86 Query 304 --ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN 361 + L A GN+ + Q + + L+ K I+ + + Sbjct 87 IHCQNAALTEMCLVAFGNLAELESSKEQF----ASTNIAEELVKLFKKQIEHDKREMIFE 142 Query 362 ITA--GRQDQIQ-QVVNHGLVPFLVSVLSK 388 + A D I+ Q+V GLV L+ ++ + Sbjct 143 VLAPLAENDAIKLQLVEAGLVECLLEIVQQ 172
> 1jpp_B B BETA-CATENIN
Length=538 Score = 43.5 bits (101), Expect = 0.003, Method: Compositional matrix adjust. Identities = 70/289 (24%), Positives = 118/289 (41%), Gaps = 36/289 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKAD 390 + W + T G + NH G +P LV +L +A Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAH 411 Score = 41.6 bits (96), Expect = 0.011, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 1jpp_A A BETA-CATENIN
Length=538 Score = 43.5 bits (101), Expect = 0.003, Method: Compositional matrix adjust. Identities = 70/289 (24%), Positives = 118/289 (41%), Gaps = 36/289 (12%) Query 118 AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH 177 AG + K V+ L +T+ + + L +A G E ++ G A ++++ + + Sbjct 143 AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y 198 Query 178 ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS 234 E+ +W + SV + +++ G + L L P ++N WTL Sbjct 199 TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR 253 Query 235 NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV 294 NL + A + +E +L TLV+LL DD V+ +S LT + MV + G Sbjct 254 NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG 310 Query 295 VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK 348 + LV+ L I PA+ A+ ++ + E Q V + G L V LL P Sbjct 311 IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP- 368 Query 349 TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKAD 390 + W + T G + NH G +P LV +L +A Sbjct 369 ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAH 411 Score = 41.6 bits (96), Expect = 0.012, Method: Compositional matrix adjust. Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 57/295 (19%) Query 122 PKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQTKAVVDGGAIPAFISLLASP--- 174 P+ VS + RT + E+A L N+ S E A+ G IPA + +L SP Sbjct 59 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDS 117 Query 175 --------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMS 219 H ++ AV G + ++ +K+ A+ L +LA + Sbjct 118 VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE 177 Query 220 S----LACG-------YLRNLT-----WTLS------NLCRNKNPAPPIDAVEQILPTLV 257 S LA G +R T WT S ++C + PA Q L Sbjct 178 SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--- 234 Query 258 RLLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LH DP + L C W + L+D ++ GM G++ LV+LLG+ ++ +VT A Sbjct 235 --LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAG 289 Query 316 AIGNIVTGTDEQTQVVIDAGAL--AVFPSLLTNPKTNIQKEATWTMSNITAGRQD 368 + N+ + +V G + V L + +I + A + ++T+ Q+ Sbjct 290 ILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE 344
> 5zhx_D D Rap1 GTPase-GDP dissociation stimulator 1
Length=487 Score = 42.7 bits (99), Expect = 0.005, Method: Compositional matrix adjust. Identities = 74/340 (22%), Positives = 144/340 (42%), Gaps = 45/340 (13%) Query 160 DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL------ 213 D G I + LL S + Q ALGNI D + +I G + L+ LL Sbjct 16 DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQN 75 Query 214 -AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC 272 A+ +M +A G L+ L +K + E+++ + + HD E++ + Sbjct 76 AALTEMCLVAFG-------NLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVL 128 Query 273 WAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------- 324 ++ N+ I + +V+ G+V L++++ + + + I + TG+ Sbjct 129 APLA-----ENDAIKLQLVEAGLVECLLEIV---QQKVDSDKEDDITELKTGSDLMVLLL 180 Query 325 --DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLVP 380 DE Q + + G +VF +L+ P N Q + ++ R D +V++G+V Sbjct 181 LGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVE 240 Query 381 FLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 L+ +L + + Q A+ A+ N V ++ G+ E ++ L ++ + Sbjct 241 KLMDLLDRHVEDGNVTVQHAALSALRNLAI--PVINKAKMLSAGVTEAVLKFLKSEMPPV 298 Query 437 ILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD 471 +L + + +AAE+LG+ KL ++E C D Sbjct 299 QFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD 338
> 5zhx_B B Rap1 GTPase-GDP dissociation stimulator 1
Length=487 Score = 42.7 bits (99), Expect = 0.005, Method: Compositional matrix adjust. Identities = 74/340 (22%), Positives = 144/340 (42%), Gaps = 45/340 (13%) Query 160 DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL------ 213 D G I + LL S + Q ALGNI D + +I G + L+ LL Sbjct 16 DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQN 75 Query 214 -AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC 272 A+ +M +A G L+ L +K + E+++ + + HD E++ + Sbjct 76 AALTEMCLVAFG-------NLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVL 128 Query 273 WAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------- 324 ++ N+ I + +V+ G+V L++++ + + + I + TG+ Sbjct 129 APLA-----ENDAIKLQLVEAGLVECLLEIV---QQKVDSDKEDDITELKTGSDLMVLLL 180 Query 325 --DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLVP 380 DE Q + + G +VF +L+ P N Q + ++ R D +V++G+V Sbjct 181 LGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVE 240 Query 381 FLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 L+ +L + + Q A+ A+ N V ++ G+ E ++ L ++ + Sbjct 241 KLMDLLDRHVEDGNVTVQHAALSALRNLAI--PVINKAKMLSAGVTEAVLKFLKSEMPPV 298 Query 437 ILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD 471 +L + + +AAE+LG+ KL ++E C D Sbjct 299 QFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD 338
> 5zhx_C C Rap1 GTPase-GDP dissociation stimulator 1
Length=487 Score = 42.7 bits (99), Expect = 0.005, Method: Compositional matrix adjust. Identities = 74/340 (22%), Positives = 144/340 (42%), Gaps = 45/340 (13%) Query 160 DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL------ 213 D G I + LL S + Q ALGNI D + +I G + L+ LL Sbjct 16 DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQN 75 Query 214 -AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC 272 A+ +M +A G L+ L +K + E+++ + + HD E++ + Sbjct 76 AALTEMCLVAFG-------NLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVL 128 Query 273 WAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------- 324 ++ N+ I + +V+ G+V L++++ + + + I + TG+ Sbjct 129 APLA-----ENDAIKLQLVEAGLVECLLEIV---QQKVDSDKEDDITELKTGSDLMVLLL 180 Query 325 --DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLVP 380 DE Q + + G +VF +L+ P N Q + ++ R D +V++G+V Sbjct 181 LGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVE 240 Query 381 FLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 L+ +L + + Q A+ A+ N V ++ G+ E ++ L ++ + Sbjct 241 KLMDLLDRHVEDGNVTVQHAALSALRNLAI--PVINKAKMLSAGVTEAVLKFLKSEMPPV 298 Query 437 ILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD 471 +L + + +AAE+LG+ KL ++E C D Sbjct 299 QFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD 338
> 5zhx_A A Rap1 GTPase-GDP dissociation stimulator 1
Length=487 Score = 42.7 bits (99), Expect = 0.005, Method: Compositional matrix adjust. Identities = 74/340 (22%), Positives = 144/340 (42%), Gaps = 45/340 (13%) Query 160 DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL------ 213 D G I + LL S + Q ALGNI D + +I G + L+ LL Sbjct 16 DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQN 75 Query 214 -AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC 272 A+ +M +A G L+ L +K + E+++ + + HD E++ + Sbjct 76 AALTEMCLVAFG-------NLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVL 128 Query 273 WAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------- 324 ++ N+ I + +V+ G+V L++++ + + + I + TG+ Sbjct 129 APLA-----ENDAIKLQLVEAGLVECLLEIV---QQKVDSDKEDDITELKTGSDLMVLLL 180 Query 325 --DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLVP 380 DE Q + + G +VF +L+ P N Q + ++ R D +V++G+V Sbjct 181 LGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVE 240 Query 381 FLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI 436 L+ +L + + Q A+ A+ N V ++ G+ E ++ L ++ + Sbjct 241 KLMDLLDRHVEDGNVTVQHAALSALRNLAI--PVINKAKMLSAGVTEAVLKFLKSEMPPV 298 Query 437 ILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD 471 +L + + +AAE+LG+ KL ++E C D Sbjct 299 QFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD 338
> 3ifq_A A plakoglobin
Length=553 Score = 38.1 bits (87), Expect = 0.16, Method: Compositional matrix adjust. Identities = 67/360 (19%), Positives = 137/360 (38%), Gaps = 71/360 (20%) Query 79 DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +D V ++ + NQL +A+R+ L P+ V+ + RT + Sbjct 31 EDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSDL 76 Query 139 ESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 ++A T+I S + A+ G IPA + +L+SP + A+ L N+ Sbjct 77 DTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL------ 130 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 L+ + GA K D +++++P Sbjct 131 ---LLYQEGA----------------------------------KMAVRLADGLQKMVP- 152 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LL+ ++P+ LA T + L G E +++ G LV+++ + Sbjct 153 ---LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTS 209 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQV 373 + +++ +++AG + LT+ + + WT+ N++ A +Q+ ++ V Sbjct 210 RVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESV 269 Query 374 VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD 433 + LV+ LS D A ++N T + + + + G+ + +L A D Sbjct 270 LK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGD 324
> 3ifq_B B plakoglobin
Length=553 Score = 37.7 bits (86), Expect = 0.17, Method: Compositional matrix adjust. Identities = 67/360 (19%), Positives = 137/360 (38%), Gaps = 71/360 (20%) Query 79 DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF 138 +D V ++ + NQL +A+R+ L P+ V+ + RT + Sbjct 31 EDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSDL 76 Query 139 ESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV 195 ++A T+I S + A+ G IPA + +L+SP + A+ L N+ Sbjct 77 DTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL------ 130 Query 196 FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT 255 L+ + GA K D +++++P Sbjct 131 ---LLYQEGA----------------------------------KMAVRLADGLQKMVP- 152 Query 256 LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR 315 LL+ ++P+ LA T + L G E +++ G LV+++ + Sbjct 153 ---LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTS 209 Query 316 AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQV 373 + +++ +++AG + LT+ + + WT+ N++ A +Q+ ++ V Sbjct 210 RVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESV 269 Query 374 VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD 433 + LV+ LS D A ++N T + + + + G+ + +L A D Sbjct 270 LK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGD 324
> 5wlc_GB SN Utp30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6lqu_FB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6lqp_GB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6zqc_CA UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6zqb_X UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6zqa_W UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 6ke6_GB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.68, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 5wyj_IB U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.72, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 5wyk_CB U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.72, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 5ydt_A U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.73, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 5ydu_B B Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.73, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 5ydu_A A Ribosome biogenesis protein UTP30
Length=274 Score = 35.0 bits (79), Expect = 0.96, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
> 3l6y_A A Catenin delta-1
Length=584 Score = 34.7 bits (78), Expect = 1.9, Method: Compositional matrix adjust. Identities = 29/117 (25%), Positives = 52/117 (44%), Gaps = 5/117 (4%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV----WAVTNYTS 406 A + NI+ GR QD + N VP LV +L KA E + W ++++ S Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDS 166
> 3l6y_E E Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.1, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
> 3l6y_C C Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.2, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
> 3l6x_A A Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.2, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
> 5mfm_H Q YIIIM6AII_GS11_(KR)5
Length=348 Score = 33.9 bits (76), Expect = 2.6, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%) Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEK 494 ++E G L+K+E LQ+HENE + K + +EK Sbjct 294 VKEAGALEKLEQLQSHENEKIQKEAQEALEK 324
> 5mfm_G P YIIIM6AII_GS11_(KR)5
Length=348 Score = 33.9 bits (76), Expect = 2.6, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%) Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEK 494 ++E G L+K+E LQ+HENE + K + +EK Sbjct 294 VKEAGALEKLEQLQSHENEKIQKEAQEALEK 324 Lambda K H a alpha 0.315 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 34122002360 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40