[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= YP_009724392.1 envelope protein [Severe acute respiratory syndrome
coronavirus 2]

Length=75
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  2mm4_A A Envelope small membrane protein                             100    7e-28
  5x29_D D Envelope small membrane protein                             100    1e-27
  5x29_E E Envelope small membrane protein                             100    1e-27
  5x29_B B Envelope small membrane protein                             100    1e-27
  5x29_C C Envelope small membrane protein                             100    1e-27
  5x29_A A Envelope small membrane protein                             100    1e-27
  7k3g_D D Envelope small membrane protein                            56.2    6e-11
  7k3g_E E Envelope small membrane protein                            56.2    6e-11
  7k3g_B B Envelope small membrane protein                            56.2    6e-11
  7k3g_C C Envelope small membrane protein                            56.2    6e-11
  7k3g_A A Envelope small membrane protein                            56.2    6e-11


> 2mm4_A A Envelope small membrane protein
Length=58 Score = 100 bits (249), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 58
> 5x29_D D Envelope small membrane protein
Length=81 Score = 100 bits (249), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 24 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 81
> 5x29_E E Envelope small membrane protein
Length=81 Score = 100 bits (249), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 24 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 81
> 5x29_B B Envelope small membrane protein
Length=81 Score = 100 bits (249), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 24 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 81
> 5x29_C C Envelope small membrane protein
Length=81 Score = 100 bits (249), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 24 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 81
> 5x29_A A Envelope small membrane protein
Length=81 Score = 100 bits (249), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL 65 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRL AY NIVNVSLVKP+ YVYSRVKNL Sbjct 24 ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL 81
> 7k3g_D D Envelope small membrane protein
Length=31 Score = 56.2 bits (134), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 38 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 31
> 7k3g_E E Envelope small membrane protein
Length=31 Score = 56.2 bits (134), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 38 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 31
> 7k3g_B B Envelope small membrane protein
Length=31 Score = 56.2 bits (134), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 38 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 31
> 7k3g_C C Envelope small membrane protein
Length=31 Score = 56.2 bits (134), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 38 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 31
> 7k3g_A A Envelope small membrane protein
Length=31 Score = 56.2 bits (134), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%) Query 8 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 38 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR Sbjct 1 ETGTLIVNSVLLFLAFVVFLLVTLAILTALR 31 Lambda K H a alpha 0.331 0.142 0.407 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3725706120 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40