[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= YP_009725295.1 orf1a polyprotein [Severe acute respiratory syndrome
coronavirus 2]

Length=4405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  6wuu_B B papain-like protease                                        674    0.0   
  6wuu_A A papain-like protease                                        673    0.0   
  6wx4_A D Non-structural protein 3                                    671    0.0   
  6wuu_C C papain-like protease                                        670    0.0   
  6wuu_D D papain-like protease                                        670    0.0   
  6wzu_A A Non-structural protein 3                                    667    0.0   
  7jrn_A A Papain-like proteinase                                      667    0.0   
  7jrn_B J Papain-like proteinase                                      667    0.0   
  7cjm_A B Non-structural protein 3                                    665    0.0   
  6wrh_A A Non-structural protein 3                                    665    0.0   
  6w9c_A A Papain-like proteinase                                      664    0.0   
  6xa9_A A Papain-like protease                                        664    0.0   
  6xa9_C C Papain-like protease                                        664    0.0   
  7jit_A A Papain-like protease                                        662    0.0   
  6w9c_C C Papain-like proteinase                                      660    0.0   
  6xg3_A A Peptidase C16                                               660    0.0   
  7jir_A A Papain-like protease                                        660    0.0   
  7jn2_A A Papain-Like Protease                                        660    0.0   
  7cjd_A D Replicase polyprotein 1ab                                   661    0.0   
  7jiv_A A Papain-like protease                                        659    0.0   
  7cjd_C B Replicase polyprotein 1ab                                   657    0.0   
  6xaa_A A Papain-like protease                                        655    0.0   
  7cjd_D C Replicase polyprotein 1ab                                   655    0.0   
  6xbi_A A main protease                                               652    0.0   
  6lu7_A A main protease                                               652    0.0   
  6xqt_A A 3C-like proteinase                                          652    0.0   
  6xqt_B B 3C-like proteinase                                          652    0.0   
  7c8t_A A 3C-like proteinase                                          652    0.0   
  6z2e_A AAA Main Protease                                             652    0.0   
  6wqf_A A 3C-like proteinase                                          652    0.0   
  7buy_A A SARS-CoV-2 virus Main protease                              652    0.0   
  6xhu_A A 3C-like proteinase                                          652    0.0   
  6ynq_A A Replicase polyprotein 1ab                                   652    0.0   
  6m2n_B B SARS-CoV-2 3CL protease                                     652    0.0   
  6m2n_D D SARS-CoV-2 3CL protease                                     652    0.0   
  6m2n_A A SARS-CoV-2 3CL protease                                     652    0.0   
  6xb2_A A 3C-like proteinase                                          652    0.0   
  6xch_A A 3C-like proteinase                                          652    0.0   
  7c8r_A A 3C-like proteinase                                          652    0.0   
  6m03_A A main protease                                               652    0.0   
  7cwb_A A 3C-like proteinase                                          652    0.0   
  6xhu_B C 3C-like proteinase                                          652    0.0   
  6wnp_A A 3C-like proteinase                                          652    0.0   
  6wtk_A A 3C-like proteinase                                          652    0.0   
  7k3t_A A 3C-like proteinase                                          652    0.0   
  7k40_A A 3C-like proteinase                                          652    0.0   
  6yvf_A A Replicase polyprotein 1ab                                   652    0.0   
  6xqu_A A 3C-like proteinase                                          652    0.0   
  7jvz_A A 3C-like proteinase                                          652    0.0   
  6xqs_A A 3C-like proteinase                                          652    0.0   
  6yt8_A A Replicase polyprotein 1ab                                   652    0.0   
  6yb7_A A Replicase polyprotein 1ab                                   652    0.0   
  7jyc_A A 3C-like proteinase                                          652    0.0   
  6y2e_A A Replicase polyprotein 1ab                                   652    0.0   
  7jun_A A 3C-like proteinase                                          652    0.0   
  6wtm_A A 3C-like proteinase                                          652    0.0   
  6wtj_A A 3C-like proteinase                                          652    0.0   
  6wtm_B B 3C-like proteinase                                          652    0.0   
  6xa9_E E Papain-like protease                                        650    0.0   
  6w63_A A 3C-like proteinase                                          649    0.0   
  6m2n_C C SARS-CoV-2 3CL protease                                     649    0.0   
  6m2q_A A SARS-CoV-2 3CL protease                                     649    0.0   
  7k6e_A A 3C-like proteinase                                          649    0.0   
  7k6d_A A 3C-like proteinase                                          649    0.0   
  7jfq_A A 3C-like proteinase                                          649    0.0   
  6xr3_A A 3C-like proteinase                                          649    0.0   
  6xoa_B B 3C-like proteinase                                          649    0.0   
  6xoa_D D 3C-like proteinase                                          649    0.0   
  6xoa_C C 3C-like proteinase                                          649    0.0   
  6xoa_A A 3C-like proteinase                                          649    0.0   
  6xkf_A A 3C-like proteinase                                          648    0.0   
  6xb0_A A 3C-like proteinase                                          648    0.0   
  6xkh_A A 3C-like proteinase                                          648    0.0   
  6xb1_A A 3C-like proteinase                                          648    0.0   
  6xkf_B B 3C-like proteinase                                          648    0.0   
  6xa4_A A main protease                                               647    0.0   
  6xbh_A A main protease                                               647    0.0   
  6xfn_A A main protease                                               647    0.0   
  6m0k_A A Replicase polyprotein 1ab                                   647    0.0   
  5r81_A A 3C-like proteinase                                          647    0.0   
  5rfg_A A 3C-like proteinase                                          647    0.0   
  5rf1_A A 3C-like proteinase                                          647    0.0   
  5rfv_A A 3C-like proteinase                                          647    0.0   
  5rea_A A 3C-like proteinase                                          647    0.0   
  5reh_A A 3C-like proteinase                                          647    0.0   
  5re9_A A 3C-like proteinase                                          647    0.0   
  5rfo_A A 3C-like proteinase                                          647    0.0   
  5rfy_A A 3C-like proteinase                                          647    0.0   
  5r82_A A 3C-like proteinase                                          647    0.0   
  5rft_A A 3C-like proteinase                                          647    0.0   
  5rfd_A A 3C-like proteinase                                          647    0.0   
  5r7y_A A 3C-like proteinase                                          647    0.0   
  5r7z_A A 3C-like proteinase                                          647    0.0   
  5rfx_A A 3C-like proteinase                                          647    0.0   
  5rfs_A A 3C-like proteinase                                          647    0.0   
  5rfq_A A 3C-like proteinase                                          647    0.0   
  5rfn_A A 3C-like proteinase                                          647    0.0   
  5rfp_A A 3C-like proteinase                                          647    0.0   
  5rfj_A A 3C-like proteinase                                          647    0.0   
  5rfi_A A 3C-like proteinase                                          647    0.0   
  5rf9_A A 3C-like proteinase                                          647    0.0   
  5rf8_A A 3C-like proteinase                                          647    0.0   
  5rf7_A A 3C-like proteinase                                          647    0.0   
  5rf6_A A 3C-like proteinase                                          647    0.0   
  5rf3_A A 3C-like proteinase                                          647    0.0   
  5rf4_A A 3C-like proteinase                                          647    0.0   
  5rez_A A 3C-like proteinase                                          647    0.0   
  5rew_A A 3C-like proteinase                                          647    0.0   
  5rev_A A 3C-like proteinase                                          647    0.0   
  5rex_A A 3C-like proteinase                                          647    0.0   
  5reu_A A 3C-like proteinase                                          647    0.0   
  5reo_A A 3C-like proteinase                                          647    0.0   
  5rep_A A 3C-like proteinase                                          647    0.0   
  5rem_A A 3C-like proteinase                                          647    0.0   
  5rel_A A 3C-like proteinase                                          647    0.0   
  5rej_A A 3C-like proteinase                                          647    0.0   
  5reg_A A 3C-like proteinase                                          647    0.0   
  5ree_A A 3C-like proteinase                                          647    0.0   
  5reb_A A 3C-like proteinase                                          647    0.0   
  5re6_A A 3C-like proteinase                                          647    0.0   
  5re4_A A 3C-like proteinase                                          647    0.0   
  5r84_A A 3C-like proteinase                                          647    0.0   
  5rg2_A A 3C-like proteinase                                          647    0.0   
  5rgq_A A 3C-like proteinase                                          647    0.0   
  5rgn_A A 3C-like proteinase                                          647    0.0   
  5rgk_A A 3C-like proteinase                                          647    0.0   
  6yz6_A A Main Protease                                               647    0.0   
  5rek_A A 3C-like proteinase                                          647    0.0   
  5rei_A A 3C-like proteinase                                          647    0.0   
  5rgj_A A 3C-like proteinase                                          647    0.0   
  5rf5_A A 3C-like proteinase                                          647    0.0   
  5rhc_A A 3C-like proteinase                                          647    0.0   
  5rhe_A A 3C-like proteinase                                          647    0.0   
  5rfk_A A 3C-like proteinase                                          647    0.0   
  5rhf_A A 3C-like proteinase                                          647    0.0   
  5r8t_A A 3C-like proteinase                                          647    0.0   
  5rh4_A A 3C-like proteinase                                          647    0.0   
  5rgp_A A 3C-like proteinase                                          647    0.0   
  5red_A A 3C-like proteinase                                          647    0.0   
  5rgo_A A 3C-like proteinase                                          647    0.0   
  5rfu_A A 3C-like proteinase                                          647    0.0   
  5res_A A 3C-like proteinase                                          647    0.0   
  5rfz_A A 3C-like proteinase                                          647    0.0   
  5rfr_A A 3C-like proteinase                                          647    0.0   
  5rhd_A A 3C-like proteinase                                          647    0.0   
  5rhb_A A 3C-like proteinase                                          647    0.0   
  5rfm_A A 3C-like proteinase                                          647    0.0   
  5rha_A A 3C-like proteinase                                          647    0.0   
  5rgm_A A 3C-like proteinase                                          647    0.0   
  5rg0_A A 3C-like proteinase                                          647    0.0   
  5re8_A A 3C-like proteinase                                          647    0.0   
  5rh0_A A 3C-like proteinase                                          647    0.0   
  5rgz_A A 3C-like proteinase                                          647    0.0   
  5rgy_A A 3C-like proteinase                                          647    0.0   
  5rgv_A A 3C-like proteinase                                          647    0.0   
  5rh2_A A 3C-like proteinase                                          647    0.0   
  5rh3_A A 3C-like proteinase                                          647    0.0   
  5rgx_A A 3C-like proteinase                                          647    0.0   
  5rgw_A A 3C-like proteinase                                          647    0.0   
  5rgt_A A 3C-like proteinase                                          647    0.0   
  5rh9_A A 3C-like proteinase                                          647    0.0   
  5rh8_A A 3C-like proteinase                                          647    0.0   
  5rh7_A A 3C-like proteinase                                          647    0.0   
  5rh5_A A 3C-like proteinase                                          647    0.0   
  5rh6_A A 3C-like proteinase                                          647    0.0   
  5rgi_A A 3C-like proteinase                                          647    0.0   
  5rgu_A A 3C-like proteinase                                          647    0.0   
  5rgh_A A 3C-like proteinase                                          647    0.0   
  5ren_A A 3C-like proteinase                                          647    0.0   
  5re7_A A 3C-like proteinase                                          647    0.0   
  6zru_A A Main Protease                                               647    0.0   
  6zrt_A A Main Protease                                               647    0.0   
  5rfl_A A 3C-like proteinase                                          647    0.0   
  5rfh_A A 3C-like proteinase                                          647    0.0   
  5rf0_A A 3C-like proteinase                                          647    0.0   
  5rfc_A A 3C-like proteinase                                          647    0.0   
  5rg3_A A 3C-like proteinase                                          647    0.0   
  5rfe_A A 3C-like proteinase                                          647    0.0   
  5ref_A A 3C-like proteinase                                          647    0.0   
  5rgl_A A 3C-like proteinase                                          647    0.0   
  5rf2_A A 3C-like proteinase                                          647    0.0   
  5r80_A A 3C-like proteinase                                          647    0.0   
  5rh1_A A 3C-like proteinase                                          647    0.0   
  5ret_A A 3C-like proteinase                                          647    0.0   
  5r83_A A 3C-like proteinase                                          647    0.0   
  5rgg_A A 3C-like proteinase                                          647    0.0   
  5rgs_A A 3C-like proteinase                                          647    0.0   
  5rey_A A 3C-like proteinase                                          647    0.0   
  5rfb_A A 3C-like proteinase                                          647    0.0   
  5rec_A A 3C-like proteinase                                          647    0.0   
  5rfw_A A 3C-like proteinase                                          647    0.0   
  5rg1_A A 3C-like proteinase                                          647    0.0   
  5rgr_A A 3C-like proteinase                                          647    0.0   
  5re5_A A 3C-like proteinase                                          647    0.0   
  7ju7_A A 3C-like proteinase                                          647    0.0   
  5rff_A A 3C-like proteinase                                          647    0.0   
  5rer_A A 3C-like proteinase                                          647    0.0   
  6y84_A A Replicase polyprotein 1ab                                   647    0.0   
  7cmd_C C Replicase polyprotein 1ab                                   647    0.0   
  7jiw_A A Papain-Like Protease                                        646    0.0   
  7cmd_B B Replicase polyprotein 1ab                                   646    0.0   
  6lze_A A Replicase polyprotein 1ab                                   645    0.0   
  6xbg_B B main protease                                               645    0.0   
  6y2g_B B Replicase polyprotein 1ab                                   645    0.0   
  6w9c_B B Papain-like proteinase                                      645    0.0   
  6y2f_A A Replicase polyprotein 1ab                                   644    0.0   
  6xhm_A A 3C-like proteinase                                          644    0.0   
  6xbi_B B main protease                                               644    0.0   
  6xmk_B B 3C-like proteinase                                          644    0.0   
  6wtt_A A 3C-like proteinase                                          644    0.0   
  6wtt_C C 3C-like proteinase                                          644    0.0   
  6wtt_B B 3C-like proteinase                                          644    0.0   
  7brr_A A 3C-like proteinase                                          643    0.0   
  7cmd_D D Replicase polyprotein 1ab                                   644    0.0   
  7c7p_A A main protease                                               642    0.0   
  7bqy_A A main protease                                               642    0.0   
  6xhm_B B 3C-like proteinase                                          642    0.0   
  6y2g_A A Replicase polyprotein 1ab                                   642    0.0   
  7com_A A main protease                                               642    0.0   
  7d1o_A A 3C-like proteinase                                          642    0.0   
  5rfa_A A 3C-like proteinase                                          642    0.0   
  7c6u_A A 3C-like proteinase                                          642    0.0   
  7c6s_A A 3C-like proteinase                                          642    0.0   
  7c8b_A A 3C-like proteinase                                          642    0.0   
  7brp_B A 3C-like proteinase                                          642    0.0   
  7jkv_A A 3C-like proteinase                                          642    0.0   
  7brp_A B 3C-like proteinase                                          642    0.0   
  7jkv_B B 3C-like proteinase                                          642    0.0   
  7cmd_A A Replicase polyprotein 1ab                                   641    0.0   
  7c8u_A A Replicase polyprotein 1ab                                   640    0.0   
  7jr3_A A 3C-like proteinase                                          640    0.0   
  7bro_A A 3C-like proteinase                                          640    0.0   
  6xbg_A A main protease                                               640    0.0   
  7cwc_A A 3C-like proteinase                                          640    0.0   
  7brr_B B 3C-like proteinase                                          637    0.0   
  7cwc_B B 3C-like proteinase                                          637    0.0   
  7c7p_B B main protease                                               637    0.0   
  6xmk_A A 3C-like proteinase                                          635    0.0   
  2zu4_A A 3C-like proteinase                                          634    0.0   
  2h2z_A A Replicase polyprotein 1ab                                   634    0.0   
  2zu5_A A 3C-like proteinase                                          634    0.0   
  3sne_A A 3C-like proteinase                                          634    0.0   
  3tns_A A SARS coronavirus main protease                              634    0.0   
  3snd_B B 3C-like proteinase                                          634    0.0   
  3snd_A A 3C-like proteinase                                          634    0.0   
  5n19_A A SARS coronavirus main protease                              634    0.0   
  3snb_A A 3C-like proteinase                                          634    0.0   
  2gx4_A A 3C-like proteinase                                          634    0.0   
  3snc_A A 3C-like proteinase                                          634    0.0   
  2gz9_A A Replicase polyprotein 1ab                                   634    0.0   
  6w79_A A Main protease                                               634    0.0   
  6y7m_A AAA Replicase polyprotein 1a                                  634    0.0   
  3vb5_B B 3C-like proteinase                                          634    0.0   
  6lny_A A Replicase polyprotein 1a                                    634    0.0   
  2z3c_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  2gz7_A A Replicase polyprotein 1ab                                   634    0.0   
  2gz8_A A Replicase polyprotein 1ab                                   634    0.0   
  2z3d_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  3szn_A A 3C-like proteinase                                          634    0.0   
  6lo0_A A Replicase polyprotein 1a                                    634    0.0   
  2z9k_B B 3C-like proteinase                                          634    0.0   
  5n5o_A A Replicase polyprotein 1ab                                   634    0.0   
  3tit_A A SARS coronavirus main protease                              634    0.0   
  2duc_B B Replicase polyprotein 1ab                                   634    0.0   
  2z94_A A Replicase polyprotein 1ab                                   634    0.0   
  3vb6_B B 3C-like proteinase                                          634    0.0   
  2a5a_A A 3C-like peptidase                                           634    0.0   
  2hob_A A Replicase polyprotein 1ab                                   634    0.0   
  6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like ...   634    0.0   
  3vb4_B B 3C-like proteinase                                          634    0.0   
  3tiu_A A SARS coronavirus main protease                              634    0.0   
  2z3e_A A Replicase polyprotein 1ab (pp1ab)                           634    0.0   
  2v6n_A A REPLICASE POLYPROTEIN 1AB                                   634    0.0   
  3vb3_B B 3C-like proteinase                                          634    0.0   
  6wco_A A Main protease                                               634    0.0   
  3v3m_A A 3C-like proteinase                                          634    0.0   
  2duc_A A Replicase polyprotein 1ab                                   634    0.0   
  3sn8_A A 3C-like proteinase                                          634    0.0   
  3tnt_A A SARS coronavirus main protease                              634    0.0   
  2a5i_A A 3C-like peptidase                                           634    0.0   
  3vb7_B B 3C-like proteinase                                          634    0.0   
  2z9g_A A 3C-like proteinase                                          634    0.0   
  7jr4_A A 3C-like proteinase                                          634    0.0   
  7cbt_B B Replicase polyprotein 1ab                                   635    0.0   
  7cbt_A A Replicase polyprotein 1ab                                   635    0.0   
  3ea8_A A 3C-like proteinase                                          633    0.0   
  3m3v_A A 3C-like proteinase                                          633    0.0   
  7com_B B main protease                                               633    0.0   
  5b6o_A A 3C-like proteinase                                          632    0.0   
  2z9k_A A 3C-like proteinase                                          632    0.0   
  3e91_A A 3C-like proteinase                                          632    0.0   
  3ea7_A A 3C-like proteinase                                          632    0.0   
  2qcy_A A 3C-like proteinase                                          631    0.0   
  1wof_A A 3C-like proteinase                                          631    0.0   
  2amd_A A 3C-like proteinase                                          631    0.0   
  3m3s_A A 3C-like proteinase                                          631    0.0   
  1z1j_B B 3C-like proteinase                                          631    0.0   
  1z1j_A A 3C-like proteinase                                          631    0.0   
  4wy3_A A 3C-like proteinase                                          630    0.0   
  4twy_A A 3C-like proteinase                                          630    0.0   
  5c5n_A A 3C-like proteinase                                          630    0.0   
  3aw0_A A 3C-Like Proteinase                                          630    0.0   
  4tww_B B 3C-like proteinase                                          630    0.0   
  4tww_A A 3C-like proteinase                                          630    0.0   
  2z9j_B B 3C-like proteinase                                          629    0.0   
  2a5k_A A 3C-like peptidase                                           629    0.0   
  2qc2_B B 3C-like proteinase                                          629    0.0   
  3m3t_A A 3C-like proteinase                                          629    0.0   
  2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)    629    0.0   
  3m3v_B B 3C-like proteinase                                          628    0.0   
  7cx9_A A 3C protein                                                  627    0.0   
  2qc2_A A 3C-like proteinase                                          627    0.0   
  2amq_A A 3C-like proteinase                                          627    0.0   
  1wof_B B 3C-like proteinase                                          626    0.0   
  2amd_B B 3C-like proteinase                                          626    0.0   
  4mds_A A 3C-like proteinase                                          626    0.0   
  6w2a_B B Replicase polyprotein 1a                                    626    0.0   
  2alv_A A Replicase polyprotein 1ab                                   625    0.0   
  2z9j_A A 3C-like proteinase                                          625    0.0   
  2c3s_A A SARS COV 3C-LIKE PROTEINASE                                 625    0.0   
  1uk2_A A 3C-LIKE PROTEINASE                                          625    0.0   
  1uj1_B B 3C-like proteinase                                          625    0.0   
  1uk3_B B 3C-like proteinase                                          625    0.0   
  2gt7_B B 3C-like proteinase                                          625    0.0   
  1uk4_B B 3C-like proteinase                                          625    0.0   
  1uk2_B B 3C-LIKE PROTEINASE                                          625    0.0   
  2amq_B B 3C-like proteinase                                          625    0.0   
  2d2d_B B 3C-like proteinase                                          625    0.0   
  2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   624    0.0   
  3sna_A A 3C-like proteinase                                          624    0.0   
  6w2a_A A Replicase polyprotein 1a                                    624    0.0   
  6xhn_A A 3C-like proteinase                                          624    0.0   
  6xhl_A A 3C-like proteinase                                          624    0.0   
  3iwm_A A 3C-like proteinase                                          624    0.0   
  3vb7_A A 3C-like proteinase                                          624    0.0   
  3vb4_A A 3C-like proteinase                                          624    0.0   
  3iwm_B B 3C-like proteinase                                          624    0.0   
  3vb6_A A 3C-like proteinase                                          624    0.0   
  2z9l_B B 3C-like proteinase                                          624    0.0   
  3vb3_A A 3C-like proteinase                                          624    0.0   
  1z1i_A A 3C-like proteinase                                          624    0.0   
  3vb5_A A 3C-like proteinase                                          624    0.0   
  1uk3_A A 3C-like proteinase                                          624    0.0   
  1uk4_A A 3C-like proteinase                                          624    0.0   
  1uj1_A A 3C-like proteinase                                          624    0.0   
  2d2d_A A 3C-like proteinase                                          624    0.0   
  3ea7_B B 3C-like proteinase                                          623    0.0   
  3m3s_B B 3C-like proteinase                                          623    0.0   
  3eaj_B B 3C-like proteinase                                          623    0.0   
  3eaj_A A 3C-like proteinase                                          623    0.0   
  2qiq_A A Replicase polyprotein 1ab                                   622    0.0   
  2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)    622    0.0   
  3iwm_C C 3C-like proteinase                                          622    0.0   
  2bx3_A A MAIN PROTEINASE                                             622    0.0   
  3iwm_D D 3C-like proteinase                                          622    0.0   
  6xho_A A 3C-like proteinase                                          622    0.0   
  2a5k_B B 3C-like peptidase                                           622    0.0   
  2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE                            622    0.0   
  2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE                            622    0.0   
  7cjd_B A Replicase polyprotein 1ab                                   622    0.0   
  3e91_B B 3C-like proteinase                                          621    0.0   
  4hi3_B B 3C-like proteinase                                          621    0.0   
  3ea9_A A 3C-like proteinase                                          621    0.0   
  2z9l_A A 3C-like proteinase                                          621    0.0   
  2gt7_A A 3C-like proteinase                                          621    0.0   
  3aw1_A A 3C-Like Proteinase                                          620    0.0   
  5b6o_B B 3C-like proteinase                                          621    0.0   
  2gtb_A A 3C-like proteinase                                          620    0.0   
  2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   620    0.0   
  3d62_A A 3C-like proteinase                                          619    0.0   
  6xhn_B B 3C-like proteinase                                          619    0.0   
  3f9h_B B 3C-like proteinase                                          619    0.0   
  4hi3_A A 3C-like proteinase                                          619    0.0   
  5c5o_A A 3C-like proteinase                                          619    0.0   
  3aw1_B B 3C-Like Proteinase                                          619    0.0   
  3avz_A A 3C-Like Proteinase                                          619    0.0   
  3atw_A A 3C-Like Proteinase                                          619    0.0   
  3atw_B B 3C-Like Proteinase                                          619    0.0   
  5c5o_B B 3C-like proteinase                                          619    0.0   
  6xhl_B B 3C-like proteinase                                          619    0.0   
  2bx4_A A 3C-LIKE PROTEINASE                                          618    0.0   
  2gt8_A A 3C-like proteinase                                          618    0.0   
  3f9f_B B 3C-like proteinase                                          617    0.0   
  3f9f_A A 3C-like proteinase                                          617    0.0   
  3f9h_A A 3C-like proteinase                                          617    0.0   
  7c2y_A A 3C-like proteinase                                          614    0.0   
  3f9e_A A 3C-like proteinase                                          614    0.0   
  3f9g_A A 3C-like proteinase                                          612    0.0   
  7c2q_A A 3C-like proteinase                                          611    0.0   
  1q2w_A A 3C-like protease                                            611    0.0   
  1q2w_B B 3C-like protease                                            610    0.0   
  3fzd_A A 3C-like proteinase                                          610    0.0   
  3f9g_B B 3C-like proteinase                                          607    0.0   
  6xho_B B 3C-like proteinase                                          607    0.0   
  7c2q_B B 3C-like proteinase                                          602    0.0   
  7c2y_B B 3C-like proteinase                                          598    0.0   
  2pwx_A A 3C-like proteinase                                          592    0.0   
  6yva_A A Replicase polyprotein 1a                                    588    0.0   
  5tl6_A B Replicase polyprotein 1ab                                   562    8e-180
  4mm3_B B Papain-like proteinase                                      562    8e-180
  5tl7_B B Replicase polyprotein 1ab                                   562    9e-180
  4m0w_A A Replicase polyprotein 1a                                    562    9e-180
  5e6j_A A Replicase polyprotein 1ab                                   561    2e-179
  5y3e_A A Replicase polyprotein 1a                                    561    2e-179
  5y3q_A A Replicase polyprotein 1a                                    561    2e-179
  2fe8_A A Replicase polyprotein 1ab                                   560    4e-179
  5tl7_D D Replicase polyprotein 1ab                                   558    1e-178
  2fe8_B B Replicase polyprotein 1ab                                   558    2e-178
  5e6j_D D Replicase polyprotein 1ab                                   558    2e-178
  5tl6_B D Replicase polyprotein 1ab                                   557    3e-178
  3e9s_A A Non-structural protein 3                                    557    3e-178
  2fe8_C C Replicase polyprotein 1ab                                   556    5e-178
  3mj5_A A Replicase polyprotein 1a                                    556    6e-178
  4ow0_A A papain-like protease                                        553    1e-176
  4ovz_A A Papain-like proteinase                                      538    2e-171
  3mj5_B B Replicase polyprotein 1a                                    460    3e-144
  4ow0_B B papain-like protease                                        452    1e-141
  4ovz_B B Papain-like proteinase                                      438    2e-136
  2wct_B B NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2wct_A A NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2w2g_A A NON-STRUCTURAL PROTEIN 3                                    410    6e-128
  2w2g_B B NON-STRUCTURAL PROTEIN 3                                    402    6e-125
  2wct_C C NON-STRUCTURAL PROTEIN 3                                    401    2e-124
  2wct_D D NON-STRUCTURAL PROTEIN 3                                    392    2e-121
  2ahm_H H Replicase polyprotein 1ab, heavy chain                      384    2e-119
  6xez_D D nsp8                                                        383    4e-119
  6xez_B B nsp8                                                        383    4e-119
  6yyt_D D nsp8                                                        383    4e-119
  6yyt_B B nsp8                                                        383    4e-119
  2ahm_G G Replicase polyprotein 1ab, heavy chain                      382    5e-119
  6wey_A A Non-structural protein 3                                    350    3e-108
  6ywm_A A NSP3 macrodomain                                            349    1e-107
  6woj_D D Non-structural protein 3                                    349    1e-107
  6woj_B B Non-structural protein 3                                    349    1e-107
  6ywk_C C NSP3 macrodomain                                            348    1e-107
  6ywl_C C NSP3 macrodomain                                            348    1e-107
  6woj_A A Non-structural protein 3                                    347    5e-107
  6woj_C C Non-structural protein 3                                    347    5e-107
  6ywl_E E NSP3 macrodomain                                            347    5e-107
  6ywl_B B NSP3 macrodomain                                            347    5e-107
  6ywl_A A NSP3 macrodomain                                            347    5e-107
  6ywk_E E NSP3 macrodomain                                            347    5e-107
  6ywk_D D NSP3 macrodomain                                            347    5e-107
  6ywk_A A NSP3 macrodomain                                            347    5e-107
  6ywk_B B NSP3 macrodomain                                            347    5e-107
  6ywm_B B NSP3 macrodomain                                            344    3e-106
  6wen_A A Non-structural protein 3                                    344    3e-106
  6w6y_A A SARS-CoV-2 NSP3                                             344    3e-106
  6ywl_D D NSP3 macrodomain                                            344    4e-106
  6vxs_B B Non-structural protein 3                                    342    2e-105
  6vxs_A A Non-structural protein 3                                    342    2e-105
  6w02_B B Non-structural protein 3                                    342    2e-105
  6w6y_B B SARS-CoV-2 NSP3                                             342    2e-105
  6ywm_C C NSP3 macrodomain                                            342    2e-105
  6wcf_A A Non-structural protein 3                                    341    6e-105
  7jme_A A Non-structural protein 3                                    341    7e-105
  6w02_A A Non-structural protein 3                                    339    2e-104
  4rsp_A A Orf1a protein                                               324    4e-97 
  4ylu_A A ORF1a protein                                               323    8e-97 
  4ylu_D D ORF1a protein                                               323    8e-97 
  5wkj_A A Orf1a protein                                               322    2e-96 
  6vh2_B B Orf1a protein                                               322    2e-96 
  5wkl_A A Orf1a protein                                               322    2e-96 
  6vh3_B B Orf1a protein                                               322    2e-96 
  6vh3_A A Orf1a protein                                               322    2e-96 
  4wme_A A MERS-CoV 3CL protease                                       322    2e-96 
  4wme_D D MERS-CoV 3CL protease                                       322    2e-96 
  5wkk_A A Orf1a protein                                               322    3e-96 
  4ylu_B B ORF1a protein                                               321    4e-96 
  4ylu_C C ORF1a protein                                               321    4e-96 
  5wkm_A A Orf1a protein                                               321    5e-96 
  5c3n_A A ORF1a protein                                               320    6e-96 
  5c3n_B B ORF1a protein                                               320    9e-96 
  4wme_B B MERS-CoV 3CL protease                                       320    1e-95 
  4wmd_B B ORF1a                                                       320    1e-95 
  6vh2_A A Orf1a protein                                               320    1e-95 
  4wmd_C C ORF1a                                                       320    1e-95 
  4wmf_B B MERS-CoV 3CL protease                                       320    1e-95 
  6vh1_B B Orf1a protein                                               320    1e-95 
  6vgz_B B Orf1a protein                                               320    1e-95 
  6vgy_B B Orf1a protein                                               320    2e-95 
  6vh0_B B Orf1a protein                                               320    2e-95 
  6vh1_A A Orf1a protein                                               320    2e-95 
  6vgy_A A Orf1a protein                                               320    2e-95 
  6vh0_A A Orf1a protein                                               320    2e-95 
  6vgz_A A Orf1a protein                                               319    2e-95 
  4wme_C C MERS-CoV 3CL protease                                       318    5e-95 
  4wmd_A A ORF1a                                                       317    9e-95 
  4wmf_A A MERS-CoV 3CL protease                                       317    1e-94 
  2ahm_E E Replicase polyprotein 1ab, heavy chain                      312    2e-94 
  4yog_B B 3C-like proteinase                                          313    3e-93 
  4yoj_A A 3C-like proteinase                                          313    3e-93 
  4yoj_B B 3C-like proteinase                                          313    3e-93 
  4yo9_A A 3C-like proteinase                                          313    3e-93 
  4yoi_A A 3C-like proteinase                                          313    3e-93 
  4yoi_B B 3C-like proteinase                                          313    3e-93 
  4yog_A A 3C-like proteinase                                          313    3e-93 
  2ynb_A A 3C-LIKE PROTEINASE                                          313    3e-93 
  2yna_A A 3C-LIKE PROTEINASE                                          313    3e-93 
  2yna_B B 3C-LIKE PROTEINASE                                          309    7e-92 


> 6wuu_B B papain-like protease
Length=326 Score = 674 bits (1739), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/321 (99%), Positives = 320/321 (99%), Gaps = 0/321 (0%) Query 1562 LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 1621 +REVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL Sbjct 1 MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 60 Query 1622 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 1681 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL Sbjct 61 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 120 Query 1682 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 1741 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL Sbjct 121 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 180 Query 1742 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 1801 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE Sbjct 181 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 240 Query 1802 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 1861 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG Sbjct 241 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 300 Query 1862 PITDVFYKENSYTTTIKPVTY 1882 PITDVFYKENSYTTTIKP+ + Sbjct 301 PITDVFYKENSYTTTIKPLEH 321
> 6wuu_A A papain-like protease
Length=326 Score = 673 bits (1737), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/318 (99%), Positives = 318/318 (100%), Gaps = 0/318 (0%) Query 1562 LREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 1621 +REVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL Sbjct 1 MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL 60 Query 1622 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 1681 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL Sbjct 61 PNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALL 120 Query 1682 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 1741 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL Sbjct 121 TLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANL 180 Query 1742 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 1801 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE Sbjct 181 DSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE 240 Query 1802 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 1861 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG Sbjct 241 SPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKG 300 Query 1862 PITDVFYKENSYTTTIKP 1879 PITDVFYKENSYTTTIKP Sbjct 301 PITDVFYKENSYTTTIKP 318
> 6wx4_A D Non-structural protein 3
Length=326 Score = 671 bits (1730), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/319 (99%), Positives = 318/319 (99%), Gaps = 0/319 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPVTY 1882 TDVFYKENSYTTTIKP+ + Sbjct 303 TDVFYKENSYTTTIKPLEH 321
> 6wuu_C C papain-like protease
Length=326 Score = 670 bits (1729), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/317 (99%), Positives = 317/317 (100%), Gaps = 0/317 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPV 1880 TDVFYKENSYTTTIKP+ Sbjct 303 TDVFYKENSYTTTIKPL 319
> 6wuu_D D papain-like protease
Length=326 Score = 670 bits (1729), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/317 (99%), Positives = 317/317 (100%), Gaps = 0/317 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 3 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 62 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 63 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 122 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 123 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 182 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 183 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 242 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 243 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 302 Query 1864 TDVFYKENSYTTTIKPV 1880 TDVFYKENSYTTTIKP+ Sbjct 303 TDVFYKENSYTTTIKPL 319
> 6wzu_A A Non-structural protein 3
Length=318 Score = 667 bits (1722), Expect = 0.0, Method: Compositional matrix adjust. Identities = 315/315 (100%), Positives = 315/315 (100%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 4 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 64 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 124 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 184 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 244 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 303 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 304 TDVFYKENSYTTTIK 318
> 7jrn_A A Papain-like proteinase
Length=323 Score = 667 bits (1722), Expect = 0.0, Method: Compositional matrix adjust. Identities = 315/315 (100%), Positives = 315/315 (100%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 1 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 60 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 61 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 120 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 121 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 180 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 181 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 240 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 241 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 300 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 301 TDVFYKENSYTTTIK 315
> 7jrn_B J Papain-like proteinase
Length=323 Score = 667 bits (1722), Expect = 0.0, Method: Compositional matrix adjust. Identities = 315/315 (100%), Positives = 315/315 (100%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 1 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 60 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 61 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 120 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 121 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 180 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 181 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 240 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 241 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 300 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 301 TDVFYKENSYTTTIK 315
> 7cjm_A B Non-structural protein 3
Length=316 Score = 665 bits (1715), Expect = 0.0, Method: Compositional matrix adjust. Identities = 314/315 (99%), Positives = 314/315 (99%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 302 TDVFYKENSYTTTIK 316
> 6wrh_A A Non-structural protein 3
Length=318 Score = 665 bits (1715), Expect = 0.0, Method: Compositional matrix adjust. Identities = 314/315 (99%), Positives = 314/315 (99%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 4 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTL Sbjct 64 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 124 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 184 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 244 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 303 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 304 TDVFYKENSYTTTIK 318
> 6w9c_A A Papain-like proteinase
Length=317 Score = 664 bits (1712), Expect = 0.0, Method: Compositional matrix adjust. Identities = 313/313 (100%), Positives = 313/313 (100%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD Sbjct 3 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 62 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ Sbjct 63 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 122 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK Sbjct 123 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 182 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV Sbjct 183 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 242 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD Sbjct 243 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 302 Query 1866 VFYKENSYTTTIK 1878 VFYKENSYTTTIK Sbjct 303 VFYKENSYTTTIK 315
> 6xa9_A A Papain-like protease
Length=318 Score = 664 bits (1712), Expect = 0.0, Method: Compositional matrix adjust. Identities = 313/313 (100%), Positives = 313/313 (100%), Gaps = 0/313 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 5 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 64 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ Sbjct 65 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 124 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 125 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 184 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 185 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 244 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 245 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 304 Query 1865 DVFYKENSYTTTI 1877 DVFYKENSYTTTI Sbjct 305 DVFYKENSYTTTI 317
> 6xa9_C C Papain-like protease
Length=318 Score = 664 bits (1712), Expect = 0.0, Method: Compositional matrix adjust. Identities = 313/313 (100%), Positives = 313/313 (100%), Gaps = 0/313 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 5 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 64 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ Sbjct 65 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 124 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 125 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 184 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 185 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 244 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 245 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 304 Query 1865 DVFYKENSYTTTI 1877 DVFYKENSYTTTI Sbjct 305 DVFYKENSYTTTI 317
> 7jit_A A Papain-like protease
Length=318 Score = 662 bits (1709), Expect = 0.0, Method: Compositional matrix adjust. Identities = 313/314 (99%), Positives = 313/314 (99%), Gaps = 0/314 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 5 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 64 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQ Sbjct 65 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQ 124 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 125 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 184 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 185 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 244 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 245 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 304 Query 1865 DVFYKENSYTTTIK 1878 DVFYKENSYTTTIK Sbjct 305 DVFYKENSYTTTIK 318
> 6w9c_C C Papain-like proteinase
Length=317 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/312 (100%), Positives = 312/312 (100%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 4 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 63 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI Sbjct 64 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 123 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 124 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 183 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM Sbjct 184 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 243 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 244 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 303 Query 1867 FYKENSYTTTIK 1878 FYKENSYTTTIK Sbjct 304 FYKENSYTTTIK 315
> 6xg3_A A Peptidase C16
Length=318 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/313 (99%), Positives = 312/313 (99%), Gaps = 0/313 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 5 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 64 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQ Sbjct 65 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQ 124 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 125 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 184 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 185 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 244 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 245 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 304 Query 1865 DVFYKENSYTTTI 1877 DVFYKENSYTTTI Sbjct 305 DVFYKENSYTTTI 317
> 7jir_A A Papain-like protease
Length=318 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/313 (99%), Positives = 312/313 (99%), Gaps = 0/313 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 5 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 64 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQ Sbjct 65 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQ 124 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 125 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 184 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 185 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 244 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 245 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 304 Query 1865 DVFYKENSYTTTI 1877 DVFYKENSYTTTI Sbjct 305 DVFYKENSYTTTI 317
> 7jn2_A A Papain-Like Protease
Length=318 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/312 (100%), Positives = 312/312 (100%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 7 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 66 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI Sbjct 67 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 126 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 127 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 186 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM Sbjct 187 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 246 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 247 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 306 Query 1867 FYKENSYTTTIK 1878 FYKENSYTTTIK Sbjct 307 FYKENSYTTTIK 318
> 7cjd_A D Replicase polyprotein 1ab
Length=325 Score = 661 bits (1705), Expect = 0.0, Method: Compositional matrix adjust. Identities = 312/313 (99%), Positives = 312/313 (99%), Gaps = 0/313 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTT 1876 TDVFYKENSYTTT Sbjct 302 TDVFYKENSYTTT 314
> 7jiv_A A Papain-like protease
Length=318 Score = 659 bits (1699), Expect = 0.0, Method: Compositional matrix adjust. Identities = 311/312 (99%), Positives = 311/312 (99%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 7 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 66 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQQI Sbjct 67 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQI 126 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 127 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 186 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM Sbjct 187 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 246 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 247 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 306 Query 1867 FYKENSYTTTIK 1878 FYKENSYTTTIK Sbjct 307 FYKENSYTTTIK 318
> 7cjd_C B Replicase polyprotein 1ab
Length=325 Score = 657 bits (1694), Expect = 0.0, Method: Compositional matrix adjust. Identities = 310/311 (99%), Positives = 310/311 (99%), Gaps = 0/311 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND Sbjct 3 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 62 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQ Sbjct 63 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQ 122 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC Sbjct 123 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 182 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF Sbjct 183 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 242 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT Sbjct 243 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 302 Query 1865 DVFYKENSYTT 1875 DVFYKENSYTT Sbjct 303 DVFYKENSYTT 313
> 6xaa_A A Papain-like protease
Length=318 Score = 655 bits (1690), Expect = 0.0, Method: Compositional matrix adjust. Identities = 309/309 (100%), Positives = 309/309 (100%), Gaps = 0/309 (0%) Query 1568 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL 1627 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL Sbjct 8 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL 67 Query 1628 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE 1687 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE Sbjct 68 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE 127 Query 1688 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV 1747 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV Sbjct 128 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV 187 Query 1748 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM 1807 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM Sbjct 188 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM 247 Query 1808 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF 1867 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF Sbjct 248 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF 307 Query 1868 YKENSYTTT 1876 YKENSYTTT Sbjct 308 YKENSYTTT 316
> 7cjd_D C Replicase polyprotein 1ab
Length=325 Score = 655 bits (1690), Expect = 0.0, Method: Compositional matrix adjust. Identities = 309/310 (99%), Positives = 309/310 (99%), Gaps = 0/310 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD Sbjct 4 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQQ Sbjct 64 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK Sbjct 124 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV Sbjct 184 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD Sbjct 244 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 303 Query 1866 VFYKENSYTT 1875 VFYKENSYTT Sbjct 304 VFYKENSYTT 313
> 6xbi_A A main protease
Length=308 Score = 652 bits (1682), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 123 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 302 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 303 SGVTFQ 308
> 6lu7_A A main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqt_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqt_B B 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7c8t_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6z2e_A AAA Main Protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wqf_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7buy_A A SARS-CoV-2 virus Main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xhu_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6ynq_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_B B SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_D D SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_A A SARS-CoV-2 3CL protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb2_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xch_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7c8r_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m03_A A main protease
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7cwb_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xhu_B C 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wnp_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtk_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7k3t_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7k40_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yvf_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqu_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jvz_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqs_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yt8_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yb7_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jyc_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y2e_A A Replicase polyprotein 1ab
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jun_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtj_A A 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_B B 3C-like proteinase
Length=306 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xa9_E E Papain-like protease
Length=318 Score = 650 bits (1677), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/309 (99%), Positives = 307/309 (99%), Gaps = 0/309 (0%) Query 1568 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL 1627 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSH KTFYVLPNDDTL Sbjct 8 IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHXXKTFYVLPNDDTL 67 Query 1628 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE 1687 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE Sbjct 68 RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE 127 Query 1688 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV 1747 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV Sbjct 128 LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV 187 Query 1748 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM 1807 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM Sbjct 188 LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM 247 Query 1808 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF 1867 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF Sbjct 248 SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF 307 Query 1868 YKENSYTTT 1876 YKENSYTTT Sbjct 308 YKENSYTTT 316
> 6w63_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6m2n_C C SARS-CoV-2 3CL protease
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6m2q_A A SARS-CoV-2 3CL protease
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 7k6e_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 7k6d_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 7jfq_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6xr3_A A 3C-like proteinase
Length=306 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6xoa_B B 3C-like proteinase
Length=306 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_D D 3C-like proteinase
Length=306 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_C C 3C-like proteinase
Length=306 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_A A 3C-like proteinase
Length=306 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkf_A A 3C-like proteinase
Length=310 Score = 648 bits (1672), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb0_A A 3C-like proteinase
Length=310 Score = 648 bits (1672), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkh_A A 3C-like proteinase
Length=310 Score = 648 bits (1672), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb1_A A 3C-like proteinase
Length=310 Score = 648 bits (1672), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkf_B B 3C-like proteinase
Length=310 Score = 648 bits (1672), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xa4_A A main protease
Length=308 Score = 647 bits (1669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 3565 GVTF 3568 GVTF Sbjct 304 GVTF 307
> 6xbh_A A main protease
Length=308 Score = 647 bits (1669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 3565 GVTF 3568 GVTF Sbjct 304 GVTF 307
> 6xfn_A A main protease
Length=308 Score = 647 bits (1669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 3565 GVTF 3568 GVTF Sbjct 304 GVTF 307
> 6m0k_A A Replicase polyprotein 1ab
Length=304 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r81_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfv_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rea_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfy_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r82_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rft_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfd_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r7y_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r7z_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfx_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfs_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfq_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfn_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfp_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfj_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfi_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rez_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rew_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rev_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rex_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rep_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rem_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rel_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rej_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ree_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5reb_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r84_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgq_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgn_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgk_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6yz6_A A Main Protease
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rek_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rei_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgj_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rhc_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rhe_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfk_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rhf_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r8t_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh4_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgp_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5red_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgo_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5res_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfz_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfr_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rhd_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rhb_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfm_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rha_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgm_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgz_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgy_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgv_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgx_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgw_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgt_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh9_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh8_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh6_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgi_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgu_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ren_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6zru_A A Main Protease
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6zrt_A A Main Protease
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfl_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfh_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf0_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfc_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg3_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfe_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ref_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgl_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rf2_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r80_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rh1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5ret_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5r83_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgg_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgs_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rey_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfb_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rec_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rfw_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rg1_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rgr_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5re5_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 7ju7_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rff_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 5rer_A A 3C-like proteinase
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 6y84_A A Replicase polyprotein 1ab
Length=306 Score = 647 bits (1668), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 7cmd_C C Replicase polyprotein 1ab
Length=319 Score = 647 bits (1669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/314 (98%), Positives = 307/314 (98%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIP TKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPXXXXXXXTKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKENSYTTTI Sbjct 302 TDVFYKENSYTTTI 315
> 7jiw_A A Papain-Like Protease
Length=318 Score = 646 bits (1666), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/309 (99%), Positives = 305/309 (99%), Gaps = 0/309 (0%) Query 1570 VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV 1629 VFTTVDNINLHTQV MTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV Sbjct 10 VFTTVDNINLHTQVXXXXMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV 69 Query 1630 EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK 1689 EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK Sbjct 70 EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK 129 Query 1690 FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLN 1749 FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLN Sbjct 130 FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLN 189 Query 1750 VVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSA 1809 VVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSA Sbjct 190 VVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSA 249 Query 1810 PPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYK 1869 PPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYK Sbjct 250 PPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYK 309 Query 1870 ENSYTTTIK 1878 ENSYTTTIK Sbjct 310 ENSYTTTIK 318
> 7cmd_B B Replicase polyprotein 1ab
Length=319 Score = 646 bits (1666), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/315 (97%), Positives = 307/315 (97%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQI TKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIXXXXXXXXTKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 302 TDVFYKENSYTTTIK 316
> 6lze_A A Replicase polyprotein 1ab
Length=303 Score = 645 bits (1663), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGV 3566 SGV Sbjct 301 SGV 303
> 6xbg_B B main protease
Length=308 Score = 645 bits (1664), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 125 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 304 Query 3566 VTF 3568 VTF Sbjct 305 VTF 307
> 6y2g_B B Replicase polyprotein 1ab
Length=306 Score = 645 bits (1663), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGV 3566 SGV Sbjct 301 SGV 303
> 6w9c_B B Papain-like proteinase
Length=317 Score = 645 bits (1664), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/311 (98%), Positives = 306/311 (98%), Gaps = 0/311 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT Sbjct 4 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 63 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI Sbjct 64 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 123 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR Sbjct 124 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 183 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIP QATKYLVQQESPFVM Sbjct 184 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPXXXXXQATKYLVQQESPFVM 243 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV Sbjct 244 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 303 Query 1867 FYKENSYTTTI 1877 FYKENSYTTTI Sbjct 304 FYKENSYTTTI 314
> 6y2f_A A Replicase polyprotein 1ab
Length=306 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/305 (99%), Positives = 303/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTS MLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSXXMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 6xhm_A A 3C-like proteinase
Length=306 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6xbi_B B main protease
Length=308 Score = 644 bits (1660), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 123 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 302 Query 3564 SG 3565 SG Sbjct 303 SG 304
> 6xmk_B B 3C-like proteinase
Length=309 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 5 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 64 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 65 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 124 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 125 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 184 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 185 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 244 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 245 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 304 Query 3564 SG 3565 SG Sbjct 305 SG 306
> 6wtt_A A 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6wtt_C C 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6wtt_B B 3C-like proteinase
Length=310 Score = 644 bits (1661), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 7brr_A A 3C-like proteinase
Length=307 Score = 643 bits (1659), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302 Query 3565 GV 3566 GV Sbjct 303 GV 304
> 7cmd_D D Replicase polyprotein 1ab
Length=319 Score = 644 bits (1660), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/315 (97%), Positives = 306/315 (97%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ TKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQXXXXXXXXXTKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 302 TDVFYKENSYTTTIK 316
> 7c7p_A A main protease
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7bqy_A A main protease
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 6xhm_B B 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 6y2g_A A Replicase polyprotein 1ab
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7com_A A main protease
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7d1o_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 5rfa_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7c6u_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7c6s_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7c8b_A A 3C-like proteinase
Length=306 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 7brp_B A 3C-like proteinase
Length=307 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7jkv_A A 3C-like proteinase
Length=307 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7brp_A B 3C-like proteinase
Length=307 Score = 642 bits (1656), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7jkv_B B 3C-like proteinase
Length=307 Score = 642 bits (1655), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 7cmd_A A Replicase polyprotein 1ab
Length=319 Score = 641 bits (1654), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/315 (97%), Positives = 305/315 (97%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 2 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL Sbjct 62 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 122 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGV TKYLVQQESP Sbjct 182 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVXXXXXXXXXXTKYLVQQESP 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 242 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKENSYTTTIK Sbjct 302 TDVFYKENSYTTTIK 316
> 7c8u_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302
> 7jr3_A A 3C-like proteinase
Length=306 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300
> 7bro_A A 3C-like proteinase
Length=307 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 6xbg_A A main protease
Length=308 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303
> 7cwc_A A 3C-like proteinase
Length=310 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 5 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 64 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 65 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 124 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 125 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 184 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 185 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 244 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 245 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 304
> 7brr_B B 3C-like proteinase
Length=307 Score = 637 bits (1643), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 124 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 7cwc_B B 3C-like proteinase
Length=310 Score = 637 bits (1643), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 7 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 66 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 67 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 126 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 127 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 186 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 187 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 246 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 247 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 305
> 7c7p_B B main protease
Length=306 Score = 637 bits (1643), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/306 (98%), Positives = 300/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT PNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTXXXXXXPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xmk_A A 3C-like proteinase
Length=309 Score = 635 bits (1637), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 8 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 67 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 68 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 127 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 128 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 187 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 188 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 247 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 248 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 305
> 2zu4_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2h2z_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2zu5_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sne_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tns_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n19_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snb_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gx4_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snc_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz9_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6w79_A A Main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y7m_A AAA Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb5_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lny_A A Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3c_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz7_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz8_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3d_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3szn_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lo0_A A Replicase polyprotein 1a
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9k_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n5o_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tit_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_B B Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z94_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb6_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5a_A A 3C-like peptidase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2hob_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like
Protease Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb4_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tiu_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3e_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2v6n_A A REPLICASE POLYPROTEIN 1AB
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb3_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wco_A A Main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3v3m_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_A A Replicase polyprotein 1ab
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sn8_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tnt_A A SARS coronavirus main protease
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5i_A A 3C-like peptidase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb7_B B 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9g_A A 3C-like proteinase
Length=306 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jr4_A A 3C-like proteinase
Length=310 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/302 (99%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT MLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTXXXMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 XSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 7cbt_B B Replicase polyprotein 1ab
Length=333 Score = 635 bits (1637), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 31 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 90 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 91 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 150 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 151 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 210 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 211 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 270 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 271 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 328
> 7cbt_A A Replicase polyprotein 1ab
Length=333 Score = 635 bits (1637), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 31 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 90 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 91 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 150 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 151 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 210 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 211 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 270 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 271 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 328
> 3ea8_A A 3C-like proteinase
Length=306 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3m3v_A A 3C-like proteinase
Length=308 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 303 SGVTFQ 308
> 7com_B B main protease
Length=306 Score = 633 bits (1632), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/305 (98%), Positives = 298/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC PNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXXPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 5b6o_A A 3C-like proteinase
Length=316 Score = 632 bits (1630), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/310 (95%), Positives = 302/310 (97%), Gaps = 0/310 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQSAVK 3573 SGVTFQ K Sbjct 301 SGVTFQGKFK 310
> 2z9k_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3e91_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3ea7_A A 3C-like proteinase
Length=306 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 2qcy_A A 3C-like proteinase
Length=306 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 1wof_A A 3C-like proteinase
Length=311 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SGVTF 3568 SGVTF Sbjct 306 SGVTF 310
> 2amd_A A 3C-like proteinase
Length=311 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SGVTF 3568 SGVTF Sbjct 306 SGVTF 310
> 3m3s_A A 3C-like proteinase
Length=306 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_B B 3C-like proteinase
Length=306 Score = 631 bits (1627), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_A A 3C-like proteinase
Length=306 Score = 631 bits (1627), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4wy3_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4twy_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 5c5n_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 3aw0_A A 3C-Like Proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_B B 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_A A 3C-like proteinase
Length=306 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTFQ 3569 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9j_B B 3C-like proteinase
Length=306 Score = 629 bits (1623), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVT 3567 SGVT Sbjct 301 SGVT 304
> 2a5k_A A 3C-like peptidase
Length=307 Score = 629 bits (1623), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 SGVT 3567 SGVT Sbjct 302 SGVT 305
> 2qc2_B B 3C-like proteinase
Length=308 Score = 629 bits (1622), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 SGVTF 3568 SGVTF Sbjct 303 SGVTF 307
> 3m3t_A A 3C-like proteinase
Length=308 Score = 629 bits (1622), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 302 Query 3564 SGVTF 3568 SGVTF Sbjct 303 SGVTF 307
> 2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 629 bits (1621), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3m3v_B B 3C-like proteinase
Length=308 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 3564 SGV 3566 SGV Sbjct 303 SGV 305
> 7cx9_A A 3C protein
Length=306 Score = 627 bits (1618), Expect = 0.0, Method: Compositional matrix adjust. Identities = 295/301 (98%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2qc2_A A 3C-like proteinase
Length=308 Score = 627 bits (1618), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/304 (96%), Positives = 299/304 (98%), Gaps = 0/304 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 SGVT 3567 SGVT Sbjct 303 SGVT 306
> 2amq_A A 3C-like proteinase
Length=311 Score = 627 bits (1618), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 3566 VTF 3568 VTF Sbjct 308 VTF 310
> 1wof_B B 3C-like proteinase
Length=311 Score = 626 bits (1615), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 2amd_B B 3C-like proteinase
Length=311 Score = 626 bits (1615), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 4mds_A A 3C-like proteinase
Length=303 Score = 626 bits (1614), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 6w2a_B B Replicase polyprotein 1a
Length=310 Score = 626 bits (1614), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/303 (96%), Positives = 298/303 (98%), Gaps = 0/303 (0%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLI Sbjct 7 HSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLI 66 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 RKSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYN Sbjct 67 RKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYN 126 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 GSPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 127 GSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 186 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY Sbjct 187 KFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 246 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 EPLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQ Sbjct 247 EPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ 306 Query 3563 CSG 3565 CSG Sbjct 307 CSG 309
> 2alv_A A Replicase polyprotein 1ab
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301 Query 3565 GV 3566 GV Sbjct 302 GV 303
> 2z9j_A A 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2c3s_A A SARS COV 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk2_A A 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uj1_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk3_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2gt7_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk4_B B 3C-like proteinase
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 1uk2_B B 3C-LIKE PROTEINASE
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2amq_B B 3C-like proteinase
Length=311 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 2d2d_B B 3C-like proteinase
Length=311 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 3564 SG 3565 SG Sbjct 306 SG 307
> 2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 624 bits (1609), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3sna_A A 3C-like proteinase
Length=301 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 6w2a_A A Replicase polyprotein 1a
Length=310 Score = 624 bits (1609), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLI Sbjct 7 HSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLI 66 Query 3323 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 3382 RKSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYN Sbjct 67 RKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYN 126 Query 3383 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 3442 GSPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 127 GSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 186 Query 3443 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 3502 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY Sbjct 187 KFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 246 Query 3503 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 EPLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQ Sbjct 247 EPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ 306 Query 3563 CS 3564 CS Sbjct 307 CS 308
> 6xhn_A A 3C-like proteinase
Length=307 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302 Query 3565 G 3565 G Sbjct 303 G 303
> 6xhl_A A 3C-like proteinase
Length=307 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302 Query 3565 G 3565 G Sbjct 303 G 303
> 3iwm_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb7_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb4_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3iwm_B B 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb6_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2z9l_B B 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb3_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 1z1i_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3vb5_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 1uk3_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 1uk4_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 1uj1_A A 3C-like proteinase
Length=306 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 3566 V 3566 V Sbjct 303 V 303
> 2d2d_A A 3C-like proteinase
Length=311 Score = 624 bits (1608), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 3566 V 3566 V Sbjct 308 V 308
> 3ea7_B B 3C-like proteinase
Length=306 Score = 623 bits (1607), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 3m3s_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 3eaj_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 3eaj_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 2qiq_A A Replicase polyprotein 1ab
Length=301 Score = 622 bits (1605), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 +GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 AGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SG 3565 SG Sbjct 301 SG 302
> 3iwm_C C 3C-like proteinase
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2bx3_A A MAIN PROTEINASE
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 3iwm_D D 3C-like proteinase
Length=306 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 6xho_A A 3C-like proteinase
Length=307 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302
> 2a5k_B B 3C-like peptidase
Length=307 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 7cjd_B A Replicase polyprotein 1ab
Length=325 Score = 622 bits (1605), Expect = 0.0, Method: Compositional matrix adjust. Identities = 296/307 (96%), Positives = 296/307 (96%), Gaps = 0/307 (0%) Query 1569 KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLR 1628 KVFTTVDNINLHTQVV QFGPTYLDGADVTKI HNSHEGKTFYVLPNDDTLR Sbjct 7 KVFTTVDNINLHTQVVXXXXXXXXQFGPTYLDGADVTKIXXHNSHEGKTFYVLPNDDTLR 66 Query 1629 VEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIEL 1688 VEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTLQQIEL Sbjct 67 VEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIEL 126 Query 1689 KFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL 1748 KFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL Sbjct 127 KFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL 186 Query 1749 NVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMS 1808 NVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMS Sbjct 187 NVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMS 246 Query 1809 APPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY 1868 APPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY Sbjct 247 APPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY 306 Query 1869 KENSYTT 1875 KENSYTT Sbjct 307 KENSYTT 313
> 3e91_B B 3C-like proteinase
Length=306 Score = 621 bits (1602), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300
> 4hi3_B B 3C-like proteinase
Length=315 Score = 621 bits (1602), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3ea9_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2z9l_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 2gt7_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 SGVTF 3568 SGVTF Sbjct 301 SGVTF 305
> 3aw1_A A 3C-Like Proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 5b6o_B B 3C-like proteinase
Length=316 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 3564 S 3564 S Sbjct 301 S 301
> 2gtb_A A 3C-like proteinase
Length=307 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 3564 S 3564 S Sbjct 302 S 302
> 3d62_A A 3C-like proteinase
Length=299 Score = 619 bits (1597), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 60 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 121 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 180 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 299
> 6xhn_B B 3C-like proteinase
Length=307 Score = 619 bits (1597), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/302 (95%), Positives = 296/302 (98%), Gaps = 0/302 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 3565 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM RTILGS +LEDEFTPFDVVRQCSG Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXRTILGSTILEDEFTPFDVVRQCSG 303 Query 3566 VT 3567 VT Sbjct 304 VT 305
> 3f9h_B B 3C-like proteinase
Length=308 Score = 619 bits (1596), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 4hi3_A A 3C-like proteinase
Length=315 Score = 619 bits (1597), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301
> 5c5o_A A 3C-like proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3aw1_B B 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3avz_A A 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_A A 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_B B 3C-Like Proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 5c5o_B B 3C-like proteinase
Length=306 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 6xhl_B B 3C-like proteinase
Length=307 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/301 (95%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM RTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXRTILGSTILEDEFTPFDVVRQCS 302 Query 3565 G 3565 G Sbjct 303 G 303
> 2bx4_A A 3C-LIKE PROTEINASE
Length=306 Score = 618 bits (1594), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2gt8_A A 3C-like proteinase
Length=307 Score = 618 bits (1594), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 3f9f_B B 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9f_A A 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9h_A A 3C-like proteinase
Length=308 Score = 617 bits (1592), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 7c2y_A A 3C-like proteinase
Length=298 Score = 614 bits (1583), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/294 (98%), Positives = 289/294 (98%), Gaps = 0/294 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPNFTIKGSF GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 124 GVYQCAMRPNFTIKGSFXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 3560 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT SALLEDEFTPFDVV Sbjct 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTXXXSALLEDEFTPFDVV 297
> 3f9e_A A 3C-like proteinase
Length=308 Score = 614 bits (1584), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/297 (96%), Positives = 293/297 (99%), Gaps = 0/297 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKG+FLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGAFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQ Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ 301
> 3f9g_A A 3C-like proteinase
Length=303 Score = 612 bits (1578), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/300 (95%), Positives = 292/300 (97%), Gaps = 0/300 (0%) Query 3265 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 3324 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 3325 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 3384 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 3385 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 3444 PSGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 3445 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 3504 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 3505 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 7c2q_A A 3C-like proteinase
Length=296 Score = 611 bits (1575), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/296 (97%), Positives = 288/296 (97%), Gaps = 0/296 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 60 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKGS GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 121 SGVYQCAMRPNFTIKGSXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 180 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAV GDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVXXGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 3561 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT SALLEDEFTPFDVVR Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTXXXSALLEDEFTPFDVVR 296
> 1q2w_A A 3C-like protease
Length=308 Score = 611 bits (1576), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC MLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 1q2w_B B 3C-like protease
Length=308 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/301 (94%), Positives = 291/301 (97%), Gaps = 0/301 (0%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT PNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXXXXXXPNYEDLLIR 62 Query 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 3564 S 3564 S Sbjct 303 S 303
> 3fzd_A A 3C-like proteinase
Length=301 Score = 610 bits (1573), Expect = 0.0, Method: Compositional matrix adjust. Identities = 283/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTL GLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLAGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKG NGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGXXXNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 3564 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 3f9g_B B 3C-like proteinase
Length=303 Score = 607 bits (1566), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/298 (95%), Positives = 290/298 (97%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 6xho_B B 3C-like proteinase
Length=307 Score = 607 bits (1565), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/298 (95%), Positives = 290/298 (97%), Gaps = 0/298 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNG TILGS +LEDEFTPFDVVRQC Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGXXXXTILGSTILEDEFTPFDVVRQC 301
> 7c2q_B B 3C-like proteinase
Length=296 Score = 602 bits (1551), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/296 (96%), Positives = 284/296 (96%), Gaps = 0/296 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIRKS 60 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKG GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 121 SGVYQCAMRPNFTIKGXXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 180 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 3561 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN TILGSALLEDEFTPFDVVR Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNXXTILGSALLEDEFTPFDVVR 296
> 7c2y_B B 3C-like proteinase
Length=298 Score = 598 bits (1542), Expect = 0.0, Method: Compositional matrix adjust. Identities = 283/296 (96%), Positives = 283/296 (96%), Gaps = 0/296 (0%) Query 3266 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 3325 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIRKS 62 Query 3326 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 3385 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 3386 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 3445 SGVYQCAMRPNFTIKG GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 123 SGVYQCAMRPNFTIKGXXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 Query 3446 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 3505 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 3506 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 3561 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGM TILGSALLEDEFTPFDVVR Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMXXXTILGSALLEDEFTPFDVVR 298
> 2pwx_A A 3C-like proteinase
Length=308 Score = 592 bits (1526), Expect = 0.0, Method: Compositional matrix adjust. Identities = 276/296 (93%), Positives = 284/296 (96%), Gaps = 0/296 (0%) Query 3267 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 3326 RKMAFPS KVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSN Sbjct 6 RKMAFPSAKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSN 65 Query 3327 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 3386 H+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 66 HSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPS 125 Query 3387 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 3446 GVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG FYG Sbjct 126 GVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGKFYG 185 Query 3447 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 3506 PFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLN TTLNDFNLVAMKYNYEPLT Sbjct 186 PFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNXXXTTLNDFNLVAMKYNYEPLT 245 Query 3507 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 3562 QDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM TILGS +LEDEFTPFDVVRQ Sbjct 246 QDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXXTILGSTILEDEFTPFDVVRQ 301
> 6yva_A A Replicase polyprotein 1a
Length=315 Score = 588 bits (1515), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/309 (91%), Positives = 282/309 (91%), Gaps = 0/309 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN Sbjct 1 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 60 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN YLATALLTL Sbjct 61 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTL 120 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS Sbjct 121 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 180 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 CKRV QTTLKGVEAVMYMGTLSYEQFKK LVQQESP Sbjct 181 CKRVXXXXXXXXXXXQTTLKGVEAVMYMGTLSYEQFKKXXXXXXXXXXXXXXXLVQQESP 240 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI Sbjct 241 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 300 Query 1864 TDVFYKENS 1872 TDVFYKENS Sbjct 301 TDVFYKENS 309
> 5tl6_A B Replicase polyprotein 1ab
Length=319 Score = 562 bits (1448), Expect = 8e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 5 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 64 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 65 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 124 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 125 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 184 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 185 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 244 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 245 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 304 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 305 TDVFYKETSYTTTIK 319
> 4mm3_B B Papain-like proteinase
Length=316 Score = 562 bits (1448), Expect = 8e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 302 TDVFYKETSYTTTIK 316
> 5tl7_B B Replicase polyprotein 1ab
Length=319 Score = 562 bits (1448), Expect = 9e-180, Method: Compositional matrix adjust. Identities = 261/315 (83%), Positives = 286/315 (91%), Gaps = 0/315 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 5 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 64 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 65 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 124 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 125 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 184 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 185 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 244 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 245 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 304 Query 1864 TDVFYKENSYTTTIK 1878 TDVFYKE SYTTTIK Sbjct 305 TDVFYKETSYTTTIK 319
> 4m0w_A A Replicase polyprotein 1a
Length=327 Score = 562 bits (1449), Expect = 9e-180, Method: Compositional matrix adjust. Identities = 261/317 (82%), Positives = 287/317 (91%), Gaps = 0/317 (0%) Query 1565 VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPND 1624 V+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+D Sbjct 3 VKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSD 62 Query 1625 DTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQ 1684 DTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQ Sbjct 63 DTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNSYLSSVLLALQ 122 Query 1685 QIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSC 1744 Q+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 123 QLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESA 182 Query 1745 KRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF 1804 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES F Sbjct 183 KRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSF 242 Query 1805 VMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT 1864 VMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+T Sbjct 243 VMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVT 302 Query 1865 DVFYKENSYTTTIKPVT 1881 DVFYKE SYTTTIKPV+ Sbjct 303 DVFYKETSYTTTIKPVS 319
> 5e6j_A A Replicase polyprotein 1ab
Length=325 Score = 561 bits (1446), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/317 (82%), Positives = 287/317 (91%), Gaps = 0/317 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTIKPVTY 1882 VFYKE SYTTTIKP+ + Sbjct 304 VFYKETSYTTTIKPLEH 320
> 5y3e_A A Replicase polyprotein 1a
Length=323 Score = 561 bits (1445), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 5y3q_A A Replicase polyprotein 1a
Length=323 Score = 561 bits (1445), Expect = 2e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 2fe8_A A Replicase polyprotein 1ab
Length=315 Score = 560 bits (1443), Expect = 4e-179, Method: Compositional matrix adjust. Identities = 260/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 302 TDVFYKETSYTTTI 315
> 5tl7_D D Replicase polyprotein 1ab
Length=319 Score = 558 bits (1439), Expect = 1e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 7 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 66 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 67 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 126 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 127 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 186 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 187 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 246 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 247 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 306 Query 1866 VFYKENSYTTTIK 1878 VFYKE SYTTTIK Sbjct 307 VFYKETSYTTTIK 319
> 2fe8_B B Replicase polyprotein 1ab
Length=315 Score = 558 bits (1438), Expect = 2e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTTT 1876 TDVFYKE SYTTT Sbjct 302 TDVFYKETSYTTT 314
> 5e6j_D D Replicase polyprotein 1ab
Length=325 Score = 558 bits (1439), Expect = 2e-178, Method: Compositional matrix adjust. Identities = 259/313 (83%), Positives = 284/313 (91%), Gaps = 0/313 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTIK 1878 VFYKE SYTTTIK Sbjct 304 VFYKETSYTTTIK 316
> 5tl6_B D Replicase polyprotein 1ab
Length=319 Score = 557 bits (1436), Expect = 3e-178, Method: Compositional matrix adjust. Identities = 259/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1567 TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDT 1626 TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DDT Sbjct 8 TIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDT 67 Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ+ Sbjct 68 LRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQL 127 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KR Sbjct 128 EVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKR 187 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVM Sbjct 188 VLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVM 247 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TDV Sbjct 248 MSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDV 307 Query 1867 FYKENSYTTTIK 1878 FYKE SYTTTIK Sbjct 308 FYKETSYTTTIK 319
> 3e9s_A A Non-structural protein 3
Length=322 Score = 557 bits (1436), Expect = 3e-178, Method: Compositional matrix adjust. Identities = 259/314 (82%), Positives = 284/314 (90%), Gaps = 0/314 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 4 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 63 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL L Sbjct 64 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLAL 123 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 124 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 183 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 184 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 243 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 244 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 303 Query 1864 TDVFYKENSYTTTI 1877 TDVFYKE SYTTTI Sbjct 304 TDVFYKETSYTTTI 317
> 2fe8_C C Replicase polyprotein 1ab
Length=315 Score = 556 bits (1434), Expect = 5e-178, Method: Compositional matrix adjust. Identities = 258/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1564 EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPN 1623 EV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+ Sbjct 2 EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS 61 Query 1624 DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTL 1683 DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL L Sbjct 62 DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLAL 121 Query 1684 QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS 1743 QQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S Sbjct 122 QQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLES 181 Query 1744 CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP 1803 KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES Sbjct 182 AKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESS 241 Query 1804 FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI 1863 FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+ Sbjct 242 FVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV 301 Query 1864 TDVFYKENSYTT 1875 TDVFYKE SYTT Sbjct 302 TDVFYKETSYTT 313
> 3mj5_A A Replicase polyprotein 1a
Length=316 Score = 556 bits (1434), Expect = 6e-178, Method: Compositional matrix adjust. Identities = 258/312 (83%), Positives = 283/312 (91%), Gaps = 0/312 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTI 1877 VFYKE SYTTTI Sbjct 304 VFYKETSYTTTI 315
> 4ow0_A A papain-like protease
Length=320 Score = 553 bits (1425), Expect = 1e-176, Method: Compositional matrix adjust. Identities = 257/312 (82%), Positives = 282/312 (90%), Gaps = 0/312 (0%) Query 1566 RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD 1625 +TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DD Sbjct 4 KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDD 63 Query 1626 TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ 1685 TLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ Sbjct 64 TLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQ 123 Query 1686 IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK 1745 +E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S K Sbjct 124 LEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAK 183 Query 1746 RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV 1805 RVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FV Sbjct 184 RVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFV 243 Query 1806 MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD 1865 MMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TD Sbjct 244 MMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD 303 Query 1866 VFYKENSYTTTI 1877 VFYKE SYTTTI Sbjct 304 VFYKETSYTTTI 315
> 4ovz_A A Papain-like proteinase
Length=324 Score = 538 bits (1386), Expect = 2e-171, Method: Compositional matrix adjust. Identities = 250/305 (82%), Positives = 274/305 (90%), Gaps = 0/305 (0%) Query 1571 FTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVE 1630 FTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +HEGKTF+VLP+DDTLR E Sbjct 9 FTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSE 68 Query 1631 AFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKF 1690 AFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ+E+KF Sbjct 69 AFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQLEVKF 128 Query 1691 NPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNV 1750 N PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KRVLNV Sbjct 129 NAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNV 188 Query 1751 VCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAP 1810 VCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVMMSAP Sbjct 189 VCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAP 248 Query 1811 PAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKE 1870 PA+Y+L+ GTF CA+EYTGNYQ GHY HIT+KETLY IDGA LTK SEYKGP+TDVFYKE Sbjct 249 PAEYKLQQGTFLCANEYTGNYQXGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKE 308 Query 1871 NSYTT 1875 SYTT Sbjct 309 TSYTT 313
> 3mj5_B B Replicase polyprotein 1a
Length=316 Score = 460 bits (1183), Expect = 3e-144, Method: Compositional matrix adjust. Identities = 213/262 (81%), Positives = 235/262 (90%), Gaps = 0/262 (0%) Query 1617 TFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYL 1676 TF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNCYL Sbjct 55 TFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYL 114 Query 1677 ATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLF 1736 ++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L Sbjct 115 SSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLL 174 Query 1737 QHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKY 1796 QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+Y Sbjct 175 QHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQY 234 Query 1797 LVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKS 1856 LVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK Sbjct 235 LVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKM 294 Query 1857 SEYKGPITDVFYKENSYTTTIK 1878 SEYKGP+TDVFYKE SYTTTIK Sbjct 295 SEYKGPVTDVFYKETSYTTTIK 316
> 4ow0_B B papain-like protease
Length=320 Score = 452 bits (1164), Expect = 1e-141, Method: Compositional matrix adjust. Identities = 210/260 (81%), Positives = 232/260 (89%), Gaps = 0/260 (0%) Query 1619 YVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLAT 1678 +VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ Sbjct 57 FVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSS 116 Query 1679 ALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH 1738 LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QH Sbjct 117 VLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQH 176 Query 1739 ANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV 1798 ANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLV Sbjct 177 ANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLV 236 Query 1799 QQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSE 1858 QQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SE Sbjct 237 QQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSE 296 Query 1859 YKGPITDVFYKENSYTTTIK 1878 YKGP+TDVFYKE SYTTTIK Sbjct 297 YKGPVTDVFYKETSYTTTIK 316
> 4ovz_B B Papain-like proteinase
Length=320 Score = 438 bits (1126), Expect = 2e-136, Method: Compositional matrix adjust. Identities = 204/252 (81%), Positives = 224/252 (89%), Gaps = 0/252 (0%) Query 1627 LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI 1686 LR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN YL++ LL LQQ+ Sbjct 65 LRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNXYLSSVLLALQQL 124 Query 1687 ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKR 1746 E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++L QHANL+S KR Sbjct 125 EVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKR 184 Query 1747 VLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM 1806 VLNVVCK CGQ+ TTL GVEAVMYMGTLSY+ K GV IPC CG+ AT+YLVQQES FVM Sbjct 185 VLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVM 244 Query 1807 MSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDV 1866 MSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA LTK SEYKGP+TDV Sbjct 245 MSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDV 304 Query 1867 FYKENSYTTTIK 1878 FYKE SYTTTIK Sbjct 305 FYKETSYTTTIK 316
> 2wct_B B NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2wct_A A NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2w2g_A A NON-STRUCTURAL PROTEIN 3
Length=264 Score = 410 bits (1055), Expect = 6e-128, Method: Compositional matrix adjust. Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2w2g_B B NON-STRUCTURAL PROTEIN 3
Length=264 Score = 402 bits (1033), Expect = 6e-125, Method: Compositional matrix adjust. Identities = 192/260 (74%), Positives = 221/260 (85%), Gaps = 0/260 (0%) Query 1235 CVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEG 1294 C++EVTTTLEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV+ G Sbjct 5 CIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSG 64 Query 1295 VLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFY 1354 +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCKSAFY Sbjct 65 DITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFY 124 Query 1355 ILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEG 1414 +LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIKIQEG Sbjct 125 VLPSEAPXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEG 184 Query 1415 VVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPAT 1474 +VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ PA Sbjct 185 IVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAV 244 Query 1475 VSVSSPDAVTAYNGYLTSSS 1494 VSVSSPDAVT YNGYLTSSS Sbjct 245 VSVSSPDAVTTYNGYLTSSS 264
> 2wct_C C NON-STRUCTURAL PROTEIN 3
Length=264 Score = 401 bits (1030), Expect = 2e-124, Method: Compositional matrix adjust. Identities = 191/264 (72%), Positives = 220/264 (83%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++ LEETKFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDXXXXXLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2wct_D D NON-STRUCTURAL PROTEIN 3
Length=264 Score = 392 bits (1007), Expect = 2e-121, Method: Compositional matrix adjust. Identities = 187/264 (71%), Positives = 216/264 (82%), Gaps = 0/264 (0%) Query 1231 KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDV 1290 KIKAC++ KFLT LLL+ DING L+ DS ++ D++FL+KDAPY+VGDV Sbjct 1 KIKACIDXXXXXXXXXKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDV 60 Query 1291 VQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK 1350 + G +T VVIP+KKAGGTTEML++AL+KVP D YITTYPGQG GYT+EEAKT LKKCK Sbjct 61 ITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCK 120 Query 1351 SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIK 1410 SAFY+LPS EILGTVSWNLREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK Sbjct 121 SAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIK 180 Query 1411 IQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLK 1470 IQEG+VDYG RF+FYTSK VAS+I LN LNE LVTMP+GYVTHG NLEEAAR MRSL+ Sbjct 181 IQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLR 240 Query 1471 VPATVSVSSPDAVTAYNGYLTSSS 1494 PA VSVSSPDAVT YNGYLTSSS Sbjct 241 APAVVSVSSPDAVTTYNGYLTSSS 264
> 2ahm_H H Replicase polyprotein 1ab, heavy chain
Length=203 Score = 384 bits (985), Expect = 2e-119, Method: Compositional matrix adjust. Identities = 186/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%) Query 3944 IASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK 4003 IASEFSSLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK Sbjct 7 IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK 66 Query 4004 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP 4063 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP Sbjct 67 MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP 126 Query 4064 LTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLA 4123 LTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLA Sbjct 127 LTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLA 186 Query 4124 WPLIVTALRAN 4134 WPLIVTALRAN Sbjct 187 WPLIVTALRAN 197
> 6xez_D D nsp8
Length=199 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 7 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 66 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 67 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 126 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 186 Query 4128 VTALRA 4133 VTALRA Sbjct 187 VTALRA 192
> 6xez_B B nsp8
Length=199 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 7 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 66 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 67 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 126 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 186 Query 4128 VTALRA 4133 VTALRA Sbjct 187 VTALRA 192
> 6yyt_D D nsp8
Length=201 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 9 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 68 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 69 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 128 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 129 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 188 Query 4128 VTALRA 4133 VTALRA Sbjct 189 VTALRA 194
> 6yyt_B B nsp8
Length=201 Score = 383 bits (983), Expect = 4e-119, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%) Query 3948 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 4007 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ Sbjct 9 FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQ 68 Query 4008 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 4067 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA Sbjct 69 AMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTA 128 Query 4068 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 4127 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI Sbjct 129 AKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLI 188 Query 4128 VTALRA 4133 VTALRA Sbjct 189 VTALRA 194
> 2ahm_G G Replicase polyprotein 1ab, heavy chain
Length=203 Score = 382 bits (982), Expect = 5e-119, Method: Compositional matrix adjust. Identities = 186/191 (97%), Positives = 189/191 (99%), Gaps = 0/191 (0%) Query 3943 AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE 4002 AIASEFSSLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE Sbjct 6 AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE 65 Query 4003 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII 4062 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII Sbjct 66 KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII 125 Query 4063 PLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNL 4122 PLTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNL Sbjct 126 PLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNL 185 Query 4123 AWPLIVTALRA 4133 AWPLIVTALRA Sbjct 186 AWPLIVTALRA 196
> 6wey_A A Non-structural protein 3
Length=172 Score = 350 bits (899), Expect = 3e-108, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 2 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 61 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 62 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 121 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS 1195 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS Sbjct 122 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS 172
> 6ywm_A A NSP3 macrodomain
Length=173 Score = 349 bits (895), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_D D Non-structural protein 3
Length=176 Score = 349 bits (895), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_B B Non-structural protein 3
Length=176 Score = 349 bits (895), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6ywk_C C NSP3 macrodomain
Length=173 Score = 348 bits (894), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6ywl_C C NSP3 macrodomain
Length=173 Score = 348 bits (894), Expect = 1e-107, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 1194 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK 173
> 6woj_A A Non-structural protein 3
Length=176 Score = 347 bits (890), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6woj_C C Non-structural protein 3
Length=176 Score = 347 bits (890), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_E E NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_B B NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywl_A A NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_E E NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_D D NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_A A NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywk_B B NSP3 macrodomain
Length=173 Score = 347 bits (889), Expect = 5e-107, Method: Compositional matrix adjust. Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 1193 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEM 172
> 6ywm_B B NSP3 macrodomain
Length=173 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 171
> 6wen_A A Non-structural protein 3
Length=170 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 170
> 6w6y_A A SARS-CoV-2 NSP3
Length=170 Score = 344 bits (883), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 170
> 6ywl_D D NSP3 macrodomain
Length=173 Score = 344 bits (883), Expect = 4e-106, Method: Compositional matrix adjust. Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 1192 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE 171
> 6vxs_B B Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6vxs_A A Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6w02_B B Non-structural protein 3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6w6y_B B SARS-CoV-2 NSP3
Length=170 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 3 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 62 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 63 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 122 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 6ywm_C C NSP3 macrodomain
Length=173 Score = 342 bits (877), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%) Query 1025 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 1084 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ Sbjct 4 VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ 63 Query 1085 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 1144 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL Sbjct 64 VESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVL 123 Query 1145 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 124 LAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 170
> 6wcf_A A Non-structural protein 3
Length=170 Score = 341 bits (874), Expect = 6e-105, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 1026 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 1085 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV Sbjct 4 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 63 Query 1086 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 1145 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL Sbjct 64 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 123 Query 1146 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 124 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 169
> 7jme_A A Non-structural protein 3
Length=172 Score = 341 bits (874), Expect = 7e-105, Method: Compositional matrix adjust. Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%) Query 1026 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 1085 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV Sbjct 3 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 62 Query 1086 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 1145 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL Sbjct 63 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 122 Query 1146 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 1191 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL Sbjct 123 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL 168
> 6w02_A A Non-structural protein 3
Length=170 Score = 339 bits (869), Expect = 2e-104, Method: Compositional matrix adjust. Identities = 165/165 (100%), Positives = 165/165 (100%), Gaps = 0/165 (0%) Query 1026 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 1085 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV Sbjct 4 NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQV 63 Query 1086 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 1145 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL Sbjct 64 ESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLL 123 Query 1146 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF 1190 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF Sbjct 124 APLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF 168
> 4rsp_A A Orf1a protein
Length=310 Score = 324 bits (831), Expect = 4e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLXGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_A A ORF1a protein
Length=306 Score = 323 bits (828), Expect = 8e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_D D ORF1a protein
Length=306 Score = 323 bits (828), Expect = 8e-97, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 5wkj_A A Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 6vh2_B B Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 5wkl_A A Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 6vh3_B B Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 3560 VRQCSGV 3566 Q GV Sbjct 304 NMQIMGV 310
> 6vh3_A A Orf1a protein
Length=313 Score = 322 bits (826), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 206/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHXXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 4wme_A A MERS-CoV 3CL protease
Length=306 Score = 322 bits (825), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 4wme_D D MERS-CoV 3CL protease
Length=306 Score = 322 bits (825), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 5wkk_A A Orf1a protein
Length=313 Score = 322 bits (825), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 205/308 (67%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 4ylu_B B ORF1a protein
Length=306 Score = 321 bits (823), Expect = 4e-96, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 4ylu_C C ORF1a protein
Length=306 Score = 321 bits (823), Expect = 4e-96, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 5wkm_A A Orf1a protein
Length=313 Score = 321 bits (823), Expect = 5e-96, Method: Compositional matrix adjust. Identities = 156/308 (51%), Positives = 204/308 (66%), Gaps = 8/308 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPXXQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQCSGV 3566 V Q GV Sbjct 303 VNMQIMGV 310
> 5c3n_A A ORF1a protein
Length=306 Score = 320 bits (821), Expect = 6e-96, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 5c3n_B B ORF1a protein
Length=306 Score = 320 bits (820), Expect = 9e-96, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 4wme_B B MERS-CoV 3CL protease
Length=306 Score = 320 bits (820), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wmd_B B ORF1a
Length=306 Score = 320 bits (820), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 6vh2_A A Orf1a protein
Length=313 Score = 320 bits (820), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 4wmd_C C ORF1a
Length=306 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 4wmf_B B MERS-CoV 3CL protease
Length=306 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 6vh1_B B Orf1a protein
Length=313 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vgz_B B Orf1a protein
Length=313 Score = 320 bits (819), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vgy_B B Orf1a protein
Length=313 Score = 320 bits (819), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vh0_B B Orf1a protein
Length=313 Score = 320 bits (819), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vh1_A A Orf1a protein
Length=313 Score = 320 bits (819), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vgy_A A Orf1a protein
Length=313 Score = 320 bits (819), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vh0_A A Orf1a protein
Length=313 Score = 320 bits (819), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 6vgz_A A Orf1a protein
Length=313 Score = 319 bits (818), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 154/304 (51%), Positives = 204/304 (67%), Gaps = 8/304 (3%) Query 3263 QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLI 3322 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 7 HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLI 66 Query 3323 RKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLA 3379 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLA Sbjct 67 SMTNHSFSVQKHXXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLA 126 Query 3380 CYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTD 3439 CYNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 127 CYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSA 186 Query 3440 LEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMK 3499 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 187 FDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALA 246 Query 3500 YNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD 3558 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP D Sbjct 247 NQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED 302 Query 3559 VVRQ 3562 V Q Sbjct 303 VNMQ 306
> 4wme_C C MERS-CoV 3CL protease
Length=306 Score = 318 bits (815), Expect = 5e-95, Method: Compositional matrix adjust. Identities = 154/306 (50%), Positives = 204/306 (67%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQIMG 302
> 4wmd_A A ORF1a
Length=306 Score = 317 bits (813), Expect = 9e-95, Method: Compositional matrix adjust. Identities = 153/303 (50%), Positives = 203/303 (67%), Gaps = 8/303 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQ 3562 Q Sbjct 297 NMQ 299
> 4wmf_A A MERS-CoV 3CL protease
Length=306 Score = 317 bits (812), Expect = 1e-94, Method: Compositional matrix adjust. Identities = 154/307 (50%), Positives = 204/307 (66%), Gaps = 8/307 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PS VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSXDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 3560 VRQCSGV 3566 Q GV Sbjct 297 NMQIMGV 303
> 2ahm_E E Replicase polyprotein 1ab, heavy chain
Length=203 Score = 312 bits (799), Expect = 2e-94, Method: Composition-based stats. Identities = 151/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%) Query 3980 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK 4039 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK Sbjct 43 LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRK 102 Query 4040 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQ 4099 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV+PDY TYKNTCDG TFTYASALWEIQ Sbjct 103 LDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQ 162 Query 4100 QVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN 4134 QVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRAN Sbjct 163 QVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN 197
> 4yog_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yo9_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_B B 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yog_A A 3C-like proteinase
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2ynb_A A 3C-LIKE PROTEINASE
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2yna_A A 3C-LIKE PROTEINASE
Length=306 Score = 313 bits (801), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSGVTFQ 3569 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2yna_B B 3C-LIKE PROTEINASE
Length=306 Score = 309 bits (791), Expect = 7e-92, Method: Compositional matrix adjust. Identities = 152/306 (50%), Positives = 203/306 (66%), Gaps = 8/306 (3%) Query 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 3324 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 3380 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 3381 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 3440 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 3441 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 3500 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 3501 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 3559 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 3560 VRQCSG 3565 Q G Sbjct 297 NMQVMG 302 Lambda K H a alpha 0.320 0.135 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 317546765480 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40