[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= YP_009725301.1 3C-like proteinase [Severe acute respiratory syndrome
coronavirus 2]

Length=306
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  6xbi_A A main protease                                               641    0.0   
  6lu7_A A main protease                                               640    0.0   
  6xqt_A A 3C-like proteinase                                          640    0.0   
  6xqt_B B 3C-like proteinase                                          640    0.0   
  7c8t_A A 3C-like proteinase                                          640    0.0   
  6z2e_A AAA Main Protease                                             640    0.0   
  6wqf_A A 3C-like proteinase                                          640    0.0   
  7buy_A A SARS-CoV-2 virus Main protease                              640    0.0   
  6xhu_A A 3C-like proteinase                                          640    0.0   
  6ynq_A A Replicase polyprotein 1ab                                   640    0.0   
  6m2n_B B SARS-CoV-2 3CL protease                                     640    0.0   
  6m2n_D D SARS-CoV-2 3CL protease                                     640    0.0   
  6m2n_A A SARS-CoV-2 3CL protease                                     640    0.0   
  6xb2_A A 3C-like proteinase                                          640    0.0   
  6xch_A A 3C-like proteinase                                          640    0.0   
  7c8r_A A 3C-like proteinase                                          640    0.0   
  6m03_A A main protease                                               640    0.0   
  7cwb_A A 3C-like proteinase                                          640    0.0   
  6xhu_B C 3C-like proteinase                                          640    0.0   
  6wnp_A A 3C-like proteinase                                          640    0.0   
  6wtk_A A 3C-like proteinase                                          640    0.0   
  7k3t_A A 3C-like proteinase                                          640    0.0   
  7k40_A A 3C-like proteinase                                          640    0.0   
  6yvf_A A Replicase polyprotein 1ab                                   640    0.0   
  6xqu_A A 3C-like proteinase                                          640    0.0   
  7jvz_A A 3C-like proteinase                                          640    0.0   
  6xqs_A A 3C-like proteinase                                          640    0.0   
  6yt8_A A Replicase polyprotein 1ab                                   640    0.0   
  6yb7_A A Replicase polyprotein 1ab                                   640    0.0   
  7jyc_A A 3C-like proteinase                                          640    0.0   
  6y2e_A A Replicase polyprotein 1ab                                   640    0.0   
  7jun_A A 3C-like proteinase                                          640    0.0   
  6wtm_A A 3C-like proteinase                                          640    0.0   
  6wtj_A A 3C-like proteinase                                          640    0.0   
  6wtm_B B 3C-like proteinase                                          640    0.0   
  6w63_A A 3C-like proteinase                                          638    0.0   
  6m2n_C C SARS-CoV-2 3CL protease                                     638    0.0   
  6m2q_A A SARS-CoV-2 3CL protease                                     638    0.0   
  7k6e_A A 3C-like proteinase                                          638    0.0   
  7k6d_A A 3C-like proteinase                                          638    0.0   
  7jfq_A A 3C-like proteinase                                          638    0.0   
  6xr3_A A 3C-like proteinase                                          638    0.0   
  6xoa_B B 3C-like proteinase                                          638    0.0   
  6xoa_D D 3C-like proteinase                                          638    0.0   
  6xoa_C C 3C-like proteinase                                          638    0.0   
  6xoa_A A 3C-like proteinase                                          638    0.0   
  6xkf_A A 3C-like proteinase                                          637    0.0   
  6xb0_A A 3C-like proteinase                                          637    0.0   
  6xkh_A A 3C-like proteinase                                          637    0.0   
  6xb1_A A 3C-like proteinase                                          637    0.0   
  6xkf_B B 3C-like proteinase                                          637    0.0   
  6xa4_A A main protease                                               636    0.0   
  6xbh_A A main protease                                               636    0.0   
  6xfn_A A main protease                                               636    0.0   
  6m0k_A A Replicase polyprotein 1ab                                   636    0.0   
  5r81_A A 3C-like proteinase                                          636    0.0   
  5rfg_A A 3C-like proteinase                                          636    0.0   
  5rf1_A A 3C-like proteinase                                          636    0.0   
  5rfv_A A 3C-like proteinase                                          636    0.0   
  5rea_A A 3C-like proteinase                                          636    0.0   
  5reh_A A 3C-like proteinase                                          636    0.0   
  5re9_A A 3C-like proteinase                                          636    0.0   
  5rfo_A A 3C-like proteinase                                          636    0.0   
  5rfy_A A 3C-like proteinase                                          636    0.0   
  5r82_A A 3C-like proteinase                                          636    0.0   
  5rft_A A 3C-like proteinase                                          636    0.0   
  5rfd_A A 3C-like proteinase                                          636    0.0   
  5r7y_A A 3C-like proteinase                                          636    0.0   
  5r7z_A A 3C-like proteinase                                          636    0.0   
  5rfx_A A 3C-like proteinase                                          636    0.0   
  5rfs_A A 3C-like proteinase                                          636    0.0   
  5rfq_A A 3C-like proteinase                                          636    0.0   
  5rfn_A A 3C-like proteinase                                          636    0.0   
  5rfp_A A 3C-like proteinase                                          636    0.0   
  5rfj_A A 3C-like proteinase                                          636    0.0   
  5rfi_A A 3C-like proteinase                                          636    0.0   
  5rf9_A A 3C-like proteinase                                          636    0.0   
  5rf8_A A 3C-like proteinase                                          636    0.0   
  5rf7_A A 3C-like proteinase                                          636    0.0   
  5rf6_A A 3C-like proteinase                                          636    0.0   
  5rf3_A A 3C-like proteinase                                          636    0.0   
  5rf4_A A 3C-like proteinase                                          636    0.0   
  5rez_A A 3C-like proteinase                                          636    0.0   
  5rew_A A 3C-like proteinase                                          636    0.0   
  5rev_A A 3C-like proteinase                                          636    0.0   
  5rex_A A 3C-like proteinase                                          636    0.0   
  5reu_A A 3C-like proteinase                                          636    0.0   
  5reo_A A 3C-like proteinase                                          636    0.0   
  5rep_A A 3C-like proteinase                                          636    0.0   
  5rem_A A 3C-like proteinase                                          636    0.0   
  5rel_A A 3C-like proteinase                                          636    0.0   
  5rej_A A 3C-like proteinase                                          636    0.0   
  5reg_A A 3C-like proteinase                                          636    0.0   
  5ree_A A 3C-like proteinase                                          636    0.0   
  5reb_A A 3C-like proteinase                                          636    0.0   
  5re6_A A 3C-like proteinase                                          636    0.0   
  5re4_A A 3C-like proteinase                                          636    0.0   
  5r84_A A 3C-like proteinase                                          636    0.0   
  5rg2_A A 3C-like proteinase                                          636    0.0   
  5rgq_A A 3C-like proteinase                                          636    0.0   
  5rgn_A A 3C-like proteinase                                          636    0.0   
  5rgk_A A 3C-like proteinase                                          636    0.0   
  6yz6_A A Main Protease                                               636    0.0   
  5rek_A A 3C-like proteinase                                          636    0.0   
  5rei_A A 3C-like proteinase                                          636    0.0   
  5rgj_A A 3C-like proteinase                                          636    0.0   
  5rf5_A A 3C-like proteinase                                          636    0.0   
  5rhc_A A 3C-like proteinase                                          636    0.0   
  5rhe_A A 3C-like proteinase                                          636    0.0   
  5rfk_A A 3C-like proteinase                                          636    0.0   
  5rhf_A A 3C-like proteinase                                          636    0.0   
  5r8t_A A 3C-like proteinase                                          636    0.0   
  5rh4_A A 3C-like proteinase                                          636    0.0   
  5rgp_A A 3C-like proteinase                                          636    0.0   
  5red_A A 3C-like proteinase                                          636    0.0   
  5rgo_A A 3C-like proteinase                                          636    0.0   
  5rfu_A A 3C-like proteinase                                          636    0.0   
  5res_A A 3C-like proteinase                                          636    0.0   
  5rfz_A A 3C-like proteinase                                          636    0.0   
  5rfr_A A 3C-like proteinase                                          636    0.0   
  5rhd_A A 3C-like proteinase                                          636    0.0   
  5rhb_A A 3C-like proteinase                                          636    0.0   
  5rfm_A A 3C-like proteinase                                          636    0.0   
  5rha_A A 3C-like proteinase                                          636    0.0   
  5rgm_A A 3C-like proteinase                                          636    0.0   
  5rg0_A A 3C-like proteinase                                          636    0.0   
  5re8_A A 3C-like proteinase                                          636    0.0   
  5rh0_A A 3C-like proteinase                                          636    0.0   
  5rgz_A A 3C-like proteinase                                          636    0.0   
  5rgy_A A 3C-like proteinase                                          636    0.0   
  5rgv_A A 3C-like proteinase                                          636    0.0   
  5rh2_A A 3C-like proteinase                                          636    0.0   
  5rh3_A A 3C-like proteinase                                          636    0.0   
  5rgx_A A 3C-like proteinase                                          636    0.0   
  5rgw_A A 3C-like proteinase                                          636    0.0   
  5rgt_A A 3C-like proteinase                                          636    0.0   
  5rh9_A A 3C-like proteinase                                          636    0.0   
  5rh8_A A 3C-like proteinase                                          636    0.0   
  5rh7_A A 3C-like proteinase                                          636    0.0   
  5rh5_A A 3C-like proteinase                                          636    0.0   
  5rh6_A A 3C-like proteinase                                          636    0.0   
  5rgi_A A 3C-like proteinase                                          636    0.0   
  5rgu_A A 3C-like proteinase                                          636    0.0   
  5rgh_A A 3C-like proteinase                                          636    0.0   
  5ren_A A 3C-like proteinase                                          636    0.0   
  5re7_A A 3C-like proteinase                                          636    0.0   
  6zru_A A Main Protease                                               636    0.0   
  6zrt_A A Main Protease                                               636    0.0   
  5rfl_A A 3C-like proteinase                                          636    0.0   
  5rfh_A A 3C-like proteinase                                          636    0.0   
  5rf0_A A 3C-like proteinase                                          636    0.0   
  5rfc_A A 3C-like proteinase                                          636    0.0   
  5rg3_A A 3C-like proteinase                                          636    0.0   
  5rfe_A A 3C-like proteinase                                          636    0.0   
  5ref_A A 3C-like proteinase                                          636    0.0   
  5rgl_A A 3C-like proteinase                                          636    0.0   
  5rf2_A A 3C-like proteinase                                          636    0.0   
  5r80_A A 3C-like proteinase                                          636    0.0   
  5rh1_A A 3C-like proteinase                                          636    0.0   
  5ret_A A 3C-like proteinase                                          636    0.0   
  5r83_A A 3C-like proteinase                                          636    0.0   
  5rgg_A A 3C-like proteinase                                          636    0.0   
  5rgs_A A 3C-like proteinase                                          636    0.0   
  5rey_A A 3C-like proteinase                                          636    0.0   
  5rfb_A A 3C-like proteinase                                          636    0.0   
  5rec_A A 3C-like proteinase                                          636    0.0   
  5rfw_A A 3C-like proteinase                                          636    0.0   
  5rg1_A A 3C-like proteinase                                          636    0.0   
  5rgr_A A 3C-like proteinase                                          636    0.0   
  5re5_A A 3C-like proteinase                                          636    0.0   
  7ju7_A A 3C-like proteinase                                          636    0.0   
  5rff_A A 3C-like proteinase                                          636    0.0   
  5rer_A A 3C-like proteinase                                          636    0.0   
  6y84_A A Replicase polyprotein 1ab                                   636    0.0   
  6lze_A A Replicase polyprotein 1ab                                   634    0.0   
  6y2g_B B Replicase polyprotein 1ab                                   634    0.0   
  6xbg_B B main protease                                               634    0.0   
  6y2f_A A Replicase polyprotein 1ab                                   633    0.0   
  6xhm_A A 3C-like proteinase                                          632    0.0   
  6xbi_B B main protease                                               632    0.0   
  6xmk_B B 3C-like proteinase                                          632    0.0   
  6wtt_A A 3C-like proteinase                                          632    0.0   
  6wtt_C C 3C-like proteinase                                          632    0.0   
  6wtt_B B 3C-like proteinase                                          632    0.0   
  7brr_A A 3C-like proteinase                                          632    0.0   
  7c7p_A A main protease                                               630    0.0   
  7bqy_A A main protease                                               630    0.0   
  6xhm_B B 3C-like proteinase                                          630    0.0   
  6y2g_A A Replicase polyprotein 1ab                                   630    0.0   
  7com_A A main protease                                               630    0.0   
  7d1o_A A 3C-like proteinase                                          630    0.0   
  5rfa_A A 3C-like proteinase                                          630    0.0   
  7c6u_A A 3C-like proteinase                                          630    0.0   
  7c6s_A A 3C-like proteinase                                          630    0.0   
  7c8b_A A 3C-like proteinase                                          630    0.0   
  7brp_B A 3C-like proteinase                                          630    0.0   
  7jkv_A A 3C-like proteinase                                          630    0.0   
  7brp_A B 3C-like proteinase                                          630    0.0   
  7jkv_B B 3C-like proteinase                                          630    0.0   
  7c8u_A A Replicase polyprotein 1ab                                   628    0.0   
  7jr3_A A 3C-like proteinase                                          628    0.0   
  7bro_A A 3C-like proteinase                                          628    0.0   
  6xbg_A A main protease                                               628    0.0   
  7cwc_A A 3C-like proteinase                                          628    0.0   
  7brr_B B 3C-like proteinase                                          627    0.0   
  7cwc_B B 3C-like proteinase                                          627    0.0   
  7c7p_B B main protease                                               625    0.0   
  6xmk_A A 3C-like proteinase                                          624    0.0   
  7cbt_B B Replicase polyprotein 1ab                                   624    0.0   
  7cbt_A A Replicase polyprotein 1ab                                   624    0.0   
  3ea8_A A 3C-like proteinase                                          623    0.0   
  2zu4_A A 3C-like proteinase                                          623    0.0   
  2h2z_A A Replicase polyprotein 1ab                                   623    0.0   
  2zu5_A A 3C-like proteinase                                          623    0.0   
  3sne_A A 3C-like proteinase                                          623    0.0   
  3tns_A A SARS coronavirus main protease                              623    0.0   
  3snd_B B 3C-like proteinase                                          623    0.0   
  3snd_A A 3C-like proteinase                                          623    0.0   
  5n19_A A SARS coronavirus main protease                              623    0.0   
  3snb_A A 3C-like proteinase                                          623    0.0   
  2gx4_A A 3C-like proteinase                                          623    0.0   
  3snc_A A 3C-like proteinase                                          623    0.0   
  2gz9_A A Replicase polyprotein 1ab                                   623    0.0   
  6w79_A A Main protease                                               623    0.0   
  6y7m_A AAA Replicase polyprotein 1a                                  623    0.0   
  3vb5_B B 3C-like proteinase                                          623    0.0   
  6lny_A A Replicase polyprotein 1a                                    623    0.0   
  2z3c_A A Replicase polyprotein 1ab (pp1ab)                           623    0.0   
  2gz7_A A Replicase polyprotein 1ab                                   623    0.0   
  2gz8_A A Replicase polyprotein 1ab                                   623    0.0   
  2z3d_A A Replicase polyprotein 1ab (pp1ab)                           623    0.0   
  3szn_A A 3C-like proteinase                                          623    0.0   
  6lo0_A A Replicase polyprotein 1a                                    623    0.0   
  2z9k_B B 3C-like proteinase                                          623    0.0   
  5n5o_A A Replicase polyprotein 1ab                                   623    0.0   
  3tit_A A SARS coronavirus main protease                              623    0.0   
  2duc_B B Replicase polyprotein 1ab                                   623    0.0   
  2z94_A A Replicase polyprotein 1ab                                   623    0.0   
  3vb6_B B 3C-like proteinase                                          623    0.0   
  2a5a_A A 3C-like peptidase                                           623    0.0   
  2hob_A A Replicase polyprotein 1ab                                   623    0.0   
  6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like ...   623    0.0   
  3vb4_B B 3C-like proteinase                                          623    0.0   
  3tiu_A A SARS coronavirus main protease                              623    0.0   
  2z3e_A A Replicase polyprotein 1ab (pp1ab)                           623    0.0   
  2v6n_A A REPLICASE POLYPROTEIN 1AB                                   623    0.0   
  3vb3_B B 3C-like proteinase                                          623    0.0   
  6wco_A A Main protease                                               623    0.0   
  3v3m_A A 3C-like proteinase                                          623    0.0   
  2duc_A A Replicase polyprotein 1ab                                   623    0.0   
  3sn8_A A 3C-like proteinase                                          623    0.0   
  3tnt_A A SARS coronavirus main protease                              623    0.0   
  2a5i_A A 3C-like peptidase                                           623    0.0   
  3vb7_B B 3C-like proteinase                                          623    0.0   
  2z9g_A A 3C-like proteinase                                          623    0.0   
  3m3v_A A 3C-like proteinase                                          623    0.0   
  7jr4_A A 3C-like proteinase                                          622    0.0   
  7com_B B main protease                                               621    0.0   
  2z9k_A A 3C-like proteinase                                          621    0.0   
  3e91_A A 3C-like proteinase                                          621    0.0   
  3ea7_A A 3C-like proteinase                                          621    0.0   
  1wof_A A 3C-like proteinase                                          621    0.0   
  2amd_A A 3C-like proteinase                                          621    0.0   
  5b6o_A A 3C-like proteinase                                          621    0.0   
  3m3s_A A 3C-like proteinase                                          620    0.0   
  2qcy_A A 3C-like proteinase                                          620    0.0   
  1z1j_B B 3C-like proteinase                                          620    0.0   
  1z1j_A A 3C-like proteinase                                          620    0.0   
  4wy3_A A 3C-like proteinase                                          620    0.0   
  4twy_A A 3C-like proteinase                                          620    0.0   
  5c5n_A A 3C-like proteinase                                          620    0.0   
  3aw0_A A 3C-Like Proteinase                                          620    0.0   
  4tww_B B 3C-like proteinase                                          620    0.0   
  4tww_A A 3C-like proteinase                                          620    0.0   
  2z9j_B B 3C-like proteinase                                          619    0.0   
  2a5k_A A 3C-like peptidase                                           619    0.0   
  2qc2_B B 3C-like proteinase                                          619    0.0   
  3m3t_A A 3C-like proteinase                                          618    0.0   
  2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)    618    0.0   
  2amq_A A 3C-like proteinase                                          617    0.0   
  3m3v_B B 3C-like proteinase                                          617    0.0   
  2qc2_A A 3C-like proteinase                                          617    0.0   
  7cx9_A A 3C protein                                                  616    0.0   
  4mds_A A 3C-like proteinase                                          615    0.0   
  2z9j_A A 3C-like proteinase                                          615    0.0   
  2c3s_A A SARS COV 3C-LIKE PROTEINASE                                 615    0.0   
  1uk2_A A 3C-LIKE PROTEINASE                                          615    0.0   
  1uj1_B B 3C-like proteinase                                          615    0.0   
  1uk3_B B 3C-like proteinase                                          615    0.0   
  2gt7_B B 3C-like proteinase                                          615    0.0   
  1uk4_B B 3C-like proteinase                                          615    0.0   
  1uk2_B B 3C-LIKE PROTEINASE                                          615    0.0   
  1wof_B B 3C-like proteinase                                          615    0.0   
  2amd_B B 3C-like proteinase                                          615    0.0   
  6w2a_B B Replicase polyprotein 1a                                    615    0.0   
  2alv_A A Replicase polyprotein 1ab                                   615    0.0   
  2amq_B B 3C-like proteinase                                          615    0.0   
  2d2d_B B 3C-like proteinase                                          615    0.0   
  2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   613    0.0   
  3sna_A A 3C-like proteinase                                          613    0.0   
  3m3s_B B 3C-like proteinase                                          613    0.0   
  6xhn_A A 3C-like proteinase                                          613    0.0   
  6xhl_A A 3C-like proteinase                                          613    0.0   
  1uk3_A A 3C-like proteinase                                          613    0.0   
  1uk4_A A 3C-like proteinase                                          613    0.0   
  1uj1_A A 3C-like proteinase                                          613    0.0   
  3iwm_A A 3C-like proteinase                                          613    0.0   
  3vb7_A A 3C-like proteinase                                          613    0.0   
  3vb4_A A 3C-like proteinase                                          613    0.0   
  3iwm_B B 3C-like proteinase                                          613    0.0   
  3vb6_A A 3C-like proteinase                                          613    0.0   
  2z9l_B B 3C-like proteinase                                          613    0.0   
  3vb3_A A 3C-like proteinase                                          613    0.0   
  1z1i_A A 3C-like proteinase                                          613    0.0   
  3vb5_A A 3C-like proteinase                                          613    0.0   
  3ea7_B B 3C-like proteinase                                          613    0.0   
  2d2d_A A 3C-like proteinase                                          613    0.0   
  6w2a_A A Replicase polyprotein 1a                                    613    0.0   
  3eaj_B B 3C-like proteinase                                          612    0.0   
  3eaj_A A 3C-like proteinase                                          612    0.0   
  2qiq_A A Replicase polyprotein 1ab                                   612    0.0   
  2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)    612    0.0   
  3iwm_C C 3C-like proteinase                                          612    0.0   
  2bx3_A A MAIN PROTEINASE                                             612    0.0   
  3iwm_D D 3C-like proteinase                                          612    0.0   
  6xho_A A 3C-like proteinase                                          612    0.0   
  2a5k_B B 3C-like peptidase                                           612    0.0   
  2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE                            612    0.0   
  2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE                            612    0.0   
  3e91_B B 3C-like proteinase                                          610    0.0   
  3ea9_A A 3C-like proteinase                                          610    0.0   
  4hi3_B B 3C-like proteinase                                          610    0.0   
  5b6o_B B 3C-like proteinase                                          610    0.0   
  3d62_A A 3C-like proteinase                                          610    0.0   
  3aw1_A A 3C-Like Proteinase                                          610    0.0   
  2z9l_A A 3C-like proteinase                                          610    0.0   
  2gt7_A A 3C-like proteinase                                          610    0.0   
  6xhn_B B 3C-like proteinase                                          610    0.0   
  2gtb_A A 3C-like proteinase                                          610    0.0   
  2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like prot...   609    0.0   
  3f9h_B B 3C-like proteinase                                          609    0.0   
  4hi3_A A 3C-like proteinase                                          609    0.0   
  5c5o_A A 3C-like proteinase                                          608    0.0   
  3aw1_B B 3C-Like Proteinase                                          608    0.0   
  3avz_A A 3C-Like Proteinase                                          608    0.0   
  3atw_A A 3C-Like Proteinase                                          608    0.0   
  3atw_B B 3C-Like Proteinase                                          608    0.0   
  5c5o_B B 3C-like proteinase                                          608    0.0   
  6xhl_B B 3C-like proteinase                                          608    0.0   
  2bx4_A A 3C-LIKE PROTEINASE                                          608    0.0   
  2gt8_A A 3C-like proteinase                                          608    0.0   
  3f9f_B B 3C-like proteinase                                          607    0.0   
  3f9f_A A 3C-like proteinase                                          607    0.0   
  3f9h_A A 3C-like proteinase                                          607    0.0   
  7c2y_A A 3C-like proteinase                                          604    0.0   
  3f9e_A A 3C-like proteinase                                          604    0.0   
  7c2q_A A 3C-like proteinase                                          601    0.0   
  3f9g_A A 3C-like proteinase                                          601    0.0   
  1q2w_A A 3C-like protease                                            601    0.0   
  3fzd_A A 3C-like proteinase                                          600    0.0   
  1q2w_B B 3C-like protease                                            600    0.0   
  3f9g_B B 3C-like proteinase                                          598    0.0   
  6xho_B B 3C-like proteinase                                          597    0.0   
  7c2q_B B 3C-like proteinase                                          591    0.0   
  7c2y_B B 3C-like proteinase                                          588    0.0   
  2pwx_A A 3C-like proteinase                                          583    0.0   
  4rsp_A A Orf1a protein                                               321    3e-107
  4ylu_A A ORF1a protein                                               320    8e-107
  4ylu_D D ORF1a protein                                               320    8e-107
  6vh3_B B Orf1a protein                                               319    1e-106
  5wkj_A A Orf1a protein                                               319    1e-106
  6vh2_B B Orf1a protein                                               319    1e-106
  4wme_A A MERS-CoV 3CL protease                                       319    2e-106
  4wme_D D MERS-CoV 3CL protease                                       319    2e-106
  5wkl_A A Orf1a protein                                               319    2e-106
  5wkk_A A Orf1a protein                                               319    2e-106
  6vh3_A A Orf1a protein                                               318    3e-106
  4ylu_B B ORF1a protein                                               318    4e-106
  4ylu_C C ORF1a protein                                               318    4e-106
  5wkm_A A Orf1a protein                                               318    7e-106
  5c3n_A A ORF1a protein                                               317    8e-106
  5c3n_B B ORF1a protein                                               317    1e-105
  4wme_B B MERS-CoV 3CL protease                                       317    1e-105
  4wmd_B B ORF1a                                                       317    1e-105
  4wmd_C C ORF1a                                                       317    1e-105
  4wmf_B B MERS-CoV 3CL protease                                       317    1e-105
  6vh2_A A Orf1a protein                                               317    2e-105
  6vh1_B B Orf1a protein                                               317    2e-105
  6vgy_B B Orf1a protein                                               317    2e-105
  6vh0_B B Orf1a protein                                               317    2e-105
  6vh1_A A Orf1a protein                                               317    2e-105
  6vgz_B B Orf1a protein                                               316    2e-105
  6vgy_A A Orf1a protein                                               316    3e-105
  6vh0_A A Orf1a protein                                               316    3e-105
  6vgz_A A Orf1a protein                                               316    3e-105
  4wme_C C MERS-CoV 3CL protease                                       315    6e-105
  4wmd_A A ORF1a                                                       314    1e-104
  4wmf_A A MERS-CoV 3CL protease                                       314    1e-104
  4yog_B B 3C-like proteinase                                          310    6e-103
  4yoj_A A 3C-like proteinase                                          310    6e-103
  4yoj_B B 3C-like proteinase                                          310    6e-103
  4yo9_A A 3C-like proteinase                                          310    6e-103
  4yoi_A A 3C-like proteinase                                          310    6e-103
  4yoi_B B 3C-like proteinase                                          310    6e-103
  4yog_A A 3C-like proteinase                                          310    6e-103
  2ynb_A A 3C-LIKE PROTEINASE                                          310    6e-103
  2yna_A A 3C-LIKE PROTEINASE                                          310    6e-103
  2yna_B B 3C-LIKE PROTEINASE                                          306    1e-101
  2ynb_B B 3C-LIKE PROTEINASE                                          306    1e-101
  4yo9_B B 3C-like proteinase                                          305    4e-101
  4wmf_C C MERS-CoV 3CL protease                                       303    2e-100
  3d23_A B 3C-like proteinase                                          301    2e-99 
  6jij_B C Replicative polyprotein 1ab                                 300    3e-99 
  3d23_D D 3C-like proteinase                                          300    6e-99 
  6jij_C A Replicative polyprotein 1ab                                 298    2e-98 
  6jij_A B Replicative polyprotein 1ab                                 298    2e-98 
  3d23_B A 3C-like proteinase                                          298    2e-98 
  3d23_C C 3C-like proteinase                                          298    2e-98 
  5hyo_B B PEDV 3CLpro                                                 265    1e-85 
  5hyo_A A PEDV 3CLpro                                                 265    1e-85 
  6l70_B B PEDV main protease                                          265    3e-85 
  6l70_A A PEDV main protease                                          265    3e-85 
  5gwz_A B PEDV main protease                                          264    4e-85 
  5gwz_B A PEDV main protease                                          264    4e-85 
  4xfq_A A PEDV main protease                                          263    1e-84 
  4xfq_B B PEDV main protease                                          261    5e-84 
  4zuh_A A PEDV 3C-Like protease                                       260    2e-83 
  4zuh_B B PEDV 3C-Like protease                                       258    7e-83 
  5zqg_B B Non-structural protein                                      258    8e-83 
  5zqg_A A Non-structural protein                                      257    3e-82 
  4zro_D D 3C-like proteinase                                          255    1e-81 
  4zro_B B 3C-like proteinase                                          255    1e-81 
  4zro_C C 3C-like proteinase                                          255    1e-81 
  4zro_A A 3C-like proteinase                                          255    1e-81 
  5eu8_A A main protease                                               255    1e-81 
  1p9u_E E putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1lvo_E E Replicase, hydrolase domain                                 254    2e-81 
  1lvo_F F Replicase, hydrolase domain                                 254    2e-81 
  1lvo_A A Replicase, hydrolase domain                                 254    2e-81 
  1p9u_A A putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1p9u_B B putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1lvo_B B Replicase, hydrolase domain                                 254    2e-81 
  1lvo_C C Replicase, hydrolase domain                                 254    2e-81 
  1p9u_C C putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1p9u_F F putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1p9u_D D putative coronavirus nsp2 (3CL-PRO)                         254    2e-81 
  1lvo_D D Replicase, hydrolase domain                                 254    2e-81 
  2amp_A A 3C-like proteinase                                          254    2e-81 
  2amp_B B 3C-like proteinase                                          254    2e-81 
  4f49_C C 3C-like proteinase                                          254    2e-81 
  4f49_A A 3C-like proteinase                                          254    2e-81 
  4f49_B B 3C-like proteinase                                          253    1e-80 
  4f49_D D 3C-like proteinase                                          252    2e-80 
  5nh0_B B Replicase polyprotein 1ab                                   250    7e-80 
  3tlo_B B 3C-like proteinase                                          250    8e-80 
  3tlo_A A 3C-like proteinase                                          250    8e-80 
  6fv1_A A Replicase polyprotein 1ab                                   250    9e-80 
  5gwy_B B main protease                                               251    9e-80 
  6fv2_A A Replicase polyprotein 1ab                                   250    9e-80 
  5nh0_A A Replicase polyprotein 1ab                                   250    1e-79 
  2k7x_A A SARS-CoV main protease                                      243    2e-79 
  2liz_A A 3C-like proteinase                                          243    2e-79 
  5nh0_C C Replicase polyprotein 1ab                                   249    3e-79 
  6fv2_B B Replicase polyprotein 1ab                                   249    4e-79 
  6fv2_C C Replicase polyprotein 1ab                                   249    4e-79 
  6fv1_C C Replicase polyprotein 1ab                                   249    4e-79 
  6fv1_B B Replicase polyprotein 1ab                                   249    4e-79 
  5gwy_A A main protease                                               247    3e-78 
  2zu2_A A 3C-like proteinase                                          241    5e-76 
  2zu2_B B 3C-like proteinase                                          241    5e-76 
  1p9s_A A Replicase polyprotein 1ab                                   241    1e-75 
  1p9s_B B Replicase polyprotein 1ab                                   240    2e-75 
  2q6d_B B Infectious bronchitis virus (IBV) main protease             226    3e-70 
  2q6f_A A Infectious bronchitis virus (IBV) main protease             222    9e-69 
  2q6f_B B Infectious bronchitis virus (IBV) main protease             222    1e-68 
  2q6d_A A Infectious bronchitis virus (IBV) main protease             222    1e-68 
  2q6d_C C Infectious bronchitis virus (IBV) main protease             218    3e-67 
  3ebn_D D Replicase polyprotein 1ab                                   204    3e-64 
  3ebn_C C Replicase polyprotein 1ab                                   204    3e-64 
  3ebn_A A Replicase polyprotein 1ab                                   202    2e-63 
  3ebn_B B Replicase polyprotein 1ab                                   202    2e-63 
  3j1z_A P Cation efflux family protein                               33.5    1.7   
  3j1z_B Q Cation efflux family protein                               33.5    1.7   
  5vrf_B A Cadmium and zinc efflux pump FieF                          33.1    1.8   
  5vrf_A B Cadmium and zinc efflux pump FieF                          33.1    1.8   


> 6xbi_A A main protease
Length=308 Score = 641 bits (1653), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 123 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 302 Query 301 SGVTFQ 306 SGVTFQ Sbjct 303 SGVTFQ 308
> 6lu7_A A main protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqt_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqt_B B 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7c8t_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6z2e_A AAA Main Protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wqf_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7buy_A A SARS-CoV-2 virus Main protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xhu_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6ynq_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_B B SARS-CoV-2 3CL protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_D D SARS-CoV-2 3CL protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m2n_A A SARS-CoV-2 3CL protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb2_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xch_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7c8r_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6m03_A A main protease
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7cwb_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xhu_B C 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wnp_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtk_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7k3t_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7k40_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yvf_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqu_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jvz_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xqs_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yt8_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6yb7_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jyc_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y2e_A A Replicase polyprotein 1ab
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 7jun_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtj_A A 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wtm_B B 3C-like proteinase
Length=306 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6w63_A A 3C-like proteinase
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6m2n_C C SARS-CoV-2 3CL protease
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6m2q_A A SARS-CoV-2 3CL protease
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 7k6e_A A 3C-like proteinase
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 7k6d_A A 3C-like proteinase
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 7jfq_A A 3C-like proteinase
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6xr3_A A 3C-like proteinase
Length=306 Score = 638 bits (1646), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/305 (100%), Positives = 305/305 (100%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6xoa_B B 3C-like proteinase
Length=306 Score = 638 bits (1645), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_D D 3C-like proteinase
Length=306 Score = 638 bits (1645), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_C C 3C-like proteinase
Length=306 Score = 638 bits (1645), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xoa_A A 3C-like proteinase
Length=306 Score = 638 bits (1645), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSSGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkf_A A 3C-like proteinase
Length=310 Score = 637 bits (1644), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb0_A A 3C-like proteinase
Length=310 Score = 637 bits (1644), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkh_A A 3C-like proteinase
Length=310 Score = 637 bits (1644), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xb1_A A 3C-like proteinase
Length=310 Score = 637 bits (1644), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xkf_B B 3C-like proteinase
Length=310 Score = 637 bits (1644), Expect = 0.0, Method: Compositional matrix adjust. Identities = 305/306 (99%), Positives = 305/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSXGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xa4_A A main protease
Length=308 Score = 636 bits (1641), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 302 GVTF 305 GVTF Sbjct 304 GVTF 307
> 6xbh_A A main protease
Length=308 Score = 636 bits (1641), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 302 GVTF 305 GVTF Sbjct 304 GVTF 307
> 6xfn_A A main protease
Length=308 Score = 636 bits (1641), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303 Query 302 GVTF 305 GVTF Sbjct 304 GVTF 307
> 6m0k_A A Replicase polyprotein 1ab
Length=304 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r81_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfg_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf1_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfv_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rea_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5reh_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re9_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfo_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfy_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r82_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rft_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfd_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r7y_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r7z_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfx_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfs_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfq_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfn_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfp_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfj_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfi_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf9_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf8_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf7_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf6_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf3_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf4_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rez_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rew_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rev_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rex_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5reu_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5reo_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rep_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rem_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rel_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rej_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5reg_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5ree_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5reb_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re6_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re4_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r84_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rg2_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgq_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgn_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgk_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 6yz6_A A Main Protease
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rek_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rei_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgj_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf5_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rhc_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rhe_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfk_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rhf_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r8t_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh4_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgp_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5red_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgo_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfu_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5res_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfz_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfr_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rhd_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rhb_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfm_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rha_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgm_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rg0_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re8_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh0_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgz_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgy_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgv_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh2_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh3_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgx_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgw_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgt_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh9_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh8_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh7_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh5_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh6_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgi_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgu_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgh_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5ren_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re7_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 6zru_A A Main Protease
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 6zrt_A A Main Protease
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfl_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfh_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf0_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfc_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rg3_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfe_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5ref_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgl_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rf2_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r80_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rh1_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5ret_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5r83_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgg_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgs_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rey_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfb_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rec_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rfw_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rg1_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rgr_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5re5_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 7ju7_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rff_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 5rer_A A 3C-like proteinase
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 6y84_A A Replicase polyprotein 1ab
Length=306 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 304/304 (100%), Positives = 304/304 (100%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 6lze_A A Replicase polyprotein 1ab
Length=303 Score = 634 bits (1636), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGV 303 SGV Sbjct 301 SGV 303
> 6y2g_B B Replicase polyprotein 1ab
Length=306 Score = 634 bits (1636), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGV 303 SGV Sbjct 301 SGV 303
> 6xbg_B B main protease
Length=308 Score = 634 bits (1635), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/303 (100%), Positives = 303/303 (100%), Gaps = 0/303 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 64 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 125 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 184 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 304 Query 303 VTF 305 VTF Sbjct 305 VTF 307
> 6y2f_A A Replicase polyprotein 1ab
Length=306 Score = 633 bits (1632), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/305 (99%), Positives = 303/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTS MLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSXXMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6xhm_A A 3C-like proteinase
Length=306 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 6xbi_B B main protease
Length=308 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 123 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 302 Query 301 SG 302 SG Sbjct 303 SG 304
> 6xmk_B B 3C-like proteinase
Length=309 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 5 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 64 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 65 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 125 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 184 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 185 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 244 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 245 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 304 Query 301 SG 302 SG Sbjct 305 SG 306
> 6wtt_A A 3C-like proteinase
Length=310 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 6wtt_C C 3C-like proteinase
Length=310 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 6wtt_B B 3C-like proteinase
Length=310 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 7brr_A A 3C-like proteinase
Length=307 Score = 632 bits (1629), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/302 (100%), Positives = 302/302 (100%), Gaps = 0/302 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302 Query 302 GV 303 GV Sbjct 303 GV 304
> 7c7p_A A main protease
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7bqy_A A main protease
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 6xhm_B B 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 6y2g_A A Replicase polyprotein 1ab
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7com_A A main protease
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7d1o_A A 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 5rfa_A A 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7c6u_A A 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7c6s_A A 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7c8b_A A 3C-like proteinase
Length=306 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 7brp_B A 3C-like proteinase
Length=307 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 7jkv_A A 3C-like proteinase
Length=307 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 7brp_A B 3C-like proteinase
Length=307 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 7jkv_B B 3C-like proteinase
Length=307 Score = 630 bits (1625), Expect = 0.0, Method: Compositional matrix adjust. Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 122 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 7c8u_A A Replicase polyprotein 1ab
Length=306 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302
> 7jr3_A A 3C-like proteinase
Length=306 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300
> 7bro_A A 3C-like proteinase
Length=307 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 123 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 6xbg_A A main protease
Length=308 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF Sbjct 124 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 303
> 7cwc_A A 3C-like proteinase
Length=310 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 5 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 64 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 65 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 125 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 184 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 185 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 244 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 245 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 304
> 7brr_B B 3C-like proteinase
Length=307 Score = 627 bits (1616), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 63 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 124 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 183 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 302
> 7cwc_B B 3C-like proteinase
Length=310 Score = 627 bits (1616), Expect = 0.0, Method: Compositional matrix adjust. Identities = 299/299 (100%), Positives = 299/299 (100%), Gaps = 0/299 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 7 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 66 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 67 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 126 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 127 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 186 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 187 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 246 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 247 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 305
> 7c7p_B B main protease
Length=306 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 300/306 (98%), Positives = 300/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT PNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTXXXXXXPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6xmk_A A 3C-like proteinase
Length=309 Score = 624 bits (1610), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 8 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 67 Query 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 68 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 127 Query 124 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 128 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 187 Query 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 188 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 247 Query 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 248 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 305
> 7cbt_B B Replicase polyprotein 1ab
Length=333 Score = 624 bits (1610), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 31 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 90 Query 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 91 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 150 Query 124 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 151 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 210 Query 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 211 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 270 Query 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 271 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 328
> 7cbt_A A Replicase polyprotein 1ab
Length=333 Score = 624 bits (1610), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 31 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 90 Query 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 91 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 150 Query 124 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 151 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 210 Query 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 211 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 270 Query 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS Sbjct 271 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 328
> 3ea8_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2zu4_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2h2z_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2zu5_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sne_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tns_A A SARS coronavirus main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snd_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n19_A A SARS coronavirus main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snb_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gx4_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3snc_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz9_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6w79_A A Main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6y7m_A AAA Replicase polyprotein 1a
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb5_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lny_A A Replicase polyprotein 1a
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3c_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz7_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2gz8_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3d_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3szn_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lo0_A A Replicase polyprotein 1a
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9k_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 5n5o_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tit_A A SARS coronavirus main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_B B Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z94_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb6_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5a_A A 3C-like peptidase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2hob_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6lnq_A A Severe Acute Respiratory Syndrome Coronavirus 3c Like
Protease Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb4_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tiu_A A SARS coronavirus main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z3e_A A Replicase polyprotein 1ab (pp1ab)
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2v6n_A A REPLICASE POLYPROTEIN 1AB
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb3_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 6wco_A A Main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3v3m_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2duc_A A Replicase polyprotein 1ab
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3sn8_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3tnt_A A SARS coronavirus main protease
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2a5i_A A 3C-like peptidase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3vb7_B B 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9g_A A 3C-like proteinase
Length=306 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3m3v_A A 3C-like proteinase
Length=308 Score = 623 bits (1606), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 301 SGVTFQ 306 SGVTFQ Sbjct 303 SGVTFQ 308
> 7jr4_A A 3C-like proteinase
Length=310 Score = 622 bits (1605), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/302 (99%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT MLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTXXXMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 XSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 7com_B B main protease
Length=306 Score = 621 bits (1602), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/305 (98%), Positives = 298/305 (98%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC PNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXXPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 2z9k_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 3e91_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 3ea7_A A 3C-like proteinase
Length=306 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 1wof_A A 3C-like proteinase
Length=311 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SGVTF 305 SGVTF Sbjct 306 SGVTF 310
> 2amd_A A 3C-like proteinase
Length=311 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/305 (96%), Positives = 301/305 (99%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SGVTF 305 SGVTF Sbjct 306 SGVTF 310
> 5b6o_A A 3C-like proteinase
Length=316 Score = 621 bits (1601), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3m3s_A A 3C-like proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2qcy_A A 3C-like proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_B B 3C-like proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 1z1j_A A 3C-like proteinase
Length=306 Score = 620 bits (1600), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 4wy3_A A 3C-like proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 4twy_A A 3C-like proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 5c5n_A A 3C-like proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 3aw0_A A 3C-Like Proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_B B 3C-like proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 4tww_A A 3C-like proteinase
Length=306 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTFQ 306 SGVTFQ Sbjct 301 SGVTFQ 306
> 2z9j_B B 3C-like proteinase
Length=306 Score = 619 bits (1596), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVT 304 SGVT Sbjct 301 SGVT 304
> 2a5k_A A 3C-like peptidase
Length=307 Score = 619 bits (1596), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/304 (96%), Positives = 300/304 (99%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 301 SGVT 304 SGVT Sbjct 302 SGVT 305
> 2qc2_B B 3C-like proteinase
Length=308 Score = 619 bits (1595), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 301 SGVTF 305 SGVTF Sbjct 303 SGVTF 307
> 3m3t_A A 3C-like proteinase
Length=308 Score = 618 bits (1594), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 302 Query 301 SGVTF 305 SGVTF Sbjct 303 SGVTF 307
> 2q6g_A A severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 618 bits (1593), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/305 (96%), Positives = 300/305 (98%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 2amq_A A 3C-like proteinase
Length=311 Score = 617 bits (1591), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 303 VTF 305 VTF Sbjct 308 VTF 310
> 3m3v_B B 3C-like proteinase
Length=308 Score = 617 bits (1591), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/303 (96%), Positives = 299/303 (99%), Gaps = 0/303 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 302 Query 301 SGV 303 SGV Sbjct 303 SGV 305
> 2qc2_A A 3C-like proteinase
Length=308 Score = 617 bits (1590), Expect = 0.0, Method: Compositional matrix adjust. Identities = 291/304 (96%), Positives = 299/304 (98%), Gaps = 0/304 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 301 SGVT 304 SGVT Sbjct 303 SGVT 306
> 7cx9_A A 3C protein
Length=306 Score = 616 bits (1589), Expect = 0.0, Method: Compositional matrix adjust. Identities = 295/301 (98%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 4mds_A A 3C-like proteinase
Length=303 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/303 (96%), Positives = 298/303 (98%), Gaps = 0/303 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGV 303 SG Sbjct 301 SGA 303
> 2z9j_A A 3C-like proteinase
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 2c3s_A A SARS COV 3C-LIKE PROTEINASE
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1uk2_A A 3C-LIKE PROTEINASE
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1uj1_B B 3C-like proteinase
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1uk3_B B 3C-like proteinase
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 2gt7_B B 3C-like proteinase
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1uk4_B B 3C-like proteinase
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1uk2_B B 3C-LIKE PROTEINASE
Length=306 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 1wof_B B 3C-like proteinase
Length=311 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SG 302 SG Sbjct 306 SG 307
> 2amd_B B 3C-like proteinase
Length=311 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SG 302 SG Sbjct 306 SG 307
> 6w2a_B B Replicase polyprotein 1a
Length=310 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 8 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 67 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 68 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 127 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 128 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 187 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 188 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 247 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 248 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 307 Query 301 SG 302 SG Sbjct 308 SG 309
> 2alv_A A Replicase polyprotein 1ab
Length=306 Score = 615 bits (1586), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301 Query 302 GV 303 GV Sbjct 302 GV 303
> 2amq_B B 3C-like proteinase
Length=311 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SG 302 SG Sbjct 306 SG 307
> 2d2d_B B 3C-like proteinase
Length=311 Score = 615 bits (1587), Expect = 0.0, Method: Compositional matrix adjust. Identities = 290/302 (96%), Positives = 298/302 (99%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 6 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 65 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 66 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 125 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 126 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 185 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 186 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 245 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 246 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 305 Query 301 SG 302 SG Sbjct 306 SG 307
> 2op9_A A Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 613 bits (1582), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 3sna_A A 3C-like proteinase
Length=301 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3m3s_B B 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVI GDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 6xhn_A A 3C-like proteinase
Length=307 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302 Query 302 G 302 G Sbjct 303 G 303
> 6xhl_A A 3C-like proteinase
Length=307 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302 Query 302 G 302 G Sbjct 303 G 303
> 1uk3_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 303 V 303 V Sbjct 303 V 303
> 1uk4_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 303 V 303 V Sbjct 303 V 303
> 1uj1_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 302 Query 303 V 303 V Sbjct 303 V 303
> 3iwm_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3vb7_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3vb4_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3iwm_B B 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3vb6_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 2z9l_B B 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3vb3_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 1z1i_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3vb5_A A 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3ea7_B B 3C-like proteinase
Length=306 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 2d2d_A A 3C-like proteinase
Length=311 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 8 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 67 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 68 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 127 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 128 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 187 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 188 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 247 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSG Sbjct 248 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG 307 Query 303 V 303 V Sbjct 308 V 308
> 6w2a_A A Replicase polyprotein 1a
Length=310 Score = 613 bits (1581), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 8 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 67 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 68 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 127 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 128 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 187 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 188 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 247 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 248 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 307 Query 301 S 301 S Sbjct 308 S 308
> 3eaj_B B 3C-like proteinase
Length=306 Score = 612 bits (1579), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 3eaj_A A 3C-like proteinase
Length=306 Score = 612 bits (1579), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 2qiq_A A Replicase polyprotein 1ab
Length=301 Score = 612 bits (1578), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 297/301 (99%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 AGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 2q6g_B B severe acute respiratory syndrome coronavirus (SARS-CoV)
Length=306 Score = 612 bits (1578), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/302 (96%), Positives = 297/302 (98%), Gaps = 0/302 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPR VICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SG 302 SG Sbjct 301 SG 302
> 3iwm_C C 3C-like proteinase
Length=306 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2bx3_A A MAIN PROTEINASE
Length=306 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 61 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 62 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 121 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 122 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 181 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 182 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 242 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 3iwm_D D 3C-like proteinase
Length=306 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 6xho_A A 3C-like proteinase
Length=307 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 302
> 2a5k_B B 3C-like peptidase
Length=307 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2vj1_A A SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 2vj1_B B SARS CORONAVIRUS MAIN PROTEINASE
Length=309 Score = 612 bits (1577), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 1 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 60 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 61 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 120 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 121 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 180 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 181 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 240 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 300
> 3e91_B B 3C-like proteinase
Length=306 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/300 (96%), Positives = 296/300 (99%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQC 300
> 3ea9_A A 3C-like proteinase
Length=306 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILG+A LEDE TPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 4hi3_B B 3C-like proteinase
Length=315 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301 Query 301 S 301 S Sbjct 302 S 302
> 5b6o_B B 3C-like proteinase
Length=316 Score = 610 bits (1574), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGS GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 3d62_A A 3C-like proteinase
Length=299 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 60 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 121 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 180 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 299
> 3aw1_A A 3C-Like Proteinase
Length=306 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 296/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 S 301 S Sbjct 301 S 301
> 2z9l_A A 3C-like proteinase
Length=306 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 2gt7_A A 3C-like proteinase
Length=306 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/305 (95%), Positives = 296/305 (97%), Gaps = 0/305 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC LNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300 Query 301 SGVTF 305 SGVTF Sbjct 301 SGVTF 305
> 6xhn_B B 3C-like proteinase
Length=307 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/302 (95%), Positives = 296/302 (98%), Gaps = 0/302 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG 302 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM RTILGS +LEDEFTPFDVVRQCSG Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXRTILGSTILEDEFTPFDVVRQCSG 303 Query 303 VT 304 VT Sbjct 304 VT 305
> 2gtb_A A 3C-like proteinase
Length=307 Score = 610 bits (1572), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/299 (96%), Positives = 295/299 (99%), Gaps = 0/299 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 2op9_B B Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
(3CL-PRO, 3CLp) Length=302 Score = 609 bits (1571), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/301 (96%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301 Query 301 S 301 S Sbjct 302 S 302
> 3f9h_B B 3C-like proteinase
Length=308 Score = 609 bits (1570), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 4hi3_A A 3C-like proteinase
Length=315 Score = 609 bits (1570), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 2 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 62 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 122 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 182 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV QC Sbjct 242 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC 301
> 5c5o_A A 3C-like proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3aw1_B B 3C-Like Proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3avz_A A 3C-Like Proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_A A 3C-Like Proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 3atw_B B 3C-Like Proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 5c5o_B B 3C-like proteinase
Length=306 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/300 (96%), Positives = 295/300 (98%), Gaps = 0/300 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 61 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 121 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVD QTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 181 FYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 241 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 6xhl_B B 3C-like proteinase
Length=307 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 287/301 (95%), Positives = 295/301 (98%), Gaps = 0/301 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 3 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 62 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 63 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 122 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 123 PSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 182 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 183 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 242 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM RTILGS +LEDEFTPFDVVRQCS Sbjct 243 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXRTILGSTILEDEFTPFDVVRQCS 302 Query 302 G 302 G Sbjct 303 G 303
> 2bx4_A A 3C-LIKE PROTEINASE
Length=306 Score = 608 bits (1567), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 300
> 2gt8_A A 3C-like proteinase
Length=307 Score = 608 bits (1567), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/298 (96%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 301
> 3f9f_B B 3C-like proteinase
Length=308 Score = 607 bits (1564), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9f_A A 3C-like proteinase
Length=308 Score = 607 bits (1564), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 3f9h_A A 3C-like proteinase
Length=308 Score = 607 bits (1564), Expect = 0.0, Method: Compositional matrix adjust. Identities = 286/299 (96%), Positives = 294/299 (98%), Gaps = 0/299 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGS LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 7c2y_A A 3C-like proteinase
Length=298 Score = 604 bits (1557), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/294 (98%), Positives = 289/294 (98%), Gaps = 0/294 (0%) Query 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN Sbjct 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 Query 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 Query 124 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 GVYQCAMRPNFTIKGSF GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG Sbjct 124 GVYQCAMRPNFTIKGSFXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 Query 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT Sbjct 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 Query 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT SALLEDEFTPFDVV Sbjct 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTXXXSALLEDEFTPFDVV 297
> 3f9e_A A 3C-like proteinase
Length=308 Score = 604 bits (1558), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/297 (96%), Positives = 293/297 (99%), Gaps = 0/297 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKG+FLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGAFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQ Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ 301
> 7c2q_A A 3C-like proteinase
Length=296 Score = 601 bits (1550), Expect = 0.0, Method: Compositional matrix adjust. Identities = 288/296 (97%), Positives = 288/296 (97%), Gaps = 0/296 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 60 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKGS GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 121 SGVYQCAMRPNFTIKGSXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 180 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAV GDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVXXGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 298 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT SALLEDEFTPFDVVR Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTXXXSALLEDEFTPFDVVR 296
> 3f9g_A A 3C-like proteinase
Length=303 Score = 601 bits (1550), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/300 (95%), Positives = 292/300 (97%), Gaps = 0/300 (0%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRK Sbjct 4 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRK 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 SNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGS Sbjct 64 SNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGS 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 PSGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG F Sbjct 124 PSGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP Sbjct 184 YGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 LTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 244 LTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 1q2w_A A 3C-like protease
Length=308 Score = 601 bits (1549), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVIC MLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXMLNPNYEDLLIRKS 64 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 303
> 3fzd_A A 3C-like proteinase
Length=301 Score = 600 bits (1547), Expect = 0.0, Method: Compositional matrix adjust. Identities = 283/299 (95%), Positives = 291/299 (97%), Gaps = 0/299 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTL GLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLAGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKG NGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 123 SGVYQCAMRPNHTIKGXXXNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCS Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS 301
> 1q2w_B B 3C-like protease
Length=308 Score = 600 bits (1547), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/301 (94%), Positives = 291/301 (97%), Gaps = 0/301 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT PNYEDLLIR Sbjct 3 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTXXXXXXPNYEDLLIR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 63 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 123 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 183 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 243 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302 Query 301 S 301 S Sbjct 303 S 303
> 3f9g_B B 3C-like proteinase
Length=303 Score = 598 bits (1541), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/298 (95%), Positives = 290/298 (97%), Gaps = 0/298 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 5 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 64 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 65 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 124 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGS SCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 125 SGVYQCAMRPNHTIKGSAXXXSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 184 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 185 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 244 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 245 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 302
> 6xho_B B 3C-like proteinase
Length=307 Score = 597 bits (1539), Expect = 0.0, Method: Compositional matrix adjust. Identities = 282/298 (95%), Positives = 290/298 (97%), Gaps = 0/298 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKS Sbjct 4 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKS 63 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 64 NHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSP 123 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FY Sbjct 124 SGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFY 183 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 184 GPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 243 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 TQDHVDILGPLSAQTGIAVLDMCA+LKELLQNG TILGS +LEDEFTPFDVVRQC Sbjct 244 TQDHVDILGPLSAQTGIAVLDMCAALKELLQNGXXXXTILGSTILEDEFTPFDVVRQC 301
> 7c2q_B B 3C-like proteinase
Length=296 Score = 591 bits (1523), Expect = 0.0, Method: Compositional matrix adjust. Identities = 284/296 (96%), Positives = 284/296 (96%), Gaps = 0/296 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIRKS Sbjct 1 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIRKS 60 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 61 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 120 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKG GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 121 SGVYQCAMRPNFTIKGXXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 180 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 181 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 240 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 298 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN TILGSALLEDEFTPFDVVR Sbjct 241 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNXXTILGSALLEDEFTPFDVVR 296
> 7c2y_B B 3C-like proteinase
Length=298 Score = 588 bits (1517), Expect = 0.0, Method: Compositional matrix adjust. Identities = 283/296 (96%), Positives = 283/296 (96%), Gaps = 0/296 (0%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC NPNYEDLLIRKS Sbjct 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICXXXXXXNPNYEDLLIRKS 62 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP Sbjct 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 SGVYQCAMRPNFTIKG GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY Sbjct 123 SGVYQCAMRPNFTIKGXXXXGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY 182 Query 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL Sbjct 183 GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL 242 Query 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 298 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGM TILGSALLEDEFTPFDVVR Sbjct 243 TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMXXXTILGSALLEDEFTPFDVVR 298
> 2pwx_A A 3C-like proteinase
Length=308 Score = 583 bits (1503), Expect = 0.0, Method: Compositional matrix adjust. Identities = 276/296 (93%), Positives = 284/296 (96%), Gaps = 0/296 (0%) Query 4 RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN 63 RKMAFPS KVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSN Sbjct 6 RKMAFPSAKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSN 65 Query 64 HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS 123 H+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPS Sbjct 66 HSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPS 125 Query 124 GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG 183 GVYQCAMRPN TIKGSFLNGSCGSVGFNIDY CVSFCYMHHMELPTGVHAGTDLEG FYG Sbjct 126 GVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYXCVSFCYMHHMELPTGVHAGTDLEGKFYG 185 Query 184 PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT 243 PFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLN TTLNDFNLVAMKYNYEPLT Sbjct 186 PFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNXXXTTLNDFNLVAMKYNYEPLT 245 Query 244 QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 QDHVDILGPLSAQTGIAVLDMCA+LKELLQNGM TILGS +LEDEFTPFDVVRQ Sbjct 246 QDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXXTILGSTILEDEFTPFDVVRQ 301
> 4rsp_A A Orf1a protein
Length=310 Score = 321 bits (822), Expect = 3e-107, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLXGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_A A ORF1a protein
Length=306 Score = 320 bits (819), Expect = 8e-107, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4ylu_D D ORF1a protein
Length=306 Score = 320 bits (819), Expect = 8e-107, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 6vh3_B B Orf1a protein
Length=313 Score = 319 bits (818), Expect = 1e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 5wkj_A A Orf1a protein
Length=313 Score = 319 bits (818), Expect = 1e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 6vh2_B B Orf1a protein
Length=313 Score = 319 bits (818), Expect = 1e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 4wme_A A MERS-CoV 3CL protease
Length=306 Score = 319 bits (817), Expect = 2e-106, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 4wme_D D MERS-CoV 3CL protease
Length=306 Score = 319 bits (817), Expect = 2e-106, Method: Compositional matrix adjust. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQIMGVVMQ 306
> 5wkl_A A Orf1a protein
Length=313 Score = 319 bits (818), Expect = 2e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 5wkk_A A Orf1a protein
Length=313 Score = 319 bits (817), Expect = 2e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 6vh3_A A Orf1a protein
Length=313 Score = 318 bits (816), Expect = 3e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 206/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHXXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 4ylu_B B ORF1a protein
Length=306 Score = 318 bits (815), Expect = 4e-106, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSG 302 Q G Sbjct 297 NMQIMG 302
> 4ylu_C C ORF1a protein
Length=306 Score = 318 bits (815), Expect = 4e-106, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 205/306 (67%), Gaps = 8/306 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSG 302 Q G Sbjct 297 NMQIMG 302
> 5wkm_A A Orf1a protein
Length=313 Score = 318 bits (814), Expect = 7e-106, Method: Compositional matrix adjust. Identities = 156/307 (51%), Positives = 204/307 (66%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPXXQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQCSGV 303 Q GV Sbjct 304 NMQIMGV 310
> 5c3n_A A ORF1a protein
Length=306 Score = 317 bits (813), Expect = 8e-106, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQ 299 Q Sbjct 297 NMQ 299
> 5c3n_B B ORF1a protein
Length=306 Score = 317 bits (812), Expect = 1e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQ 299 Q Sbjct 297 NMQ 299
> 4wme_B B MERS-CoV 3CL protease
Length=306 Score = 317 bits (812), Expect = 1e-105, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4wmd_B B ORF1a
Length=306 Score = 317 bits (812), Expect = 1e-105, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4wmd_C C ORF1a
Length=306 Score = 317 bits (812), Expect = 1e-105, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4wmf_B B MERS-CoV 3CL protease
Length=306 Score = 317 bits (812), Expect = 1e-105, Method: Compositional matrix adjust. Identities = 155/307 (50%), Positives = 205/307 (67%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 6vh2_A A Orf1a protein
Length=313 Score = 317 bits (811), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vh1_B B Orf1a protein
Length=313 Score = 317 bits (811), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vgy_B B Orf1a protein
Length=313 Score = 317 bits (811), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vh0_B B Orf1a protein
Length=313 Score = 317 bits (811), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vh1_A A Orf1a protein
Length=313 Score = 317 bits (811), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vgz_B B Orf1a protein
Length=313 Score = 316 bits (810), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXNLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vgy_A A Orf1a protein
Length=313 Score = 316 bits (810), Expect = 3e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vh0_A A Orf1a protein
Length=313 Score = 316 bits (810), Expect = 3e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 6vgz_A A Orf1a protein
Length=313 Score = 316 bits (809), Expect = 3e-105, Method: Compositional matrix adjust. Identities = 154/303 (51%), Positives = 204/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 8 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 67 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 68 MTNHSFSVQKHXXXXXXLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 127 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 128 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 187 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 188 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 247 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 248 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 303 Query 297 VRQ 299 Q Sbjct 304 NMQ 306
> 4wme_C C MERS-CoV 3CL protease
Length=306 Score = 315 bits (807), Expect = 6e-105, Method: Compositional matrix adjust. Identities = 154/306 (50%), Positives = 204/306 (67%), Gaps = 8/306 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSG 302 Q G Sbjct 297 NMQIMG 302
> 4wmd_A A ORF1a
Length=306 Score = 314 bits (805), Expect = 1e-104, Method: Compositional matrix adjust. Identities = 153/303 (50%), Positives = 203/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQ 299 Q Sbjct 297 NMQ 299
> 4wmf_A A MERS-CoV 3CL protease
Length=306 Score = 314 bits (805), Expect = 1e-104, Method: Compositional matrix adjust. Identities = 154/307 (50%), Positives = 204/307 (66%), Gaps = 8/307 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PS VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 1 SGLVKMSHPSXDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 61 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ Sbjct 121 YNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 181 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 241 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 296 Query 297 VRQCSGV 303 Q GV Sbjct 297 NMQIMGV 303
> 4yog_B B 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_A A 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoj_B B 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yo9_A A 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_A A 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yoi_B B 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 4yog_A A 3C-like proteinase
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2ynb_A A 3C-LIKE PROTEINASE
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2yna_A A 3C-LIKE PROTEINASE
Length=306 Score = 310 bits (793), Expect = 6e-103, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 297 NMQVMGVVMQ 306
> 2yna_B B 3C-LIKE PROTEINASE
Length=306 Score = 306 bits (784), Expect = 1e-101, Method: Compositional matrix adjust. Identities = 152/306 (50%), Positives = 203/306 (66%), Gaps = 8/306 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSG 302 Q G Sbjct 297 NMQVMG 302
> 2ynb_B B 3C-LIKE PROTEINASE
Length=306 Score = 306 bits (784), Expect = 1e-101, Method: Compositional matrix adjust. Identities = 152/306 (50%), Positives = 203/306 (66%), Gaps = 8/306 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQCSG 302 Q G Sbjct 297 NMQVMG 302
> 4yo9_B B 3C-like proteinase
Length=306 Score = 305 bits (782), Expect = 4e-101, Method: Compositional matrix adjust. Identities = 151/303 (50%), Positives = 202/303 (67%), Gaps = 8/303 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 1 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 60 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 61 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 120 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 121 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 180 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 181 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 240 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 241 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 296 Query 297 VRQ 299 Q Sbjct 297 NMQ 299
> 4wmf_C C MERS-CoV 3CL protease
Length=306 Score = 303 bits (777), Expect = 2e-100, Method: Compositional matrix adjust. Identities = 149/300 (50%), Positives = 197/300 (66%), Gaps = 8/300 (3%) Query 11 GKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ- 69 G VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ +PNY+ LLI +NH+F VQ Sbjct 11 GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADXXXDPNYDALLISMTNHSFSVQK 70 Query 70 --AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQ 127 LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLACYNG P+G + Sbjct 71 HIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFT 130 Query 128 CAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD 187 MRPN+TIKGSFL GS GSVG+ + ++FCYMH MEL G H G+ +G YG F+D Sbjct 131 VVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAXGTHTGSAFDGTMYGAFMD 190 Query 188 RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDH 246 +Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ + E + Sbjct 191 KQVXXXQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQS 250 Query 247 VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ 306 VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Q GV Q Sbjct 251 VDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ 306
> 3d23_A B 3C-like proteinase
Length=302 Score = 301 bits (770), Expect = 2e-99, Method: Compositional matrix adjust. Identities = 149/303 (49%), Positives = 192/303 (63%), Gaps = 3/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 301 SGV 303 +GV Sbjct 300 AGV 302
> 6jij_B C Replicative polyprotein 1ab
Length=301 Score = 300 bits (769), Expect = 3e-99, Method: Compositional matrix adjust. Identities = 152/303 (50%), Positives = 196/303 (65%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 301 SGV 303 +GV Sbjct 296 AGV 298
> 3d23_D D 3C-like proteinase
Length=302 Score = 300 bits (767), Expect = 6e-99, Method: Compositional matrix adjust. Identities = 148/302 (49%), Positives = 191/302 (63%), Gaps = 3/302 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 301 SG 302 +G Sbjct 300 AG 301
> 6jij_C A Replicative polyprotein 1ab
Length=301 Score = 298 bits (764), Expect = 2e-98, Method: Compositional matrix adjust. Identities = 151/302 (50%), Positives = 195/302 (65%), Gaps = 5/302 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 301 SG 302 +G Sbjct 296 AG 297
> 6jij_A B Replicative polyprotein 1ab
Length=301 Score = 298 bits (764), Expect = 2e-98, Method: Compositional matrix adjust. Identities = 151/302 (50%), Positives = 195/302 (65%), Gaps = 5/302 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+ DM +P+Y +LL R Sbjct 1 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICS--DMTDPDYPNLLCR 58 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 59 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 118 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 119 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 178 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 179 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 238 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS + EDE TP DV +Q Sbjct 239 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVFEDELTPSDVYQQL 295 Query 301 SG 302 +G Sbjct 296 AG 297
> 3d23_B A 3C-like proteinase
Length=302 Score = 298 bits (763), Expect = 2e-98, Method: Compositional matrix adjust. Identities = 148/303 (49%), Positives = 190/303 (63%), Gaps = 3/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+ M P+Y LL R Sbjct 3 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSXXXMNEPDYSALLCR 62 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 63 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 122 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 123 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 182 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 183 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 242 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 243 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 299 Query 301 SGV 303 +GV Sbjct 300 AGV 302
> 3d23_C C 3C-like proteinase
Length=302 Score = 298 bits (763), Expect = 2e-98, Method: Compositional matrix adjust. Identities = 147/301 (49%), Positives = 190/301 (63%), Gaps = 3/301 (1%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRK 61 G KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 4 GIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRV 63 Query 62 SNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS 121 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 64 TLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNGR 123 Query 122 PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF 181 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GNF Sbjct 124 PQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNF 183 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 184 YGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQ 243 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q + Sbjct 244 VKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLA 300 Query 302 G 302 G Sbjct 301 G 301
> 5hyo_B B PEDV 3CLpro
Length=301 Score = 265 bits (678), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 197/306 (64%), Gaps = 6/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 GS +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSGVTF 305 GV Sbjct 296 MYGVNL 301
> 5hyo_A A PEDV 3CLpro
Length=301 Score = 265 bits (678), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 197/306 (64%), Gaps = 6/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 GS +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSGVTF 305 GV Sbjct 296 MYGVNL 301
> 6l70_B B PEDV main protease
Length=305 Score = 265 bits (676), Expect = 3e-85, Method: Compositional matrix adjust. Identities = 136/304 (45%), Positives = 197/304 (65%), Gaps = 6/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSGV 303 GV Sbjct 296 MYGV 299
> 6l70_A A PEDV main protease
Length=305 Score = 265 bits (676), Expect = 3e-85, Method: Compositional matrix adjust. Identities = 136/304 (45%), Positives = 197/304 (65%), Gaps = 6/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSGV 303 GV Sbjct 296 MYGV 299
> 5gwz_A B PEDV main protease
Length=307 Score = 264 bits (675), Expect = 4e-85, Method: Compositional matrix adjust. Identities = 137/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIR 60 G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++R Sbjct 7 GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLR 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 67 L--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 125 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 184 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 185 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 244 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 245 --TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 301 Query 301 SGV 303 GV Sbjct 302 YGV 304
> 5gwz_B A PEDV main protease
Length=307 Score = 264 bits (675), Expect = 4e-85, Method: Compositional matrix adjust. Identities = 137/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 2 GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIR 60 G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++R Sbjct 7 GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLR 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 67 L--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 125 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 184 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 185 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 244 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 245 --TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 301 Query 301 SGV 303 GV Sbjct 302 YGV 304
> 4xfq_A A PEDV main protease
Length=305 Score = 263 bits (671), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSG 302 G Sbjct 296 MYG 298
> 4xfq_B B PEDV main protease
Length=305 Score = 261 bits (668), Expect = 5e-84, Method: Compositional matrix adjust. Identities = 135/302 (45%), Positives = 192/302 (64%), Gaps = 4/302 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVI-ASXXXXTIDYDYALSV 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 60 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 296 Query 301 SG 302 G Sbjct 297 YG 298
> 4zuh_A A PEDV 3C-Like protease
Length=305 Score = 260 bits (664), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 195/303 (64%), Gaps = 6/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI +S ++ +Y ++ Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVL 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 61 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 119 GAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 179 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 239 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 295 Query 300 CSG 302 G Sbjct 296 MYG 298
> 4zuh_B B PEDV 3C-Like protease
Length=305 Score = 258 bits (660), Expect = 7e-83, Method: Compositional matrix adjust. Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 4/302 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 1 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIA-SXXXXTIDYDYALSV 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 60 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 AAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 296 Query 301 SG 302 G Sbjct 297 YG 298
> 5zqg_B B Non-structural protein
Length=308 Score = 258 bits (660), Expect = 8e-83, Method: Compositional matrix adjust. Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 4/302 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI S +Y+ L Sbjct 2 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIA-SXXXXTIDYDYALSV 60 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 61 LRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 120 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 121 AAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 180 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 181 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 240 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 241 TVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQM 297 Query 301 SG 302 G Sbjct 298 YG 299
> 5zqg_A A Non-structural protein
Length=308 Score = 257 bits (656), Expect = 3e-82, Method: Compositional matrix adjust. Identities = 133/303 (44%), Positives = 193/303 (64%), Gaps = 6/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDM-LNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D V CPRHVI ++ +Y ++ Sbjct 2 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIAXXXXXXIDYDYALSVL 61 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+G +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 62 RL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 119 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+ GS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 120 GAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 180 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +V+RQ Sbjct 240 TTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 4zro_D D 3C-like proteinase
Length=299 Score = 255 bits (652), Expect = 1e-81, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 4zro_B B 3C-like proteinase
Length=299 Score = 255 bits (652), Expect = 1e-81, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 4zro_C C 3C-like proteinase
Length=299 Score = 255 bits (652), Expect = 1e-81, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 4zro_A A 3C-like proteinase
Length=299 Score = 255 bits (652), Expect = 1e-81, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 1 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 60 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 240 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 5eu8_A A main protease
Length=307 Score = 255 bits (651), Expect = 1e-81, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 182/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 6 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 64 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 65 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 125 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 184 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 185 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 244 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 245 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 301 Query 301 SGV 303 GV Sbjct 302 YGV 304
> 1p9u_E E putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1lvo_E E Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1lvo_F F Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1lvo_A A Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1p9u_A A putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1p9u_B B putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1lvo_B B Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1lvo_C C Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1p9u_C C putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1p9u_F F putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGV 303 GV Sbjct 297 YGV 299
> 1p9u_D D putative coronavirus nsp2 (3CL-PRO)
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/305 (44%), Positives = 184/305 (60%), Gaps = 4/305 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGVTF 305 GV Sbjct 297 YGVNL 301
> 1lvo_D D Replicase, hydrolase domain
Length=302 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/305 (44%), Positives = 184/305 (60%), Gaps = 4/305 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 1 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 60 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 120 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 179 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 180 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 239 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 240 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 296 Query 301 SGVTF 305 GV Sbjct 297 YGVNL 301
> 2amp_A A 3C-like proteinase
Length=304 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 3 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 62 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 122 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 182 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 242 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 298 Query 301 SGV 303 GV Sbjct 299 YGV 301
> 2amp_B B 3C-like proteinase
Length=304 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 3 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 61 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 62 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 121 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 122 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 181 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 182 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 241 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 242 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 298 Query 301 SGV 303 GV Sbjct 299 YGV 301
> 4f49_C C 3C-like proteinase
Length=310 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 8 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 67 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 126 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 127 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 186 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 187 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 246 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 247 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 303 Query 301 SGV 303 GV Sbjct 304 YGV 306
> 4f49_A A 3C-like proteinase
Length=310 Score = 254 bits (650), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 8 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 67 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 126 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 127 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 186 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 187 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 246 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 247 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 303 Query 301 SGV 303 GV Sbjct 304 YGV 306
> 4f49_B B 3C-like proteinase
Length=310 Score = 253 bits (645), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 134/302 (44%), Positives = 183/302 (61%), Gaps = 4/302 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 8 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 67 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 126 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 127 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 186 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 187 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 246 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 247 ELSX--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 303 Query 301 SG 302 G Sbjct 304 YG 305
> 4f49_D D 3C-like proteinase
Length=310 Score = 252 bits (644), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 183/303 (60%), Gaps = 4/303 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 8 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 66 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 67 VRLHNFSVSKNXVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 126 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 127 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 186 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 187 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 246 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 247 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 303 Query 301 SGV 303 GV Sbjct 304 YGV 306
> 5nh0_B B Replicase polyprotein 1ab
Length=300 Score = 250 bits (639), Expect = 7e-80, Method: Compositional matrix adjust. Identities = 135/304 (44%), Positives = 191/304 (63%), Gaps = 5/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSGV 303 GV Sbjct 297 MYGV 300
> 3tlo_B B 3C-like proteinase
Length=303 Score = 250 bits (639), Expect = 8e-80, Method: Compositional matrix adjust. Identities = 135/306 (44%), Positives = 191/306 (62%), Gaps = 5/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSGVTF 305 GV Sbjct 297 MYGVNL 302
> 3tlo_A A 3C-like proteinase
Length=303 Score = 250 bits (639), Expect = 8e-80, Method: Compositional matrix adjust. Identities = 135/306 (44%), Positives = 191/306 (62%), Gaps = 5/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSGVTF 305 GV Sbjct 297 MYGVNL 302
> 6fv1_A A Replicase polyprotein 1ab
Length=306 Score = 250 bits (639), Expect = 9e-80, Method: Compositional matrix adjust. Identities = 135/304 (44%), Positives = 191/304 (63%), Gaps = 5/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSGV 303 GV Sbjct 297 MYGV 300
> 5gwy_B B main protease
Length=308 Score = 251 bits (640), Expect = 9e-80, Method: Compositional matrix adjust. Identities = 135/306 (44%), Positives = 191/306 (62%), Gaps = 5/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 6 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 64 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 65 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 124 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 125 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 184 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 185 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 244 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 245 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 301 Query 300 CSGVTF 305 GV Sbjct 302 MYGVNL 307
> 6fv2_A A Replicase polyprotein 1ab
Length=306 Score = 250 bits (639), Expect = 9e-80, Method: Compositional matrix adjust. Identities = 135/304 (44%), Positives = 191/304 (63%), Gaps = 5/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSGV 303 GV Sbjct 297 MYGV 300
> 5nh0_A A Replicase polyprotein 1ab
Length=299 Score = 250 bits (638), Expect = 1e-79, Method: Compositional matrix adjust. Identities = 135/303 (45%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG A L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYASLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 2k7x_A A SARS-CoV main protease
Length=120 Score = 243 bits (621), Expect = 2e-79, Method: Compositional matrix adjust. Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%) Query 187 DRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH 246 DRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH Sbjct 1 DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH 60 Query 247 VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ 306 VDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ Sbjct 61 VDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 120
> 2liz_A A 3C-like proteinase
Length=120 Score = 243 bits (621), Expect = 2e-79, Method: Compositional matrix adjust. Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%) Query 187 DRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH 246 DRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH Sbjct 1 DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH 60 Query 247 VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ 306 VDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ Sbjct 61 VDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 120
> 5nh0_C C Replicase polyprotein 1ab
Length=299 Score = 249 bits (635), Expect = 3e-79, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 6fv2_B B Replicase polyprotein 1ab
Length=306 Score = 249 bits (635), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 6fv2_C C Replicase polyprotein 1ab
Length=306 Score = 249 bits (635), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 6fv1_C C Replicase polyprotein 1ab
Length=306 Score = 249 bits (635), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 6fv1_B B Replicase polyprotein 1ab
Length=306 Score = 249 bits (635), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 134/303 (44%), Positives = 190/303 (63%), Gaps = 5/303 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 1 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 59 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 60 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 119 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 120 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 180 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 239 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 240 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 296 Query 300 CSG 302 G Sbjct 297 MYG 299
> 5gwy_A A main protease
Length=308 Score = 247 bits (630), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 133/302 (44%), Positives = 189/302 (63%), Gaps = 5/302 (2%) Query 3 FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS 62 +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 8 LKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMR 66 Query 63 NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP 122 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 67 LHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEGIA 126 Query 123 SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNF 181 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G+ Sbjct 127 SGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSV 186 Query 182 YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEP 241 YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 187 YGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTS 246 Query 242 LTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS 301 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 247 VSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQMY 303 Query 302 GV 303 GV Sbjct 304 GV 305
> 2zu2_A A 3C-like proteinase
Length=302 Score = 241 bits (614), Expect = 5e-76, Method: Compositional matrix adjust. Identities = 125/304 (41%), Positives = 187/304 (62%), Gaps = 6/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 1 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 61 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 119 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 179 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 239 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 295 Query 300 CSGV 303 GV Sbjct 296 MFGV 299
> 2zu2_B B 3C-like proteinase
Length=302 Score = 241 bits (614), Expect = 5e-76, Method: Compositional matrix adjust. Identities = 125/306 (41%), Positives = 187/306 (61%), Gaps = 6/306 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 1 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 61 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 119 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 179 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 239 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 295 Query 300 CSGVTF 305 GV Sbjct 296 MFGVNL 301
> 1p9s_A A Replicase polyprotein 1ab
Length=340 Score = 241 bits (614), Expect = 1e-75, Method: Compositional matrix adjust. Identities = 125/304 (41%), Positives = 187/304 (62%), Gaps = 6/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 1 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 61 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 119 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 179 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 239 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 295 Query 300 CSGV 303 GV Sbjct 296 MFGV 299
> 1p9s_B B Replicase polyprotein 1ab
Length=340 Score = 240 bits (613), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 125/304 (41%), Positives = 187/304 (62%), Gaps = 6/304 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 1 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 60 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 61 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 118 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 119 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 178 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 179 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 238 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 239 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 295 Query 300 CSGV 303 GV Sbjct 296 MFGV 299
> 2q6d_B B Infectious bronchitis virus (IBV) main protease
Length=309 Score = 226 bits (575), Expect = 3e-70, Method: Compositional matrix adjust. Identities = 128/313 (41%), Positives = 174/313 (56%), Gaps = 19/313 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 3 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNL 59 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 60 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 119 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 120 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVI-------NGDRWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I + +W L T ++ D+N Sbjct 180 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNR 238 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ + ILG EDE Sbjct 239 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 293 Query 291 FTPFDVVRQCSGV 303 TP V Q GV Sbjct 294 LTPESVFNQVGGV 306
> 2q6f_A A Infectious bronchitis virus (IBV) main protease
Length=309 Score = 222 bits (566), Expect = 9e-69, Method: Compositional matrix adjust. Identities = 126/309 (41%), Positives = 172/309 (56%), Gaps = 19/309 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 3 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNL 59 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 60 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 119 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 120 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVIN-------GDRWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I+ +W L T ++ D+N Sbjct 180 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVXXXXXXXPKW-LESTTVSIEDYNR 238 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ + ILG EDE Sbjct 239 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 293 Query 291 FTPFDVVRQ 299 TP V Q Sbjct 294 LTPESVFNQ 302
> 2q6f_B B Infectious bronchitis virus (IBV) main protease
Length=309 Score = 222 bits (566), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 126/309 (41%), Positives = 172/309 (56%), Gaps = 19/309 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 3 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNL 59 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 60 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 119 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 120 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVIN-------GDRWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I+ +W L T ++ D+N Sbjct 180 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVXXXXXXXPKW-LESTTVSIEDYNR 238 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ + ILG EDE Sbjct 239 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 293 Query 291 FTPFDVVRQ 299 TP V Q Sbjct 294 LTPESVFNQ 302
> 2q6d_A A Infectious bronchitis virus (IBV) main protease
Length=309 Score = 222 bits (565), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 126/309 (41%), Positives = 172/309 (56%), Gaps = 19/309 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 3 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNL 59 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 60 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 119 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 120 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 179 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVI-------NGDRWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I + +W L T ++ D+N Sbjct 180 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVXXXXXSQPKW-LESTTVSIEDYNR 238 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ + ILG EDE Sbjct 239 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 293 Query 291 FTPFDVVRQ 299 TP V Q Sbjct 294 LTPESVFNQ 302
> 2q6d_C C Infectious bronchitis virus (IBV) main protease
Length=309 Score = 218 bits (556), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 125/308 (41%), Positives = 169/308 (55%), Gaps = 19/308 (6%) Query 9 PSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLV 68 PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L +NH F V Sbjct 11 PSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVLG---KFSGDQWGDVLNLANNHEFEV 67 Query 69 QAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQ 127 N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y G+ G+Y Sbjct 68 VTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYGGTVIGLYP 127 Query 128 CAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD 187 MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G FYG +VD Sbjct 128 VTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVD 187 Query 188 RQTAQAAGTDTTITVNVLAWLYAAVI-------NGDRWFLNRFTTTLNDFNLVAMKYNYE 240 + AQ D +T N++AWLYAA+I + +W L T ++ D+N A + Sbjct 188 EEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNRWASDNGFT 246 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDEFTPFDVVR 298 P + + LSA TG+ D+C L+ ++ + ILG EDE TP V Sbjct 247 PFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDELTPESVFN 301 Query 299 QCSGVTFQ 306 Q GV Q Sbjct 302 QVGGVRLQ 309
> 3ebn_D D Replicase polyprotein 1ab
Length=118 Score = 204 bits (519), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%) Query 198 TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 257 TTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT Sbjct 10 TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 69 Query 258 GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 298 GIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVR Sbjct 70 GIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVR 110
> 3ebn_C C Replicase polyprotein 1ab
Length=118 Score = 204 bits (519), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%) Query 198 TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 257 TTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT Sbjct 10 TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 69 Query 258 GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVR 298 GIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVR Sbjct 70 GIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVR 110
> 3ebn_A A Replicase polyprotein 1ab
Length=118 Score = 202 bits (513), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 96/100 (96%), Positives = 99/100 (99%), Gaps = 0/100 (0%) Query 198 TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 257 TTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT Sbjct 10 TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 69 Query 258 GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 GIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV Sbjct 70 GIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV 109
> 3ebn_B B Replicase polyprotein 1ab
Length=118 Score = 202 bits (513), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 96/100 (96%), Positives = 99/100 (99%), Gaps = 0/100 (0%) Query 198 TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 257 TTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT Sbjct 10 TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT 69 Query 258 GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 GIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVV Sbjct 70 GIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV 109
> 3j1z_A P Cation efflux family protein
Length=306 Score = 33.5 bits (75), Expect = 1.7, Method: Compositional matrix adjust. Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 3/68 (4%) Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLND-FNLVAMKYN 238 +F+ R A A T IT+ +LAWLY+ + + F TL N +A++Y Sbjct 8 DFWVKLASR--ASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIAIRYA 65 Query 239 YEPLTQDH 246 P DH Sbjct 66 IVPADHDH 73
> 3j1z_B Q Cation efflux family protein
Length=306 Score = 33.5 bits (75), Expect = 1.7, Method: Compositional matrix adjust. Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 3/68 (4%) Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLND-FNLVAMKYN 238 +F+ R A A T IT+ +LAWLY+ + + F TL N +A++Y Sbjct 8 DFWVKLASR--ASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIAIRYA 65 Query 239 YEPLTQDH 246 P DH Sbjct 66 IVPADHDH 73
> 5vrf_B A Cadmium and zinc efflux pump FieF
Length=296 Score = 33.1 bits (74), Expect = 1.8, Method: Compositional matrix adjust. Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 3/68 (4%) Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLND-FNLVAMKYN 238 +F+ R A A T IT+ +LAWLY+ + + F TL N +A++Y Sbjct 8 DFWVKLASR--ASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIAIRYA 65 Query 239 YEPLTQDH 246 P DH Sbjct 66 IVPADHDH 73
> 5vrf_A B Cadmium and zinc efflux pump FieF
Length=296 Score = 33.1 bits (74), Expect = 1.8, Method: Compositional matrix adjust. Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 3/68 (4%) Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLND-FNLVAMKYN 238 +F+ R A A T IT+ +LAWLY+ + + F TL N +A++Y Sbjct 8 DFWVKLASR--ASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIAIRYA 65 Query 239 YEPLTQDH 246 P DH Sbjct 66 IVPADHDH 73 Lambda K H a alpha 0.323 0.138 0.433 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 16510532352 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40