[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20200930.fasta
           553,592 sequences; 149,101,844 total letters



Query= YP_009725311.1 2'-O-ribose methyltransferase [Severe acute
respiratory syndrome coronavirus 2]

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  7jyy_A A 2'-O-methyltransferase                                      622    0.0   
  6wks_A AAA 2'-O-methyltransferase                                    622    0.0   
  7jz0_A A 2'-O-methyltransferase                                      622    0.0   
  7jz0_C C 2'-O-methyltransferase                                      622    0.0   
  6xkm_A A 2'-O-methyltransferase                                      622    0.0   
  6wq3_A A 2'-O-methyltransferase                                      622    0.0   
  7jhe_A A 2'-O-methyltransferase                                      622    0.0   
  7jpe_A A 2'-O-methyltransferase                                      622    0.0   
  7jib_A A 2'-O-methyltransferase                                      622    0.0   
  6w4h_A A SARS-CoV-2 NSP16                                            622    0.0   
  6wrz_A A 2'-O-methyltransferase                                      622    0.0   
  6wvn_A A 2'-O-methyltransferase                                      622    0.0   
  7c2j_A A Replicase polyprotein 1ab                                   622    0.0   
  7c2i_A A Replicase polyprotein 1ab                                   622    0.0   
  7bq7_A A SARS-CoV-2 nsp16                                            620    0.0   
  6yz1_A A nsp16                                                       620    0.0   
  6wjt_A A 2'-O-methyltransferase                                      620    0.0   
  6wkq_A A SARS-CoV-2 NSP16                                            620    0.0   
  6w75_A A SARS-CoV-2 NSP16                                            620    0.0   
  7jyy_C C 2'-O-methyltransferase                                      620    0.0   
  6w61_A A 2'-O-methyltransferase                                      620    0.0   
  6wjt_C C 2'-O-methyltransferase                                      613    0.0   
  6wkq_C C SARS-CoV-2 NSP16                                            613    0.0   
  6w75_C C SARS-CoV-2 NSP16                                            608    0.0   
  3r24_A A 2'-O-methyl transferase                                     585    0.0   
  2xyq_A A PUTATIVE 2'-O-METHYL TRANSFERASE                            575    0.0   
  2xyr_A A PUTATIVE 2'-O-METHYL TRANSFERASE                            573    0.0   
  2xyv_A A PUTATIVE 2'-O-METHYL TRANSFERASE                            572    0.0   
  5ynn_A A nsp16 protein                                               429    8e-150
  5ynp_A A nsp16 protein                                               427    4e-149
  5yni_A A nsp16 protein                                               427    6e-149
  5ynf_A A nsp16 protein                                               426    2e-148
  5ynj_A A nsp16 protein                                               426    2e-148
  5ynm_A A nsp16 protein                                               422    2e-147
  5yno_A A nsp16 protein                                               421    8e-147
  5ynq_A A nsp16 protein                                               421    8e-147
  5ynb_A A nsp16 protein                                               419    4e-146
  5yn5_A A nsp16 protein                                               416    8e-145
  5yn6_A A nsp16 protein                                               412    2e-143
  5yn8_A A nsp16 protein                                               408    2e-141


> 7jyy_A A 2'-O-methyltransferase
Length=300 Score = 622 bits (1605), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 3 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 62 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 63 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 122 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 123 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 182 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 183 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 242 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 243 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 300
> 6wks_A AAA 2'-O-methyltransferase
Length=298 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298
> 7jz0_A A 2'-O-methyltransferase
Length=300 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 3 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 62 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 63 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 122 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 123 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 182 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 183 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 242 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 243 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 300
> 7jz0_C C 2'-O-methyltransferase
Length=300 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 3 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 62 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 63 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 122 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 123 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 182 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 183 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 242 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 243 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 300
> 6xkm_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6wq3_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 7jhe_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 7jpe_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 7jib_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6w4h_A A SARS-CoV-2 NSP16
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6wrz_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6wvn_A A 2'-O-methyltransferase
Length=301 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 7c2j_A A Replicase polyprotein 1ab
Length=305 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 8 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 67 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 68 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 127 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 128 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 187 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 188 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 247 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 248 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 305
> 7c2i_A A Replicase polyprotein 1ab
Length=305 Score = 622 bits (1604), Expect = 0.0, Method: Compositional matrix adjust. Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 8 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 67 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 68 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 127 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 128 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 187 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 188 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 247 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 248 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 305
> 7bq7_A A SARS-CoV-2 nsp16
Length=298 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 297 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN Sbjct 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 297
> 6yz1_A A nsp16
Length=299 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 2 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 61 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 62 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 121 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 122 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 181 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 182 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 241 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 297 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN Sbjct 242 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 298
> 6wjt_A A 2'-O-methyltransferase
Length=301 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 61 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV Sbjct 5 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 64 Query 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA Sbjct 65 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 124 Query 122 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 181 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY Sbjct 125 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 184 Query 182 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 241 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS Sbjct 185 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 244 Query 242 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 245 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6wkq_A A SARS-CoV-2 NSP16
Length=301 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 61 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV Sbjct 5 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 64 Query 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA Sbjct 65 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 124 Query 122 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 181 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY Sbjct 125 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 184 Query 182 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 241 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS Sbjct 185 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 244 Query 242 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 245 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6w75_A A SARS-CoV-2 NSP16
Length=301 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 61 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV Sbjct 5 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 64 Query 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA Sbjct 65 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 124 Query 122 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 181 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY Sbjct 125 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 184 Query 182 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 241 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS Sbjct 185 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 244 Query 242 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 245 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 7jyy_C C 2'-O-methyltransferase
Length=300 Score = 620 bits (1599), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 3 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 62 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 63 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 122 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 123 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 182 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 183 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 242 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 297 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN Sbjct 243 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 299
> 6w61_A A 2'-O-methyltransferase
Length=303 Score = 620 bits (1598), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/298 (99%), Positives = 297/298 (99%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 2 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 61 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 62 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 121 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKT NVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 122 ANKWDLIISDMYDPKTXNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 181 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 182 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 241 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 242 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 299
> 6wjt_C C 2'-O-methyltransferase
Length=301 Score = 613 bits (1580), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/298 (99%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKT KENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTXXXXKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6wkq_C C SARS-CoV-2 NSP16
Length=301 Score = 613 bits (1580), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/298 (99%), Positives = 294/298 (99%), Gaps = 0/298 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPKT KENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKTXXXXKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 298 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 301
> 6w75_C C SARS-CoV-2 NSP16
Length=301 Score = 608 bits (1569), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/297 (98%), Positives = 292/297 (98%), Gaps = 0/297 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA Sbjct 4 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 63 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 64 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 123 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDPK KENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL Sbjct 124 ANKWDLIISDMYDPKXXXXXKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 183 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS Sbjct 184 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 243 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 297 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN Sbjct 244 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN 300
> 3r24_A A 2'-O-methyl transferase
Length=344 Score = 585 bits (1507), Expect = 0.0, Method: Compositional matrix adjust. Identities = 273/292 (93%), Positives = 286/292 (98%), Gaps = 0/292 (0%) Query 3 QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP 62 QAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLAVP Sbjct 49 QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVP 108 Query 63 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN 122 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN Sbjct 109 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN 168 Query 123 KWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYK 182 KWDLIISDMYDP+TK+VTKENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADLYK Sbjct 169 KWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYK 228 Query 183 LMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSY 242 LMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLSSY Sbjct 229 LMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSY 288 Query 243 SLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDV 294 SLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+ Sbjct 289 SLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDI 340
> 2xyq_A A PUTATIVE 2'-O-METHYL TRANSFERASE
Length=290 Score = 575 bits (1482), Expect = 0.0, Method: Compositional matrix adjust. Identities = 269/290 (93%), Positives = 281/290 (97%), Gaps = 0/290 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA Sbjct 1 ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT Sbjct 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 ANKWDLIISDMYDP+ VTKENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADL Sbjct 121 ANKWDLIISDMYDPRXXXVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS Sbjct 181 YKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI 290 SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+ Sbjct 241 SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVV 290
> 2xyr_A A PUTATIVE 2'-O-METHYL TRANSFERASE
Length=292 Score = 573 bits (1478), Expect = 0.0, Method: Compositional matrix adjust. Identities = 269/290 (93%), Positives = 280/290 (97%), Gaps = 0/290 (0%) Query 3 QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP 62 QAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLAVP Sbjct 3 QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVP 62 Query 63 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN 122 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN Sbjct 63 YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN 122 Query 123 KWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYK 182 KWDLIISDMYDP+ TKENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADLYK Sbjct 123 KWDLIISDMYDPRXXXXTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYK 182 Query 183 LMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSY 242 LMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLSSY Sbjct 183 LMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSY 242 Query 243 SLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISS 292 SLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SS Sbjct 243 SLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS 292
> 2xyv_A A PUTATIVE 2'-O-METHYL TRANSFERASE
Length=292 Score = 572 bits (1474), Expect = 0.0, Method: Compositional matrix adjust. Identities = 269/291 (92%), Positives = 279/291 (96%), Gaps = 0/291 (0%) Query 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 61 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLAV Sbjct 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAV 61 Query 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA Sbjct 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 Query 122 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 181 NKWDLIISDMYDP KENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADLY Sbjct 122 NKWDLIISDMYDPXXXXXXKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLY 181 Query 182 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 241 KLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLSS Sbjct 182 KLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSS 241 Query 242 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISS 292 YSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SS Sbjct 242 YSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS 292
> 5ynn_A A nsp16 protein
Length=303 Score = 429 bits (1102), Expect = 8e-150, Method: Compositional matrix adjust. Identities = 195/295 (66%), Positives = 241/295 (82%), Gaps = 0/295 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVL 295 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVL Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVL 295
> 5ynp_A A nsp16 protein
Length=303 Score = 427 bits (1098), Expect = 4e-149, Method: Compositional matrix adjust. Identities = 194/294 (66%), Positives = 240/294 (82%), Gaps = 0/294 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDV 294 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DV Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDV 294
> 5yni_A A nsp16 protein
Length=303 Score = 427 bits (1097), Expect = 6e-149, Method: Compositional matrix adjust. Identities = 195/296 (66%), Positives = 240/296 (81%), Gaps = 0/296 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P + MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPXXVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV 296 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLV Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLV 296
> 5ynf_A A nsp16 protein
Length=303 Score = 426 bits (1094), Expect = 2e-148, Method: Compositional matrix adjust. Identities = 193/293 (66%), Positives = 239/293 (82%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293
> 5ynj_A A nsp16 protein
Length=303 Score = 426 bits (1094), Expect = 2e-148, Method: Compositional matrix adjust. Identities = 193/293 (66%), Positives = 239/293 (82%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293
> 5ynm_A A nsp16 protein
Length=303 Score = 422 bits (1086), Expect = 2e-147, Method: Compositional matrix adjust. Identities = 192/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNV N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVXGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDXXSVSTD 293
> 5yno_A A nsp16 protein
Length=303 Score = 421 bits (1083), Expect = 8e-147, Method: Compositional matrix adjust. Identities = 192/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P + MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPXXVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293
> 5ynq_A A nsp16 protein
Length=303 Score = 421 bits (1083), Expect = 8e-147, Method: Compositional matrix adjust. Identities = 192/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P + MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPXXVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP TKNVT N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293
> 5ynb_A A nsp16 protein
Length=303 Score = 419 bits (1078), Expect = 4e-146, Method: Compositional matrix adjust. Identities = 191/296 (65%), Positives = 237/296 (80%), Gaps = 0/296 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTXXXXXGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV 296 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLV Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLV 296
> 5yn5_A A nsp16 protein
Length=303 Score = 416 bits (1069), Expect = 8e-145, Method: Compositional matrix adjust. Identities = 189/294 (64%), Positives = 235/294 (80%), Gaps = 0/294 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY S +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTXXXXXGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDV 294 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DV Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDV 294
> 5yn6_A A nsp16 protein
Length=303 Score = 412 bits (1060), Expect = 2e-143, Method: Compositional matrix adjust. Identities = 187/293 (64%), Positives = 233/293 (80%), Gaps = 0/293 (0%) Query 1 SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA 60 +S W+PG AMP+L+K+Q + LE+C+L NY +P+G+ MN+AKY QLCQYLNT TLA Sbjct 1 ASADWKPGHAMPSLFKVQNVNLERCELANYXXXXPMPRGVHMNIAKYMQLCQYLNTCTLA 60 Query 61 VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT 120 VP NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 61 VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV 120 Query 121 ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL 180 + DL+ISDMYDP N+SK FFTY+C I LALGGSVAIKITEHSW+ +L Sbjct 121 GQQVDLVISDMYDPTXXXXXXSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL 180 Query 181 YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS 240 Y+LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS Sbjct 181 YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS 240 Query 241 SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 241 TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293
> 5yn8_A A nsp16 protein
Length=303 Score = 408 bits (1048), Expect = 2e-141, Method: Compositional matrix adjust. Identities = 186/292 (64%), Positives = 230/292 (79%), Gaps = 0/292 (0%) Query 2 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV 61 S W+PG AMP+L+K+Q + LE+C+L N +P G+ MN+AKY QLCQYLNT TLAV Sbjct 2 SADWKPGHAMPSLFKVQNVNLERCELANXXXXIPMPXGVHMNIAKYMQLCQYLNTCTLAV 61 Query 62 PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA 121 P NMRVIHFGAGSDKG+APGT+VLRQWLPT +++D+DLN+FVSDAD TL GDC TV Sbjct 62 PANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRVG 121 Query 122 NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY 181 + DL+ISDMYDP N+SK FFTY+C I LALGGSVAIKITEHSW+ +LY Sbjct 122 QQVDLVISDMYDPTXXXXXXSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELY 181 Query 182 KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSS 241 +LMG FAWWT F TN NASSSE FL+G NYLG +E IDG MHANYIFWRN+ P+ LS+ Sbjct 182 ELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLST 241 Query 242 YSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD 293 YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+D Sbjct 242 YSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD 293 Lambda K H a alpha 0.320 0.134 0.410 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 15822593504 Database: unitmol_20200930.fasta Posted date: Sep 30, 2020 5:33 PM Number of letters in database: 149,101,844 Number of sequences in database: 553,592 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40