[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1

Length=73
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute ...   145    5e-45
  sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavir...   106    5e-30
  sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS co...   106    6e-30
  sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus aura...  30.4    1.2  
  sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9...  30.0    1.7  
  sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=1...  29.3    3.2  


> sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1 Length=73 Score = 145 bits (365), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM Sbjct 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 Query 61 AVMLLLLCCCLTD 73 AVMLLLLCCCLTD Sbjct 61 AVMLLLLCCCLTD 73
> sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavirus
Rp3/2004 OX=349344 GN=ORF14 PE=4 SV=1 Length=70 Score = 106 bits (265), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 56/70 (80%), Positives = 58/70 (83%), Gaps = 0/70 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 ML SCYNFLKEQHCQKASTQKGAEAAVKPLL HHVVA +QEIQL AAVGE+L LEWLA Sbjct 1 MLPSCYNFLKEQHCQKASTQKGAEAAVKPLLALHHVVAVIQEIQLLAAVGEILQLEWLAE 60 Query 61 AVMLLLLCCC 70 AV L CC Sbjct 61 AVKLPSRYCC 70
> sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS
coronavirus OX=694009 GN=ORF14 PE=1 SV=1 Length=70 Score = 106 bits (264), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 ML CYNFLKEQHCQKASTQ+ AEAAVKPLL PHHVVA +QEIQL AAVGE+LLLEWLA Sbjct 1 MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAE 60 Query 61 AVMLLLLCCC 70 V L CC Sbjct 61 VVKLPSRYCC 70
> sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus auratus
OX=10036 GN=LY75 PE=2 SV=1 Length=1722 Score = 30.4 bits (67), Expect = 1.2, Method: Composition-based stats. Identities = 17/61 (28%), Positives = 30/61 (49%), Gaps = 0/61 (0%) Query 4 SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM 63 SCYNF+ ++ + TQK + + L +++ E + V +LL ++A VM Sbjct 1254 SCYNFMITKNRHRTITQKEVHSLCQKLHSKAQILSIRNEEENNFVVEQLLYFNYIASWVM 1313 Query 64 L 64 L Sbjct 1314 L 1314
> sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606
GN=LY75 PE=1 SV=3 Length=1722 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 16/60 (27%), Positives = 29/60 (48%), Gaps = 0/60 (0%) Query 5 CYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVML 64 CYNF+ ++ A+TQ + L H+++ E + + +LL ++A VML Sbjct 1255 CYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVML 1314
> sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090
GN=Ly75 PE=1 SV=2 Length=1723 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 17/61 (28%), Positives = 29/61 (48%), Gaps = 0/61 (0%) Query 4 SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM 63 SCYNF+ + K T + ++ + L H ++ E + V +LL ++A VM Sbjct 1255 SCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVM 1314 Query 64 L 64 L Sbjct 1315 L 1315 Lambda K H a alpha 0.327 0.134 0.412 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 4968890528 Results from round 2 Query= sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1 Length=73 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS co... 106 7e-30 sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavir... 105 2e-29 sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute ... 101 8e-28 Sequences not found previously or not previously below threshold: sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus aura... 30.8 1.0 sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9... 30.4 1.3 sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=1... 30.0 1.5 sp|P44240|VG47_HAEIN Mu-like prophage FluMu protein gp47 OS=Hae... 28.1 6.0
> sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS
coronavirus OX=694009 GN=ORF14 PE=1 SV=1 Length=70 Score = 106 bits (264), Expect = 7e-30, Method: Composition-based stats. Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 ML CYNFLKEQHCQKASTQ+ AEAAVKPLL PHHVVA +QEIQL AAVGE+LLLEWLA Sbjct 1 MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAE 60 Query 61 AVMLLLLCCC 70 V L CC Sbjct 61 VVKLPSRYCC 70
> sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavirus
Rp3/2004 OX=349344 GN=ORF14 PE=4 SV=1 Length=70 Score = 105 bits (261), Expect = 2e-29, Method: Composition-based stats. Identities = 56/70 (80%), Positives = 58/70 (83%), Gaps = 0/70 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 ML SCYNFLKEQHCQKASTQKGAEAAVKPLL HHVVA +QEIQL AAVGE+L LEWLA Sbjct 1 MLPSCYNFLKEQHCQKASTQKGAEAAVKPLLALHHVVAVIQEIQLLAAVGEILQLEWLAE 60 Query 61 AVMLLLLCCC 70 AV L CC Sbjct 61 AVKLPSRYCC 70
> sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1 Length=73 Score = 101 bits (251), Expect = 8e-28, Method: Composition-based stats. Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%) Query 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM Sbjct 1 MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM 60 Query 61 AVMLLLLCCCLTD 73 AVMLLLLCCCLTD Sbjct 61 AVMLLLLCCCLTD 73
> sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus auratus
OX=10036 GN=LY75 PE=2 SV=1 Length=1722 Score = 30.8 bits (68), Expect = 1.0, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 31/65 (48%), Gaps = 0/65 (0%) Query 4 SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM 63 SCYNF+ ++ + TQK + + L +++ E + V +LL ++A VM Sbjct 1254 SCYNFMITKNRHRTITQKEVHSLCQKLHSKAQILSIRNEEENNFVVEQLLYFNYIASWVM 1313 Query 64 LLLLC 68 L + Sbjct 1314 LGVTY 1318
> sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606
GN=LY75 PE=1 SV=3 Length=1722 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 30/64 (47%), Gaps = 0/64 (0%) Query 5 CYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVML 64 CYNF+ ++ A+TQ + L H+++ E + + +LL ++A VML Sbjct 1255 CYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVML 1314 Query 65 LLLC 68 + Sbjct 1315 GITY 1318
> sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090
GN=Ly75 PE=1 SV=2 Length=1723 Score = 30.0 bits (66), Expect = 1.5, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 0/65 (0%) Query 4 SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM 63 SCYNF+ + K T + ++ + L H ++ E + V +LL ++A VM Sbjct 1255 SCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVM 1314 Query 64 LLLLC 68 L + Sbjct 1315 LGITY 1319
> sp|P44240|VG47_HAEIN Mu-like prophage FluMu protein gp47 OS=Haemophilus
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1520 PE=3 SV=1 Length=355 Score = 28.1 bits (61), Expect = 6.0, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (53%), Gaps = 0/34 (0%) Query 29 PLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAV 62 P L H+V+ + I + GE + L+WLA + Sbjct 24 PTLKRHNVIGVINRICAALSAGEHMHLDWLARQI 57 Lambda K H a alpha 0.323 0.137 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0412 0.140 1.90 42.6 43.6 Effective search space used: 4968890528 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Aug 19, 2020 9:15 PM Number of letters in database: 202,799,066 Number of sequences in database: 563,082 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40