[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= YP_009725301.1 3C-like proteinase [Severe acute respiratory syndrome
coronavirus 2]

Length=306
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute re...   652    0.0   
  sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ...   649    0.0   
  sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus...   635    0.0   
  sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coro...   634    0.0   
  sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir...   632    0.0   
  sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus...   630    0.0   
  sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus...   630    0.0   
  sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co...   631    0.0   
  sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir...   628    0.0   
  sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir...   628    0.0   
  sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus...   342    3e-104
  sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir...   341    7e-104
  sp|K9N638|R1A_MERS1 Replicase polyprotein 1a OS=Middle East res...   322    2e-97 
  sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East r...   320    7e-97 
  sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus...   311    8e-94 
  sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir...   311    2e-93 
  sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavir...   310    2e-93 
  sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav...   310    3e-93 
  sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus...   308    8e-93 
  sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus...   308    2e-92 
  sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir...   308    2e-92 
  sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavi...   307    3e-92 
  sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir...   307    4e-92 
  sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona...   306    5e-92 
  sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavi...   305    1e-91 
  sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona...   305    2e-91 
  sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavir...   304    3e-91 
  sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavir...   304    4e-91 
  sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav...   303    5e-91 
  sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavi...   303    6e-91 
  sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavi...   303    6e-91 
  sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav...   303    7e-91 
  sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona...   303    1e-90 
  sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona...   303    1e-90 
  sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavir...   302    1e-90 
  sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavir...   302    1e-90 
  sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavir...   302    2e-90 
  sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav...   302    2e-90 
  sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav...   302    2e-90 
  sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav...   301    2e-90 
  sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavir...   298    5e-89 
  sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav...   297    8e-89 
  sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus...   274    1e-80 
  sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir...   273    1e-80 
  sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemi...   264    2e-77 
  sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide...   263    5e-77 
  sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav...   254    8e-74 
  sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmi...   254    9e-74 
  sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans...   253    1e-73 
  sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavir...   250    1e-72 
  sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav...   250    1e-72 
  sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavir...   239    7e-69 
  sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav...   238    2e-68 
  sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectiou...   228    7e-65 
  sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious...   228    7e-65 
  sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti...   227    1e-64 
  sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio...   227    1e-64 
  sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious...   225    5e-64 
  sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio...   224    1e-63 
  sp|Q6AE15|HIS4_LEIXX 1-(5-phosphoribosyl)-5-[(5-phosphoribosyla...  33.1    2.6   


> sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1 Length=4405 Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3564 SGVTFQ 3569
> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 SV=1 Length=7096 Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3564 SGVTFQ 3569
> sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus
279/2005 OX=389167 GN=1a PE=3 SV=1 Length=4388 Score = 635 bits (1639), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 303/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3247 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3307 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN+TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3367 SPSGVYQCAMRPNYTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3427 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3487 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3546 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3547 SGVTFQ 3552
> sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coronavirus
OX=694009 GN=1a PE=1 SV=1 Length=4382 Score = 634 bits (1634), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3241 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3300 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3301 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3360 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3361 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3420 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3421 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3480 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3481 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3540 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3541 SGVTFQ 3546
> sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus
279/2005 OX=389167 GN=rep PE=3 SV=1 Length=7079 Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 303/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3247 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3307 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN+TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3367 SPSGVYQCAMRPNYTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3427 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3487 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3546 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3547 SGVTFQ 3552
> sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus
HKU3 OX=442736 GN=1a PE=3 SV=1 Length=4376 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/306 (95%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHV+CT+EDMLNPNY+DLLIR Sbjct 3235 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVVCTAEDMLNPNYDDLLIR 3294 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3295 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3354 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3355 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3414 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3415 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3474 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3475 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3534 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3535 SGVTFQ 3540
> sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus
Rp3/2004 OX=349344 GN=1a PE=3 SV=1 Length=4380 Score = 630 bits (1626), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3239 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3298 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3299 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3358 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPT VHAGTDLEG Sbjct 3359 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTEVHAGTDLEGK 3418 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3419 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3478 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3479 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3538 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3539 SGVTFQ 3544
> sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS
coronavirus OX=694009 GN=rep PE=1 SV=1 Length=7073 Score = 631 bits (1628), Expect = 0.0, Method: Compositional matrix adjust. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3241 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3300 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3301 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3360 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3361 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3420 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3421 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3480 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3481 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3540 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3541 SGVTFQ 3546
> sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus
Rp3/2004 OX=349344 GN=rep PE=3 SV=1 Length=7071 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3239 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3298 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3299 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3358 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPT VHAGTDLEG Sbjct 3359 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTEVHAGTDLEGK 3418 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3419 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3478 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3479 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3538 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3539 SGVTFQ 3544
> sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus
HKU3 OX=442736 GN=rep PE=3 SV=1 Length=7067 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 292/306 (95%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHV+CT+EDMLNPNY+DLLIR Sbjct 3235 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVVCTAEDMLNPNYDDLLIR 3294 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3295 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3354 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3355 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3414 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3415 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3474 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3475 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3534 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3535 SGVTFQ 3540
> sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus
HKU9 OX=694006 GN=1a PE=3 SV=1 Length=4248 Score = 342 bits (876), Expect = 3e-104, Method: Compositional matrix adjust. Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G +MA PSG VE C+V+V G+ TLNG+WLD+ V CPRHV+C+ +++ NP+Y L +R Sbjct 3104 AGLTRMAHPSGLVEPCLVKVNYGSMTLNGIWLDNFVICPRHVMCSRDELANPDYPRLSMR 3163 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 +N++F V +RVIGH+M+ +LKL VD NPKTP Y F+R+ GQ S+LACY+G Sbjct 3164 AANYDFHVSQNGHNIRVIGHTMEGSLLKLTVDVNNPKTPAYSFIRVSTGQAMSLLACYDG 3223 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P+GVY C +R N T++ SFL GSCGS GF ++ V FCY+H +ELP G H GTD G Sbjct 3224 LPTGVYTCTLRSNGTMRASFLCGSCGSPGFVMNGKEVQFCYLHQLELPNGTHTGTDFSGV 3283 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPF D+Q Q A D TITVNVLAWLYAAV++G+ WFL + + + +FN A+KY + Sbjct 3284 FYGPFEDKQVPQLAAPDCTITVNVLAWLYAAVLSGENWFLTKSSISPAEFNNCAVKYMCQ 3343 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 +T + + +L PL+A+TGI+V M ++LK LL G GRTI+GS LEDE TP+D+ RQ Sbjct 3344 SVTSESLQVLQPLAAKTGISVERMLSALKVLLSAGFCGRTIMGSCSLEDEHTPYDIGRQM 3403 Query 301 SGVTFQ 306 GV Q Sbjct 3404 LGVKLQ 3409
> sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus
HKU9 OX=694006 GN=rep PE=1 SV=1 Length=6930 Score = 341 bits (874), Expect = 7e-104, Method: Compositional matrix adjust. Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G +MA PSG VE C+V+V G+ TLNG+WLD+ V CPRHV+C+ +++ NP+Y L +R Sbjct 3104 AGLTRMAHPSGLVEPCLVKVNYGSMTLNGIWLDNFVICPRHVMCSRDELANPDYPRLSMR 3163 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 +N++F V +RVIGH+M+ +LKL VD NPKTP Y F+R+ GQ S+LACY+G Sbjct 3164 AANYDFHVSQNGHNIRVIGHTMEGSLLKLTVDVNNPKTPAYSFIRVSTGQAMSLLACYDG 3223 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P+GVY C +R N T++ SFL GSCGS GF ++ V FCY+H +ELP G H GTD G Sbjct 3224 LPTGVYTCTLRSNGTMRASFLCGSCGSPGFVMNGKEVQFCYLHQLELPNGTHTGTDFSGV 3283 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPF D+Q Q A D TITVNVLAWLYAAV++G+ WFL + + + +FN A+KY + Sbjct 3284 FYGPFEDKQVPQLAAPDCTITVNVLAWLYAAVLSGENWFLTKSSISPAEFNNCAVKYMCQ 3343 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 +T + + +L PL+A+TGI+V M ++LK LL G GRTI+GS LEDE TP+D+ RQ Sbjct 3344 SVTSESLQVLQPLAAKTGISVERMLSALKVLLSAGFCGRTIMGSCSLEDEHTPYDIGRQM 3403 Query 301 SGVTFQ 306 GV Q Sbjct 3404 LGVKLQ 3409
> sp|K9N638|R1A_MERS1 Replicase polyprotein 1a OS=Middle East respiratory
syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=1a PE=1 SV=1 Length=4391 Score = 322 bits (824), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 157/310 (51%), Positives = 207/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 3248 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 3307 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 3308 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 3367 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 3368 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 3427 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 3428 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 3487 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 3488 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 3543 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3544 NMQIMGVVMQ 3553
> sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=rep PE=1 SV=1 Length=7078 Score = 320 bits (821), Expect = 7e-97, Method: Compositional matrix adjust. Identities = 157/310 (51%), Positives = 207/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 3248 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 3307 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 3308 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 3367 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 3368 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 3427 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 3428 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 3487 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 3488 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 3543 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3544 NMQIMGVVMQ 3553
> sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus
HKU5 OX=694008 GN=1a PE=3 SV=1 Length=4481 Score = 311 bits (798), Expect = 8e-94, Method: Compositional matrix adjust. Identities = 155/310 (50%), Positives = 208/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KMA PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ Sbjct 3339 SGLVKMAAPSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVS 3398 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+N +F+VQ LRV+GH+M +LKL V++ANP+TP Y F ++PG +FSVLAC Sbjct 3399 KTNLSFIVQKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLAC 3458 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ MR N TIKGSFL GSCGSVG+ + + ++FCYMH MEL G H G Sbjct 3459 YNGRPTGVFMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAF 3518 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F DRQ Q +D T+N++AWLYAA++NG WF+ T + FN AM Sbjct 3519 DGVMYGAFEDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSN 3578 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG++V + ++ + L G G+TILG+++LEDEFTP DV Sbjct 3579 QFTEFIGTQSVDM---LAHKTGVSVEQLLYAI-QTLHKGFQGKTILGNSMLEDEFTPDDV 3634 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3635 NMQVMGVVMQ 3644
> sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus
HKU5 OX=694008 GN=rep PE=3 SV=1 Length=7182 Score = 311 bits (796), Expect = 2e-93, Method: Compositional matrix adjust. Identities = 155/310 (50%), Positives = 208/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KMA PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ Sbjct 3339 SGLVKMAAPSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVS 3398 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+N +F+VQ LRV+GH+M +LKL V++ANP+TP Y F ++PG +FSVLAC Sbjct 3399 KTNLSFIVQKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLAC 3458 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ MR N TIKGSFL GSCGSVG+ + + ++FCYMH MEL G H G Sbjct 3459 YNGRPTGVFMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAF 3518 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F DRQ Q +D T+N++AWLYAA++NG WF+ T + FN AM Sbjct 3519 DGVMYGAFEDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSN 3578 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + VD+ L+ +TG++V + ++ + L G G+TILG+++LEDEFTP DV Sbjct 3579 QFTEFIGTQSVDM---LAHKTGVSVEQLLYAI-QTLHKGFQGKTILGNSMLEDEFTPDDV 3634 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3635 NMQVMGVVMQ 3644
> sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavirus
(strain 2) OX=76344 GN=1a PE=3 SV=1 Length=4416 Score = 310 bits (795), Expect = 2e-93, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 200/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM FP+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3280 SGIVKMVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCR 3339 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F V +G + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3340 VISSDFCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3399 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3400 KSQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3459 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3460 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3519 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3520 SIKADLV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQL 3576 Query 301 SGVTFQ 306 +GV Q Sbjct 3577 AGVKLQ 3582
> sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus
(strain 2) OX=76344 GN=rep PE=3 SV=1 Length=7124 Score = 310 bits (794), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 200/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM FP+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3280 SGIVKMVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCR 3339 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F V +G + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3340 VISSDFCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3399 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3400 KSQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3459 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3460 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3519 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3520 SIKADLV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQL 3576 Query 301 SGVTFQ 306 +GV Q Sbjct 3577 AGVKLQ 3582
> sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus
HKU4 OX=694007 GN=1a PE=1 SV=1 Length=4434 Score = 308 bits (790), Expect = 8e-93, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3292 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3351 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3352 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3411 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3412 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 3471 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3472 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3531 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3532 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 3587 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3588 NMQVMGVVMQ 3597
> sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus
133/2005 OX=389230 GN=1a PE=3 SV=1 Length=4441 Score = 308 bits (788), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3299 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3358 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3359 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3418 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3419 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMHQMELSNGTHTGSSF 3478 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3479 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3538 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3539 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 3594 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3595 NMQVMGVVMQ 3604
> sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus
HKU4 OX=694007 GN=rep PE=1 SV=1 Length=7119 Score = 308 bits (788), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3292 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3351 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3352 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3411 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3412 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 3471 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3472 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3531 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3532 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 3587 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3588 NMQVMGVVMQ 3597
> sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavirus
(strain JHM) OX=11144 GN=1a PE=1 SV=1 Length=4474 Score = 307 bits (786), Expect = 3e-92, Method: Compositional matrix adjust. Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3337 SGIVKMVSPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3396 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3397 VTSSDFCVMSDRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3456 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3457 RPQGAFHVVMRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3516 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3517 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3576 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3577 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDELTPSDVYQQL 3633 Query 301 SGVTFQ 306 +GV Q Sbjct 3634 AGVKLQ 3639
> sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus
133/2005 OX=389230 GN=rep PE=3 SV=1 Length=7126 Score = 307 bits (786), Expect = 4e-92, Method: Compositional matrix adjust. Identities = 154/310 (50%), Positives = 205/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3299 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3358 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3359 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3418 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3419 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMHQMELSNGTHTGSSF 3478 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3479 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3538 Query 238 NY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + E + +D+ L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3539 QFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV 3594 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3595 NMQVMGVVMQ 3604
> sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus
(strain JHM) OX=11144 GN=rep PE=1 SV=1 Length=7180 Score = 306 bits (785), Expect = 5e-92, Method: Compositional matrix adjust. Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3337 SGIVKMVSPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3396 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3397 VTSSDFCVMSDRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3456 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3457 RPQGAFHVVMRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3516 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3517 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3576 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3577 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDELTPSDVYQQL 3633 Query 301 SGVTFQ 306 +GV Q Sbjct 3634 AGVKLQ 3639
> sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavirus
(strain A59) OX=11142 GN=1a PE=1 SV=1 Length=4468 Score = 305 bits (782), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 199/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3334 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3393 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3394 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3453 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3454 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3513 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 3514 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 3573 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3574 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQL 3629 Query 301 SGVTFQ 306 +GV Q Sbjct 3630 AGVKLQ 3635
> sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus
(strain A59) OX=11142 GN=rep PE=1 SV=1 Length=7176 Score = 305 bits (781), Expect = 2e-91, Method: Compositional matrix adjust. Identities = 155/306 (51%), Positives = 199/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3334 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3393 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3394 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3453 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3454 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3513 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 3514 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 3573 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3574 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQL 3629 Query 301 SGVTFQ 306 +GV Q Sbjct 3630 AGVKLQ 3635
> sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavirus
OC43 OX=31631 GN=1a PE=3 SV=1 Length=4383 Score = 304 bits (778), Expect = 3e-91, Method: Compositional matrix adjust. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + M+ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN LAWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavirus
(strain Quebec) OX=11133 GN=1a PE=3 SV=1 Length=4383 Score = 304 bits (778), Expect = 4e-91, Method: Compositional matrix adjust. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus
(strain Quebec) OX=11133 GN=rep PE=3 SV=1 Length=7059 Score = 303 bits (777), Expect = 5e-91, Method: Compositional matrix adjust. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavirus
(strain 98TXSF-110-ENT) OX=233262 GN=1a PE=3 SV=1 Length=4383 Score = 303 bits (777), Expect = 6e-91, Method: Compositional matrix adjust. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavirus
(strain 98TXSF-110-LUN) OX=233264 GN=1a PE=3 SV=1 Length=4383 Score = 303 bits (776), Expect = 6e-91, Method: Compositional matrix adjust. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus
OC43 OX=31631 GN=rep PE=3 SV=1 Length=7095 Score = 303 bits (777), Expect = 7e-91, Method: Compositional matrix adjust. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + M+ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN LAWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1 Length=7094 Score = 303 bits (775), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1 Length=7094 Score = 303 bits (775), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N5) OX=443241 GN=1a PE=3 SV=1 Length=4421 Score = 302 bits (774), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3285 SGIVKMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3344 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3345 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3404 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3405 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGN 3464 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3465 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3524 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3525 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3581 Query 301 SGVTFQ 306 +GV Q Sbjct 3582 AGVKLQ 3587
> sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N1) OX=443239 GN=1a PE=1 SV=1 Length=4471 Score = 302 bits (774), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3335 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 3394 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3395 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 3454 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3455 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3514 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 3515 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 3574 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3575 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3631 Query 301 SGVTFQ 306 +GV Q Sbjct 3632 AGVKLQ 3637
> sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N2) OX=443240 GN=1a PE=3 SV=1 Length=4441 Score = 302 bits (773), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3305 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3364 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3365 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3424 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3425 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3484 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3485 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3544 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3545 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3601 Query 301 SGVTFQ 306 +GV Q Sbjct 3602 AGVKLQ 3607
> sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1 Length=7132 Score = 302 bits (773), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3285 SGIVKMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3344 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3345 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3404 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3405 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGN 3464 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3465 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3524 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3525 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3581 Query 301 SGVTFQ 306 +GV Q Sbjct 3582 AGVKLQ 3587
> sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1 Length=7182 Score = 302 bits (773), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3335 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 3394 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3395 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 3454 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3455 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3514 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 3515 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 3574 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3575 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3631 Query 301 SGVTFQ 306 +GV Q Sbjct 3632 AGVKLQ 3637
> sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1 Length=7152 Score = 301 bits (772), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3305 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3364 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3365 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3424 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3425 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3484 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3485 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3544 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3545 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3601 Query 301 SGVTFQ 306 +GV Q Sbjct 3602 AGVKLQ 3607
> sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavirus
(strain Mebus) OX=11132 GN=1a PE=3 SV=1 Length=4383 Score = 298 bits (762), Expect = 5e-89, Method: Compositional matrix adjust. Identities = 146/306 (48%), Positives = 196/306 (64%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSV + I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus
(strain Mebus) OX=11132 GN=rep PE=3 SV=1 Length=7094 Score = 297 bits (761), Expect = 8e-89, Method: Compositional matrix adjust. Identities = 146/306 (48%), Positives = 196/306 (64%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSV + I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus
512/2005 OX=693999 GN=1a PE=3 SV=1 Length=4128 Score = 274 bits (700), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 140/307 (46%), Positives = 205/307 (67%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VEGC+V+V+ G TLNGLWL D V CPRHVI + + ++++ ++ L+ Sbjct 3013 AGLRKMAQPSGIVEGCIVRVSYGNLTLNGLWLGDTVICPRHVIASNTTNVIDYDHAMSLV 3072 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GN+ L VI SM+ +L +KV+ +N TP Y + ++PG +F++LACY+ Sbjct 3073 RL--HNFSISSGNMFLGVISASMRGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYD 3130 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 GS +GVY MR N+TI+GSF++G+CGS G+NI+ V FCYMHH+EL +G H G+D++G Sbjct 3131 GSAAGVYGVNMRTNYTIRGSFISGACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDG 3190 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G +T NV +WLY A+INGDRW+L+ + ++ +N A++ Sbjct 3191 TMYGKYEDQPTLQIEGASNLVTENVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGM 3250 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 L +VD L A+TG+ V + AS+++L N G++ILG L DEFT +VV+Q Sbjct 3251 TAL--KNVDCFSLLVAKTGVDVGRLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQ 3307 Query 300 CSGVTFQ 306 GVT Q Sbjct 3308 MYGVTLQ 3314
> sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus
512/2005 OX=693999 GN=rep PE=3 SV=1 Length=6793 Score = 273 bits (699), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 140/307 (46%), Positives = 205/307 (67%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VEGC+V+V+ G TLNGLWL D V CPRHVI + + ++++ ++ L+ Sbjct 3013 AGLRKMAQPSGIVEGCIVRVSYGNLTLNGLWLGDTVICPRHVIASNTTNVIDYDHAMSLV 3072 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GN+ L VI SM+ +L +KV+ +N TP Y + ++PG +F++LACY+ Sbjct 3073 RL--HNFSISSGNMFLGVISASMRGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYD 3130 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 GS +GVY MR N+TI+GSF++G+CGS G+NI+ V FCYMHH+EL +G H G+D++G Sbjct 3131 GSAAGVYGVNMRTNYTIRGSFISGACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDG 3190 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G +T NV +WLY A+INGDRW+L+ + ++ +N A++ Sbjct 3191 TMYGKYEDQPTLQIEGASNLVTENVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGM 3250 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 L +VD L A+TG+ V + AS+++L N G++ILG L DEFT +VV+Q Sbjct 3251 TAL--KNVDCFSLLVAKTGVDVGRLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQ 3307 Query 300 CSGVTFQ 306 GVT Q Sbjct 3308 MYGVTLQ 3314
> sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemic
diarrhea virus (strain CV777) OX=229032 GN=1a PE=1 SV=1 Length=4117 Score = 264 bits (675), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 138/307 (45%), Positives = 198/307 (64%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++ Sbjct 2998 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVL 3057 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 3058 RL--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 3115 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 3116 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 3175 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 3176 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 3235 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 3236 T--TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQ 3292 Query 300 CSGVTFQ 306 GV Q Sbjct 3293 MYGVNLQ 3299
> sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1 Length=6781 Score = 263 bits (672), Expect = 5e-77, Method: Compositional matrix adjust. Identities = 138/307 (45%), Positives = 198/307 (64%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S ++ +Y ++ Sbjct 2998 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVL 3057 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+ Sbjct 3058 RL--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYD 3115 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 3116 GAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDG 3175 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 3176 VMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGM 3235 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 T + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 3236 T--TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQ 3292 Query 300 CSGVTFQ 306 GV Q Sbjct 3293 MYGVNLQ 3299
> sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2 Length=6709 Score = 254 bits (648), Expect = 8e-74, Method: Compositional matrix adjust. Identities = 135/306 (44%), Positives = 183/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 2904 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 2962 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 2963 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 3022 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 3023 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 3082 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 3083 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 3142 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 3143 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3199 Query 301 SGVTFQ 306 GV Q Sbjct 3200 YGVNLQ 3205
> sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmissible
gastroenteritis coronavirus (strain Purdue) OX=11151 GN=1a PE=1 SV=1 Length=4017 Score = 254 bits (648), Expect = 9e-74, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 185/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI S+ NYE+ + Sbjct 2879 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVI-ASDTTRVINYENEMSS 2937 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 2938 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 2997 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 2998 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 3057 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 3058 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 3117 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 3118 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3174 Query 301 SGVTFQ 306 GV Q Sbjct 3175 YGVNLQ 3180
> sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible
gastroenteritis coronavirus (strain Purdue) OX=11151 GN=rep PE=1 SV=1 Length=6684 Score = 253 bits (647), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 137/306 (45%), Positives = 185/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI S+ NYE+ + Sbjct 2879 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVI-ASDTTRVINYENEMSS 2937 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 2938 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 2997 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 2998 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 3057 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 3058 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 3117 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 3118 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3174 Query 301 SGVTFQ 306 GV Q Sbjct 3175 YGVNLQ 3180
> sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavirus
NL63 OX=277944 GN=1a PE=1 SV=1 Length=4060 Score = 250 bits (639), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 136/307 (44%), Positives = 192/307 (63%), Gaps = 5/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 2940 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 2998 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 2999 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 3058 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 3059 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 3118 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 3119 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 3178 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 3179 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 3235 Query 300 CSGVTFQ 306 GV Q Sbjct 3236 MYGVNLQ 3242
> sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus
NL63 OX=277944 GN=rep PE=1 SV=1 Length=6729 Score = 250 bits (639), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 136/307 (44%), Positives = 192/307 (63%), Gaps = 5/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 2940 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 2998 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 2999 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 3058 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ D V FCY+H +EL +G H G+D G Sbjct 3059 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 3118 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 3119 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 3178 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 3179 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 3235 Query 300 CSGVTFQ 306 GV Q Sbjct 3236 MYGVNLQ 3242
> sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavirus
229E OX=11137 GN=1a PE=1 SV=1 Length=4085 Score = 239 bits (611), Expect = 7e-69, Method: Compositional matrix adjust. Identities = 126/307 (41%), Positives = 188/307 (61%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 2966 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 3025 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 3026 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 3083 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 3084 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 3143 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 3144 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 3203 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 3204 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 3260 Query 300 CSGVTFQ 306 GV Q Sbjct 3261 MFGVNLQ 3267
> sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus
229E OX=11137 GN=rep PE=1 SV=1 Length=6758 Score = 238 bits (608), Expect = 2e-68, Method: Compositional matrix adjust. Identities = 126/307 (41%), Positives = 188/307 (61%), Gaps = 6/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI + + ++ ++E ++ Sbjct 2966 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIM 3025 Query 60 RKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 R HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+ Sbjct 3026 RL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYD 3083 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 3084 GCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDG 3143 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 3144 VMYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGF 3203 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 + + D L+A+TG+ V + ++ ++L NG G+ ILG + L DEF+ +VV+Q Sbjct 3204 TAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ 3260 Query 300 CSGVTFQ 306 GV Q Sbjct 3261 MFGVNLQ 3267
> sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain Beaudette CK) OX=160235 GN=1a PE=3 SV=1 Length=3951 Score = 228 bits (581), Expect = 7e-65, Method: Compositional matrix adjust. Identities = 131/317 (41%), Positives = 179/317 (56%), Gaps = 21/317 (7%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ S D N D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLN 2835 Query 60 RKSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACY 118 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2836 LANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAY 2895 Query 119 NGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLE 178 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL Sbjct 2896 GGTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLM 2955 Query 179 GNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFN 231 G FYG +VD + AQ D +T N++AWLYAA+I+ +W L T +++D+N Sbjct 2956 GEFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYN 3014 Query 232 LVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLED 289 A + P + + LSA TG+ D+C L+ ++ + G ILG ED Sbjct 3015 KWAGDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFED 3069 Query 290 EFTPFDVVRQCSGVTFQ 306 E TP V Q GV Q Sbjct 3070 ELTPESVFNQIGGVRLQ 3086
> sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain Beaudette) OX=11122 GN=1a PE=1 SV=1 Length=3951 Score = 228 bits (581), Expect = 7e-65, Method: Compositional matrix adjust. Identities = 131/317 (41%), Positives = 179/317 (56%), Gaps = 21/317 (7%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ S D N D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLN 2835 Query 60 RKSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACY 118 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2836 LANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAY 2895 Query 119 NGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLE 178 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL Sbjct 2896 GGTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLM 2955 Query 179 GNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFN 231 G FYG +VD + AQ D +T N++AWLYAA+I+ +W L T +++D+N Sbjct 2956 GEFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYN 3014 Query 232 LVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLED 289 A + P + + LSA TG+ D+C L+ ++ + G ILG ED Sbjct 3015 KWAGDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFED 3069 Query 290 EFTPFDVVRQCSGVTFQ 306 E TP V Q GV Q Sbjct 3070 ELTPESVFNQIGGVRLQ 3086
> sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep PE=3 SV=1 Length=6629 Score = 227 bits (579), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 131/317 (41%), Positives = 179/317 (56%), Gaps = 21/317 (7%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ S D N D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLN 2835 Query 60 RKSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACY 118 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2836 LANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAY 2895 Query 119 NGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLE 178 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL Sbjct 2896 GGTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLM 2955 Query 179 GNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFN 231 G FYG +VD + AQ D +T N++AWLYAA+I+ +W L T +++D+N Sbjct 2956 GEFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYN 3014 Query 232 LVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLED 289 A + P + + LSA TG+ D+C L+ ++ + G ILG ED Sbjct 3015 KWAGDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFED 3069 Query 290 EFTPFDVVRQCSGVTFQ 306 E TP V Q GV Q Sbjct 3070 ELTPESVFNQIGGVRLQ 3086
> sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 SV=1 Length=6629 Score = 227 bits (579), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 131/317 (41%), Positives = 179/317 (56%), Gaps = 21/317 (7%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLI 59 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ S D N D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLN 2835 Query 60 RKSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACY 118 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2836 LANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAY 2895 Query 119 NGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLE 178 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL Sbjct 2896 GGTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLM 2955 Query 179 GNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFN 231 G FYG +VD + AQ D +T N++AWLYAA+I+ +W L T +++D+N Sbjct 2956 GEFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYN 3014 Query 232 LVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLED 289 A + P + + LSA TG+ D+C L+ ++ + G ILG ED Sbjct 3015 KWAGDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFED 3069 Query 290 EFTPFDVVRQCSGVTFQ 306 E TP V Q GV Q Sbjct 3070 ELTPESVFNQIGGVRLQ 3086
> sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain M41) OX=11127 GN=1a PE=1 SV=1 Length=3953 Score = 225 bits (574), Expect = 5e-64, Method: Compositional matrix adjust. Identities = 128/316 (41%), Positives = 175/316 (55%), Gaps = 19/316 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +GF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2782 AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL 2838 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 2839 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 2898 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2899 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2958 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I+ +W L T ++ D+N Sbjct 2959 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNR 3017 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ + ILG EDE Sbjct 3018 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 3072 Query 291 FTPFDVVRQCSGVTFQ 306 TP V Q GV Q Sbjct 3073 LTPESVFNQVGGVRLQ 3088
> sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1 Length=6631 Score = 224 bits (572), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 128/316 (41%), Positives = 174/316 (55%), Gaps = 19/316 (6%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +GF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2782 AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL 2838 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 2839 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 2898 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2899 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2958 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVI-------NGDRWFLNRFTTTLNDFNL 232 FYG +VD + AQ D +T N++AWLYAA+I + +W L T ++ D+N Sbjct 2959 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNR 3017 Query 233 VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN--GRTILGSALLEDE 290 A + P + + LSA TG+ D+C L+ ++ ILG EDE Sbjct 3018 WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE 3072 Query 291 FTPFDVVRQCSGVTFQ 306 TP V Q GV Q Sbjct 3073 LTPESVFNQVGGVRLQ 3088
> sp|Q6AE15|HIS4_LEIXX 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
imidazole-4-carboxamide isomerase OS=Leifsonia xyli subsp. xyli (strain CTCB07) OX=281090 GN=hisA PE=3 SV=1 Length=248 Score = 33.1 bits (74), Expect = 2.6, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 1/41 (2%) Query 252 PLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFT 292 P+ A GIA LD A+L+EL+ G+ G I+G AL FT Sbjct 199 PVVASGGIASLDDIAALRELVSLGVEG-AIVGKALYSGAFT 238 Lambda K H a alpha 0.323 0.138 0.433 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 25877591208 Results from round 2 Query= YP_009725301.1 3C-like proteinase [Severe acute respiratory syndrome coronavirus 2] Length=306 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir... 485 3e-154 sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus... 485 3e-154 sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ... 485 5e-154 sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute re... 484 7e-154 sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co... 484 1e-153 sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coro... 483 2e-153 sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir... 482 5e-153 sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus... 481 8e-153 sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir... 480 2e-152 sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus... 480 2e-152 sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav... 470 5e-149 sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona... 470 7e-149 sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavir... 470 8e-149 sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavi... 469 1e-148 sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavi... 469 2e-148 sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav... 469 2e-148 sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavi... 469 2e-148 sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavir... 469 2e-148 sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona... 469 2e-148 sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona... 469 2e-148 sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavir... 467 4e-148 sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav... 468 5e-148 sp|K9N638|R1A_MERS1 Replicase polyprotein 1a OS=Middle East res... 465 2e-147 sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East r... 465 3e-147 sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona... 465 4e-147 sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavi... 464 7e-147 sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav... 464 8e-147 sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavir... 464 8e-147 sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir... 464 1e-146 sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir... 464 1e-146 sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav... 464 1e-146 sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav... 464 1e-146 sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavir... 463 1e-146 sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus... 463 1e-146 sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavir... 463 1e-146 sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir... 463 2e-146 sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus... 463 2e-146 sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav... 463 2e-146 sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavir... 462 2e-146 sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus... 462 3e-146 sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide... 456 5e-144 sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemi... 455 6e-144 sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus... 455 7e-144 sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus... 455 9e-144 sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir... 455 1e-143 sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmi... 454 2e-143 sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir... 455 2e-143 sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans... 454 2e-143 sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav... 452 9e-143 sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavir... 448 3e-141 sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav... 447 6e-141 sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav... 443 2e-139 sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavir... 442 2e-139 sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectiou... 398 5e-124 sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious... 398 5e-124 sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti... 397 2e-123 sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio... 396 2e-123 sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious... 393 3e-122 sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio... 392 1e-121 Sequences not found previously or not previously below threshold:
> sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus
279/2005 OX=389167 GN=rep PE=3 SV=1 Length=7079 Score = 485 bits (1250), Expect = 3e-154, Method: Composition-based stats. Identities = 294/306 (96%), Positives = 303/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3247 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3307 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN+TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3367 SPSGVYQCAMRPNYTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3427 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3487 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3546 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3547 SGVTFQ 3552
> sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus
279/2005 OX=389167 GN=1a PE=3 SV=1 Length=4388 Score = 485 bits (1249), Expect = 3e-154, Method: Composition-based stats. Identities = 294/306 (96%), Positives = 303/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3247 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3307 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN+TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3367 SPSGVYQCAMRPNYTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3427 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3487 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3546 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3547 SGVTFQ 3552
> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 SV=1 Length=7096 Score = 485 bits (1249), Expect = 5e-154, Method: Composition-based stats. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3564 SGVTFQ 3569
> sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1 Length=4405 Score = 484 bits (1247), Expect = 7e-154, Method: Composition-based stats. Identities = 306/306 (100%), Positives = 306/306 (100%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR Sbjct 3264 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 3323 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3324 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 3383 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN Sbjct 3384 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 3443 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3444 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3503 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC Sbjct 3504 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 3563 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3564 SGVTFQ 3569
> sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS
coronavirus OX=694009 GN=rep PE=1 SV=1 Length=7073 Score = 484 bits (1245), Expect = 1e-153, Method: Composition-based stats. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3241 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3300 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3301 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3360 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3361 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3420 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3421 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3480 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3481 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3540 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3541 SGVTFQ 3546
> sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coronavirus
OX=694009 GN=1a PE=1 SV=1 Length=4382 Score = 483 bits (1243), Expect = 2e-153, Method: Composition-based stats. Identities = 294/306 (96%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3241 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3300 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3301 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3360 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3361 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3420 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3421 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3480 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3481 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3540 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3541 SGVTFQ 3546
> sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus
HKU3 OX=442736 GN=rep PE=3 SV=1 Length=7067 Score = 482 bits (1241), Expect = 5e-153, Method: Composition-based stats. Identities = 292/306 (95%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHV+CT+EDMLNPNY+DLLIR Sbjct 3235 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVVCTAEDMLNPNYDDLLIR 3294 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3295 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3354 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3355 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3414 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3415 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3474 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3475 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3534 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3535 SGVTFQ 3540
> sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus
HKU3 OX=442736 GN=1a PE=3 SV=1 Length=4376 Score = 481 bits (1238), Expect = 8e-153, Method: Composition-based stats. Identities = 292/306 (95%), Positives = 302/306 (99%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHV+CT+EDMLNPNY+DLLIR Sbjct 3235 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVVCTAEDMLNPNYDDLLIR 3294 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3295 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3354 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG Sbjct 3355 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK 3414 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3415 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3474 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3475 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3534 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3535 SGVTFQ 3540
> sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus
Rp3/2004 OX=349344 GN=rep PE=3 SV=1 Length=7071 Score = 480 bits (1237), Expect = 2e-152, Method: Composition-based stats. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3239 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3298 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3299 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3358 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPT VHAGTDLEG Sbjct 3359 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTEVHAGTDLEGK 3418 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3419 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3478 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3479 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3538 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3539 SGVTFQ 3544
> sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus
Rp3/2004 OX=349344 GN=1a PE=3 SV=1 Length=4380 Score = 480 bits (1236), Expect = 2e-152, Method: Composition-based stats. Identities = 293/306 (96%), Positives = 301/306 (98%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIR Sbjct 3239 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR 3298 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 KSNH+FLVQAGNVQLRVIGHSMQNC+L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNG Sbjct 3299 KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG 3358 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 SPSGVYQCAMRPN TIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPT VHAGTDLEG Sbjct 3359 SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTEVHAGTDLEGK 3418 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE Sbjct 3419 FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 3478 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 PLTQDHVDILGPLSAQTGIAVLDMCA+LKELLQNGMNGRTILGS +LEDEFTPFDVVRQC Sbjct 3479 PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC 3538 Query 301 SGVTFQ 306 SGVTFQ Sbjct 3539 SGVTFQ 3544
> sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus
(strain 2) OX=76344 GN=rep PE=3 SV=1 Length=7124 Score = 470 bits (1211), Expect = 5e-149, Method: Composition-based stats. Identities = 155/306 (51%), Positives = 200/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM FP+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3280 SGIVKMVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCR 3339 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F V +G + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3340 VISSDFCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3399 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3400 KSQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3459 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3460 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3519 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3520 SIKADLV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQL 3576 Query 301 SGVTFQ 306 +GV Q Sbjct 3577 AGVKLQ 3582
> sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus
(strain JHM) OX=11144 GN=rep PE=1 SV=1 Length=7180 Score = 470 bits (1210), Expect = 7e-149, Method: Composition-based stats. Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3337 SGIVKMVSPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3396 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3397 VTSSDFCVMSDRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3456 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3457 RPQGAFHVVMRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3516 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3517 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3576 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3577 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDELTPSDVYQQL 3633 Query 301 SGVTFQ 306 +GV Q Sbjct 3634 AGVKLQ 3639
> sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavirus
(strain 2) OX=76344 GN=1a PE=3 SV=1 Length=4416 Score = 470 bits (1209), Expect = 8e-149, Method: Composition-based stats. Identities = 155/306 (51%), Positives = 200/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM FP+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3280 SGIVKMVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCR 3339 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F V +G + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3340 VISSDFCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3399 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3400 KSQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3459 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3460 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3519 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3520 SIKADLV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQL 3576 Query 301 SGVTFQ 306 +GV Q Sbjct 3577 AGVKLQ 3582
> sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavirus
(strain JHM) OX=11144 GN=1a PE=1 SV=1 Length=4474 Score = 469 bits (1208), Expect = 1e-148, Method: Composition-based stats. Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3337 SGIVKMVSPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3396 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + + L V+ + MQ +L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3397 VTSSDFCVMSDRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3456 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3457 RPQGAFHVVMRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3516 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA++N WF+ + +L +FN+ AM + Sbjct 3517 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFS 3576 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3577 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDELTPSDVYQQL 3633 Query 301 SGVTFQ 306 +GV Q Sbjct 3634 AGVKLQ 3639
> sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavirus
(strain 98TXSF-110-ENT) OX=233262 GN=1a PE=3 SV=1 Length=4383 Score = 469 bits (1206), Expect = 2e-148, Method: Composition-based stats. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus
(strain Quebec) OX=11133 GN=rep PE=3 SV=1 Length=7059 Score = 469 bits (1207), Expect = 2e-148, Method: Composition-based stats. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavirus
(strain 98TXSF-110-LUN) OX=233264 GN=1a PE=3 SV=1 Length=4383 Score = 469 bits (1206), Expect = 2e-148, Method: Composition-based stats. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavirus
(strain Quebec) OX=11133 GN=1a PE=3 SV=1 Length=4383 Score = 469 bits (1206), Expect = 2e-148, Method: Composition-based stats. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1 Length=7094 Score = 469 bits (1207), Expect = 2e-148, Method: Composition-based stats. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1 Length=7094 Score = 469 bits (1207), Expect = 2e-148, Method: Composition-based stats. Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavirus
OC43 OX=31631 GN=1a PE=3 SV=1 Length=4383 Score = 467 bits (1203), Expect = 4e-148, Method: Composition-based stats. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + M+ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN LAWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus
OC43 OX=31631 GN=rep PE=3 SV=1 Length=7095 Score = 468 bits (1204), Expect = 5e-148, Method: Composition-based stats. Identities = 148/306 (48%), Positives = 198/306 (65%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + M+ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN LAWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|K9N638|R1A_MERS1 Replicase polyprotein 1a OS=Middle East respiratory
syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=1a PE=1 SV=1 Length=4391 Score = 465 bits (1198), Expect = 2e-147, Method: Composition-based stats. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 3248 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 3307 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 3308 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 3367 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 3368 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 3427 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 3428 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 3487 Query 238 NYE-PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 3488 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 3543 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3544 NMQIMGVVMQ 3553
> sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=rep PE=1 SV=1 Length=7078 Score = 465 bits (1198), Expect = 3e-147, Method: Composition-based stats. Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LLI Sbjct 3248 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLIS 3307 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 +NH+F VQ LRV+GH+MQ +LKL VD ANP TP Y F ++PG FSVLAC Sbjct 3308 MTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLAC 3367 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+G + MRPN+TIKGSFL GSCGSVG+ + ++FCYMH MEL G H G+ Sbjct 3368 YNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAF 3427 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F+D+Q Q TD +VNV+AWLYAA++NG WF+ T++ FN A+ Sbjct 3428 DGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALAN 3487 Query 238 NYE-PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + + VD+ L+ +TG+A+ + ++++L G G+ ILGS +LEDEFTP DV Sbjct 3488 QFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV 3543 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3544 NMQIMGVVMQ 3553
> sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus
(strain A59) OX=11142 GN=rep PE=1 SV=1 Length=7176 Score = 465 bits (1197), Expect = 4e-147, Method: Composition-based stats. Identities = 155/306 (51%), Positives = 199/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3334 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3393 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3394 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3453 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3454 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3513 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 3514 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 3573 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3574 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQL 3629 Query 301 SGVTFQ 306 +GV Q Sbjct 3630 AGVKLQ 3635
> sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavirus
(strain A59) OX=11142 GN=1a PE=1 SV=1 Length=4468 Score = 464 bits (1194), Expect = 7e-147, Method: Composition-based stats. Identities = 155/306 (51%), Positives = 199/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R Sbjct 3334 SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYPNLLCR 3393 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3394 VTSSDFCVMSGRMSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNG 3453 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + +R + TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3454 RPQGAFHVTLRSSHTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN 3513 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D T TVNV+AWLYAA+ N WF+ + +L +FN+ AM + Sbjct 3514 FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFS 3573 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+ V + A++K L +G G+ ILGS +LEDE TP DV +Q Sbjct 3574 SIKADLV--LDALASMTGVTVEQVLAAIKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQL 3629 Query 301 SGVTFQ 306 +GV Q Sbjct 3630 AGVKLQ 3635
> sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus
(strain Mebus) OX=11132 GN=rep PE=3 SV=1 Length=7094 Score = 464 bits (1195), Expect = 8e-147, Method: Composition-based stats. Identities = 146/306 (48%), Positives = 196/306 (64%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSV + I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavirus
(strain Mebus) OX=11132 GN=1a PE=3 SV=1 Length=4383 Score = 464 bits (1194), Expect = 8e-147, Method: Composition-based stats. Identities = 146/306 (48%), Positives = 196/306 (64%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ KVE C+V VT G TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R Sbjct 3247 SGIVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCR 3306 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 ++ +F V + L V+ + MQ C+L L V N +TPKY F ++PG+TF+VLA YNG Sbjct 3307 VTSSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNG 3366 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSV + I DCV F YMH +EL TG H GTD G+ Sbjct 3367 KPQGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGD 3426 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D +VN +AWLYAA++N WF+ ++ DFN+ A+ + Sbjct 3427 FYGPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFS 3486 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V + L++ TG+++ + A++K L+NG GR I+GS EDE TP DV +Q Sbjct 3487 QVKSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQL 3543 Query 301 SGVTFQ 306 +G+ Q Sbjct 3544 AGIKLQ 3549
> sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus
HKU4 OX=694007 GN=rep PE=1 SV=1 Length=7119 Score = 464 bits (1194), Expect = 1e-146, Method: Composition-based stats. Identities = 152/309 (49%), Positives = 201/309 (65%), Gaps = 6/309 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3292 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3351 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3352 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3411 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3412 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 3471 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3472 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3531 Query 238 NYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 + + L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3532 QFTEFVG--TQSIDMLAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDVN 3588 Query 298 RQCSGVTFQ 306 Q GV Q Sbjct 3589 MQVMGVVMQ 3597
> sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus
HKU5 OX=694008 GN=rep PE=3 SV=1 Length=7182 Score = 464 bits (1194), Expect = 1e-146, Method: Composition-based stats. Identities = 154/310 (50%), Positives = 207/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KMA PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ Sbjct 3339 SGLVKMAAPSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVS 3398 Query 61 KSNHNFLVQAG---NVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+N +F+VQ LRV+GH+M +LKL V++ANP+TP Y F ++PG +FSVLAC Sbjct 3399 KTNLSFIVQKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLAC 3458 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ MR N TIKGSFL GSCGSVG+ + + ++FCYMH MEL G H G Sbjct 3459 YNGRPTGVFMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAF 3518 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F DRQ Q +D T+N++AWLYAA++NG WF+ T + FN AM Sbjct 3519 DGVMYGAFEDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSN 3578 Query 238 NYE-PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + + VD+ L+ +TG++V + +++ L G G+TILG+++LEDEFTP DV Sbjct 3579 QFTEFIGTQSVDM---LAHKTGVSVEQLLYAIQT-LHKGFQGKTILGNSMLEDEFTPDDV 3634 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3635 NMQVMGVVMQ 3644
> sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1 Length=7152 Score = 464 bits (1194), Expect = 1e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3305 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3364 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3365 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3424 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3425 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3484 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3485 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3544 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3545 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3601 Query 301 SGVTFQ 306 +GV Q Sbjct 3602 AGVKLQ 3607
> sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1 Length=7132 Score = 464 bits (1194), Expect = 1e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3285 SGIVKMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3344 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3345 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3404 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3405 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGN 3464 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3465 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3524 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3525 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3581 Query 301 SGVTFQ 306 +GV Q Sbjct 3582 AGVKLQ 3587
> sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N2) OX=443240 GN=1a PE=3 SV=1 Length=4441 Score = 463 bits (1192), Expect = 1e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3305 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3364 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3365 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3424 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3425 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3484 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3485 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3544 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3545 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3601 Query 301 SGVTFQ 306 +GV Q Sbjct 3602 AGVKLQ 3607
> sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus
HKU4 OX=694007 GN=1a PE=1 SV=1 Length=4434 Score = 463 bits (1192), Expect = 1e-146, Method: Composition-based stats. Identities = 152/309 (49%), Positives = 201/309 (65%), Gaps = 6/309 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3292 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3351 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3352 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3411 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3412 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSF 3471 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3472 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3531 Query 238 NYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 + + L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3532 QFTEFVG--TQSIDMLAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDVN 3588 Query 298 RQCSGVTFQ 306 Q GV Q Sbjct 3589 MQVMGVVMQ 3597
> sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N5) OX=443241 GN=1a PE=3 SV=1 Length=4421 Score = 463 bits (1192), Expect = 1e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M P+Y LL R Sbjct 3285 SGIVKMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCR 3344 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3345 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNG 3404 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3405 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGN 3464 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ ++ DFN+ AM + Sbjct 3465 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFS 3524 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3525 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3581 Query 301 SGVTFQ 306 +GV Q Sbjct 3582 AGVKLQ 3587
> sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus
133/2005 OX=389230 GN=rep PE=3 SV=1 Length=7126 Score = 463 bits (1192), Expect = 2e-146, Method: Composition-based stats. Identities = 152/309 (49%), Positives = 201/309 (65%), Gaps = 6/309 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3299 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3358 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3359 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3418 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3419 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMHQMELSNGTHTGSSF 3478 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3479 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3538 Query 238 NYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 + + L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3539 QFTEFVG--TQSIDMLAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDVN 3595 Query 298 RQCSGVTFQ 306 Q GV Q Sbjct 3596 MQVMGVVMQ 3604
> sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus
HKU5 OX=694008 GN=1a PE=3 SV=1 Length=4481 Score = 463 bits (1191), Expect = 2e-146, Method: Composition-based stats. Identities = 154/310 (50%), Positives = 207/310 (67%), Gaps = 8/310 (3%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KMA PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ Sbjct 3339 SGLVKMAAPSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVS 3398 Query 61 KSNHNFLVQAG---NVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+N +F+VQ LRV+GH+M +LKL V++ANP+TP Y F ++PG +FSVLAC Sbjct 3399 KTNLSFIVQKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLAC 3458 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ MR N TIKGSFL GSCGSVG+ + + ++FCYMH MEL G H G Sbjct 3459 YNGRPTGVFMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAF 3518 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F DRQ Q +D T+N++AWLYAA++NG WF+ T + FN AM Sbjct 3519 DGVMYGAFEDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSN 3578 Query 238 NYE-PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV 296 + + VD+ L+ +TG++V + +++ L G G+TILG+++LEDEFTP DV Sbjct 3579 QFTEFIGTQSVDM---LAHKTGVSVEQLLYAIQT-LHKGFQGKTILGNSMLEDEFTPDDV 3634 Query 297 VRQCSGVTFQ 306 Q GV Q Sbjct 3635 NMQVMGVVMQ 3644
> sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1 Length=7182 Score = 463 bits (1192), Expect = 2e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3335 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 3394 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3395 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 3454 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3455 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3514 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 3515 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 3574 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3575 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3631 Query 301 SGVTFQ 306 +GV Q Sbjct 3632 AGVKLQ 3637
> sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus
HKU1 (isolate N1) OX=443239 GN=1a PE=1 SV=1 Length=4471 Score = 462 bits (1190), Expect = 2e-146, Method: Composition-based stats. Identities = 150/306 (49%), Positives = 193/306 (63%), Gaps = 3/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M P+Y LL R Sbjct 3335 SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCR 3394 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 + +F + +G + L V+ + MQ C L L V NP TPKY F ++PG+TF+VLA YNG Sbjct 3395 VTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNG 3454 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P G + MR ++TIKGSFL GSCGSVG+ + D V F YMH +EL TG H GTD GN Sbjct 3455 RPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGN 3514 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGP+ D Q Q D TVNV+AWLYAA++N WF+ + DFN+ AM + Sbjct 3515 FYGPYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFS 3574 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D V L L++ TG+++ + A++K L G GR ILGS EDE P DV +Q Sbjct 3575 QVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL 3631 Query 301 SGVTFQ 306 +GV Q Sbjct 3632 AGVKLQ 3637
> sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus
133/2005 OX=389230 GN=1a PE=3 SV=1 Length=4441 Score = 462 bits (1190), Expect = 3e-146, Method: Composition-based stats. Identities = 152/309 (49%), Positives = 201/309 (65%), Gaps = 6/309 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI Sbjct 3299 SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLIS 3358 Query 61 KSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLAC 117 K+NH+F+VQ LRV+ HSM +LKL VD ANP TP Y F ++PG +FSVLAC Sbjct 3359 KTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLAC 3418 Query 118 YNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL 177 YNG P+GV+ +R N TIKGSFL GSCGSVG+ + ++F YMH MEL G H G+ Sbjct 3419 YNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMHQMELSNGTHTGSSF 3478 Query 178 EGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKY 237 +G YG F D+QT Q TD T+NV+AWLYAAV+NG +WF+ + +N A+ Sbjct 3479 DGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSN 3538 Query 238 NYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVV 297 + + L+ +TG++V M A+++ L G G+TILG + LEDEFTP DV Sbjct 3539 QFTEFVG--TQSIDMLAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDVN 3595 Query 298 RQCSGVTFQ 306 Q GV Q Sbjct 3596 MQVMGVVMQ 3604
> sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1 Length=6781 Score = 456 bits (1174), Expect = 5e-144, Method: Composition-based stats. Identities = 137/306 (45%), Positives = 195/306 (64%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S +Y+ L Sbjct 2998 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTST-IDYDYALSV 3056 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 3057 LRLHNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 3116 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 3117 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 3176 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 3177 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 3236 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 3237 TVG--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 3293 Query 301 SGVTFQ 306 GV Q Sbjct 3294 YGVNLQ 3299
> sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemic
diarrhea virus (strain CV777) OX=229032 GN=1a PE=1 SV=1 Length=4117 Score = 455 bits (1172), Expect = 6e-144, Method: Composition-based stats. Identities = 137/306 (45%), Positives = 195/306 (64%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G LNGLWL D+V CPRHVI +S +Y+ L Sbjct 2998 AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTST-IDYDYALSV 3056 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GNV L V+ +M+ +L++KV+ N TPKY + ++PG++F++LACY+G Sbjct 3057 LRLHNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDG 3116 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 + +GVY MR N+TI+GSF+NG+CGS G+NI+ V FCY+H +EL +G H G+DL+G Sbjct 3117 AAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGV 3176 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G + T NVLA+LYAA+ING W+L+ ++ FN A+ Sbjct 3177 MYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT 3236 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + AS++ L +N G+ ILG L DEFT +VVRQ Sbjct 3237 TVG--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM 3293 Query 301 SGVTFQ 306 GV Q Sbjct 3294 YGVNLQ 3299
> sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus
HKU9 OX=694006 GN=1a PE=3 SV=1 Length=4248 Score = 455 bits (1172), Expect = 7e-144, Method: Composition-based stats. Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G +MA PSG VE C+V+V G+ TLNG+WLD+ V CPRHV+C+ +++ NP+Y L +R Sbjct 3104 AGLTRMAHPSGLVEPCLVKVNYGSMTLNGIWLDNFVICPRHVMCSRDELANPDYPRLSMR 3163 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 +N++F V +RVIGH+M+ +LKL VD NPKTP Y F+R+ GQ S+LACY+G Sbjct 3164 AANYDFHVSQNGHNIRVIGHTMEGSLLKLTVDVNNPKTPAYSFIRVSTGQAMSLLACYDG 3223 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P+GVY C +R N T++ SFL GSCGS GF ++ V FCY+H +ELP G H GTD G Sbjct 3224 LPTGVYTCTLRSNGTMRASFLCGSCGSPGFVMNGKEVQFCYLHQLELPNGTHTGTDFSGV 3283 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPF D+Q Q A D TITVNVLAWLYAAV++G+ WFL + + + +FN A+KY + Sbjct 3284 FYGPFEDKQVPQLAAPDCTITVNVLAWLYAAVLSGENWFLTKSSISPAEFNNCAVKYMCQ 3343 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 +T + + +L PL+A+TGI+V M ++LK LL G GRTI+GS LEDE TP+D+ RQ Sbjct 3344 SVTSESLQVLQPLAAKTGISVERMLSALKVLLSAGFCGRTIMGSCSLEDEHTPYDIGRQM 3403 Query 301 SGVTFQ 306 GV Q Sbjct 3404 LGVKLQ 3409
> sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus
512/2005 OX=693999 GN=1a PE=3 SV=1 Length=4128 Score = 455 bits (1171), Expect = 9e-144, Method: Composition-based stats. Identities = 139/306 (45%), Positives = 200/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VEGC+V+V+ G TLNGLWL D V CPRHVI ++ +Y+ + Sbjct 3013 AGLRKMAQPSGIVEGCIVRVSYGNLTLNGLWLGDTVICPRHVIASNTT-NVIDYDHAMSL 3071 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GN+ L VI SM+ +L +KV+ +N TP Y + ++PG +F++LACY+G Sbjct 3072 VRLHNFSISSGNMFLGVISASMRGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYDG 3131 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 S +GVY MR N+TI+GSF++G+CGS G+NI+ V FCYMHH+EL +G H G+D++G Sbjct 3132 SAAGVYGVNMRTNYTIRGSFISGACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDGT 3191 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G +T NV +WLY A+INGDRW+L+ + ++ +N A++ Sbjct 3192 MYGKYEDQPTLQIEGASNLVTENVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGMT 3251 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L +VD L A+TG+ V + AS+++L N G++ILG L DEFT +VV+Q Sbjct 3252 ALK--NVDCFSLLVAKTGVDVGRLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQM 3308 Query 301 SGVTFQ 306 GVT Q Sbjct 3309 YGVTLQ 3314
> sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus
HKU9 OX=694006 GN=rep PE=1 SV=1 Length=6930 Score = 455 bits (1172), Expect = 1e-143, Method: Composition-based stats. Identities = 159/306 (52%), Positives = 214/306 (70%), Gaps = 0/306 (0%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G +MA PSG VE C+V+V G+ TLNG+WLD+ V CPRHV+C+ +++ NP+Y L +R Sbjct 3104 AGLTRMAHPSGLVEPCLVKVNYGSMTLNGIWLDNFVICPRHVMCSRDELANPDYPRLSMR 3163 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 +N++F V +RVIGH+M+ +LKL VD NPKTP Y F+R+ GQ S+LACY+G Sbjct 3164 AANYDFHVSQNGHNIRVIGHTMEGSLLKLTVDVNNPKTPAYSFIRVSTGQAMSLLACYDG 3223 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P+GVY C +R N T++ SFL GSCGS GF ++ V FCY+H +ELP G H GTD G Sbjct 3224 LPTGVYTCTLRSNGTMRASFLCGSCGSPGFVMNGKEVQFCYLHQLELPNGTHTGTDFSGV 3283 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 FYGPF D+Q Q A D TITVNVLAWLYAAV++G+ WFL + + + +FN A+KY + Sbjct 3284 FYGPFEDKQVPQLAAPDCTITVNVLAWLYAAVLSGENWFLTKSSISPAEFNNCAVKYMCQ 3343 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 +T + + +L PL+A+TGI+V M ++LK LL G GRTI+GS LEDE TP+D+ RQ Sbjct 3344 SVTSESLQVLQPLAAKTGISVERMLSALKVLLSAGFCGRTIMGSCSLEDEHTPYDIGRQM 3403 Query 301 SGVTFQ 306 GV Q Sbjct 3404 LGVKLQ 3409
> sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmissible
gastroenteritis coronavirus (strain Purdue) OX=11151 GN=1a PE=1 SV=1 Length=4017 Score = 454 bits (1169), Expect = 2e-143, Method: Composition-based stats. Identities = 136/306 (44%), Positives = 185/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 2879 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 2937 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 2938 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 2997 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 2998 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 3057 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 3058 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 3117 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 3118 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3174 Query 301 SGVTFQ 306 GV Q Sbjct 3175 YGVNLQ 3180
> sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus
512/2005 OX=693999 GN=rep PE=3 SV=1 Length=6793 Score = 455 bits (1170), Expect = 2e-143, Method: Composition-based stats. Identities = 139/306 (45%), Positives = 200/306 (65%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VEGC+V+V+ G TLNGLWL D V CPRHVI ++ +Y+ + Sbjct 3013 AGLRKMAQPSGIVEGCIVRVSYGNLTLNGLWLGDTVICPRHVIASNTT-NVIDYDHAMSL 3071 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +GN+ L VI SM+ +L +KV+ +N TP Y + ++PG +F++LACY+G Sbjct 3072 VRLHNFSISSGNMFLGVISASMRGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYDG 3131 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 S +GVY MR N+TI+GSF++G+CGS G+NI+ V FCYMHH+EL +G H G+D++G Sbjct 3132 SAAGVYGVNMRTNYTIRGSFISGACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDGT 3191 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ T Q G +T NV +WLY A+INGDRW+L+ + ++ +N A++ Sbjct 3192 MYGKYEDQPTLQIEGASNLVTENVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGMT 3251 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L +VD L A+TG+ V + AS+++L N G++ILG L DEFT +VV+Q Sbjct 3252 ALK--NVDCFSLLVAKTGVDVGRLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQM 3308 Query 301 SGVTFQ 306 GVT Q Sbjct 3309 YGVTLQ 3314
> sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible
gastroenteritis coronavirus (strain Purdue) OX=11151 GN=rep PE=1 SV=1 Length=6684 Score = 454 bits (1169), Expect = 2e-143, Method: Composition-based stats. Identities = 136/306 (44%), Positives = 185/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V+ G LNGLWL D V CPRHVI + + NYE+ + Sbjct 2879 SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSS 2937 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V NV L V+ + L LKV+ NP TP++KF I+ G++F++LACY G Sbjct 2938 VRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEG 2997 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++ EG Sbjct 2998 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGE 3057 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + +L +N A ++ Sbjct 3058 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFT 3117 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 L+ D L+A+TG +V + S+ L G GRTIL L DEFTP +V+RQ Sbjct 3118 ELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3174 Query 301 SGVTFQ 306 GV Q Sbjct 3175 YGVNLQ 3180
> sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2 Length=6709 Score = 452 bits (1164), Expect = 9e-143, Method: Composition-based stats. Identities = 135/306 (44%), Positives = 183/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG RKMA PSG VE C+V+V G LNGLWL D V CPRHVI + + NYE+ L Sbjct 2904 SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS 2962 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + N L V+ + L LKV+ NP TP++KF ++PG++F++LACY G Sbjct 2963 VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG 3022 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 P VY MR TIKGSF+ G+CGSVG+ ++ + F YMHH+EL G H G++LEG Sbjct 3023 CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE 3082 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG + D+ + Q GT+ + NV+A+LYAA+ING+RWF+ + TL +N A ++ Sbjct 3083 MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT 3142 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + D L+A+TG +V + + L G GRTIL L DEFTP +V+RQ Sbjct 3143 EIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM 3199 Query 301 SGVTFQ 306 GV Q Sbjct 3200 YGVNLQ 3205
> sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavirus
229E OX=11137 GN=1a PE=1 SV=1 Length=4085 Score = 448 bits (1152), Expect = 3e-141, Method: Composition-based stats. Identities = 125/306 (41%), Positives = 183/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI ++ +Y+ Sbjct 2966 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTT-SAIDYDHEYSI 3024 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+G Sbjct 3025 MRLHNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYDG 3084 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 3085 CAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGV 3144 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 3145 MYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFT 3204 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + +++ +L NG G+ ILG + L DEF+ +VV+Q Sbjct 3205 AMNGE--DAFSILAAKTGVCVERLLHAIQ-VLNNGFGGKQILGYSSLNDEFSINEVVKQM 3261 Query 301 SGVTFQ 306 GV Q Sbjct 3262 FGVNLQ 3267
> sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus
229E OX=11137 GN=rep PE=1 SV=1 Length=6758 Score = 447 bits (1151), Expect = 6e-141, Method: Composition-based stats. Identities = 125/306 (41%), Positives = 183/306 (60%), Gaps = 4/306 (1%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +G RKMA PSG VE C+V+V G T LNGLWL D+VYCPRHVI ++ +Y+ Sbjct 2966 AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTT-SAIDYDHEYSI 3024 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF + +G L V+G +M LK+KV N TP++ F ++ G+ F++LACY+G Sbjct 3025 MRLHNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYDG 3084 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN 180 GV+ MR N+TI+GSF+NG+CGS G+N+ V F YMH +EL +G H G+ +G Sbjct 3085 CAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGV 3144 Query 181 FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE 240 YG F D+ Q + +TVNV+A+LYAA++NG W+L + +N A + Sbjct 3145 MYGGFEDQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFT 3204 Query 241 PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC 300 + + D L+A+TG+ V + +++ +L NG G+ ILG + L DEF+ +VV+Q Sbjct 3205 AMNGE--DAFSILAAKTGVCVERLLHAIQ-VLNNGFGGKQILGYSSLNDEFSINEVVKQM 3261 Query 301 SGVTFQ 306 GV Q Sbjct 3262 FGVNLQ 3267
> sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus
NL63 OX=277944 GN=rep PE=1 SV=1 Length=6729 Score = 443 bits (1140), Expect = 2e-139, Method: Composition-based stats. Identities = 135/307 (44%), Positives = 191/307 (62%), Gaps = 5/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 2940 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 2998 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 2999 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 3058 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDY-DCVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ V FCY+H +EL +G H G+D G Sbjct 3059 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 3118 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 3119 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 3178 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 3179 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 3235 Query 300 CSGVTFQ 306 GV Q Sbjct 3236 MYGVNLQ 3242
> sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavirus
NL63 OX=277944 GN=1a PE=1 SV=1 Length=4060 Score = 442 bits (1138), Expect = 2e-139, Method: Composition-based stats. Identities = 135/307 (44%), Positives = 191/307 (62%), Gaps = 5/307 (2%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SG +KMA PSG VE C+V+V G+T LNG+WL D V CPRHVI S +L +Y+ Sbjct 2940 SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYST 2998 Query 61 KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG 120 HNF V V L V+G +M VL++KV +N TPK+ F ++PG +F++LACY G Sbjct 2999 MRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFKTLKPGDSFNILACYEG 3058 Query 121 SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDY-DCVSFCYMHHMELPTGVHAGTDLEG 179 SGV+ +R NFTIKGSF+NG+CGS G+N+ V FCY+H +EL +G H G+D G Sbjct 3059 IASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTG 3118 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY 239 + YG F D+ + Q + ++ NV+A+LYAA++NG RW+L ++ FN AM Y Sbjct 3119 SVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGY 3178 Query 240 EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ 299 ++ V+ L+A+TG++V + AS++ L G G+ ILG + L DEFT +VV+Q Sbjct 3179 TSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ 3235 Query 300 CSGVTFQ 306 GV Q Sbjct 3236 MYGVNLQ 3242
> sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain Beaudette CK) OX=160235 GN=1a PE=3 SV=1 Length=3951 Score = 398 bits (1023), Expect = 5e-124, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 174/313 (56%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVL---GKFSGDQWNDVLNL 2836 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2837 ANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYG 2896 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2897 GTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2956 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T +++D+N Sbjct 2957 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKWLESTTVSVDDYNKW 3016 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + + G ILG EDE TP Sbjct 3017 AGDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKNSQWGGDPILGQYNFEDELTP 3073 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3074 ESVFNQIGGVRLQ 3086
> sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain Beaudette) OX=11122 GN=1a PE=1 SV=1 Length=3951 Score = 398 bits (1023), Expect = 5e-124, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 174/313 (56%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVL---GKFSGDQWNDVLNL 2836 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2837 ANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYG 2896 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2897 GTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2956 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T +++D+N Sbjct 2957 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKWLESTTVSVDDYNKW 3016 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + + G ILG EDE TP Sbjct 3017 AGDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKNSQWGGDPILGQYNFEDELTP 3073 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3074 ESVFNQIGGVRLQ 3086
> sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep PE=3 SV=1 Length=6629 Score = 397 bits (1020), Expect = 2e-123, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 174/313 (56%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVL---GKFSGDQWNDVLNL 2836 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2837 ANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYG 2896 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2897 GTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2956 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T +++D+N Sbjct 2957 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKWLESTTVSVDDYNKW 3016 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + + G ILG EDE TP Sbjct 3017 AGDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKNSQWGGDPILGQYNFEDELTP 3073 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3074 ESVFNQIGGVRLQ 3086
> sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 SV=1 Length=6629 Score = 396 bits (1019), Expect = 2e-123, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 174/313 (56%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 SGF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2780 SGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDTIYCPRHVL---GKFSGDQWNDVLNL 2836 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V + V L V+ ++ VL L+ AN +TPKYKF++ G +F++ Y Sbjct 2837 ANNHEFEVTTQHGVTLNVVSRRLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYG 2896 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2897 GTVVGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2956 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T +++D+N Sbjct 2957 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSLPKWLESTTVSVDDYNKW 3016 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + + G ILG EDE TP Sbjct 3017 AGDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKNSQWGGDPILGQYNFEDELTP 3073 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3074 ESVFNQIGGVRLQ 3086
> sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious
bronchitis virus (strain M41) OX=11127 GN=1a PE=1 SV=1 Length=3953 Score = 393 bits (1010), Expect = 3e-122, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 171/313 (55%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +GF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2782 AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL 2838 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 2839 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 2898 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2899 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2958 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T ++ D+N Sbjct 2959 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKWLESTTVSIEDYNRW 3018 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + ILG EDE TP Sbjct 3019 ASDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKSAQWGSDPILGQYNFEDELTP 3075 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3076 ESVFNQVGGVRLQ 3088
> sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1 Length=6631 Score = 392 bits (1007), Expect = 1e-121, Method: Composition-based stats. Identities = 125/313 (40%), Positives = 171/313 (55%), Gaps = 13/313 (4%) Query 1 SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR 60 +GF+K+ PS VE C+V V+ LNGLWL D +YCPRHV+ + D+L Sbjct 2782 AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL 2838 Query 61 KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN 119 +NH F V N V L V+ ++ VL L+ AN +TPKYKFV+ G +F++ Y Sbjct 2839 ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG 2898 Query 120 GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG 179 G+ G+Y MR N TI+ SFL G+CGSVGFNI+ V+F YMHH+ELP +H GTDL G Sbjct 2899 GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG 2958 Query 180 NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRW------FLNRFTTTLNDFNLV 233 FYG +VD + AQ D +T N++AWLYAA+I+ +L T ++ D+N Sbjct 2959 EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKWLESTTVSIEDYNRW 3018 Query 234 AMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP 293 A + P + + LSA TG+ V + ++ + ILG EDE TP Sbjct 3019 ASDNGFTPFSTST--AITKLSAITGVDVCKLLRTIM-VKSAQWGSDPILGQYNFEDELTP 3075 Query 294 FDVVRQCSGVTFQ 306 V Q GV Q Sbjct 3076 ESVFNQVGGVRLQ 3088 Lambda K H a alpha 0.321 0.148 0.452 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0452 0.140 1.90 42.6 43.6 Effective search space used: 25877591208 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Aug 19, 2020 9:15 PM Number of letters in database: 202,799,066 Number of sequences in database: 563,082 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40