PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6
PE=1 SV=1

Length=212
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL...   437    1e-155
  sp|P79341|IL6_MACFA Interleukin-6 OS=Macaca fascicularis OX=954...   422    6e-150
  sp|P51494|IL6_MACMU Interleukin-6 OS=Macaca mulatta OX=9544 GN=...   421    1e-149
  sp|Q5I6E3|IL6_MACTH Interleukin-6 OS=Macaca thibetana OX=54602 ...   420    3e-149
  sp|P46650|IL6_CERAT Interleukin-6 OS=Cercocebus atys OX=9531 GN...   420    4e-149
  sp|Q8MKH0|IL6_SAISC Interleukin-6 OS=Saimiri sciureus OX=9521 G...   377    6e-132
  sp|Q865W7|IL6_CAMBA Interleukin-6 OS=Camelus bactrianus OX=9837...   267    5e-89 
  sp|Q95181|IL6_HORSE Interleukin-6 OS=Equus caballus OX=9796 GN=...   267    7e-89 
  sp|P26893|IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE...   266    1e-88 
  sp|Q865X6|IL6_LAMGL Interleukin-6 OS=Lama glama OX=9844 GN=IL6 ...   266    2e-88 
  sp|P41683|IL6_FELCA Interleukin-6 OS=Felis catus OX=9685 GN=IL6...   255    4e-84 
  sp|P41323|IL6_CANLF Interleukin-6 OS=Canis lupus familiaris OX=...   254    5e-84 
  sp|Q9XT80|IL6_DELLE Interleukin-6 OS=Delphinapterus leucas OX=9...   252    5e-83 
  sp|Q28747|IL6_ORCOR Interleukin-6 (Fragment) OS=Orcinus orca OX...   251    1e-82 
  sp|A3FBE9|IL6_MUSPF Interleukin-6 OS=Mustela putorius furo OX=9...   249    5e-82 
  sp|Q28819|IL6_PHOVI Interleukin-6 (Fragment) OS=Phoca vitulina ...   246    1e-80 
  sp|Q25BC2|IL6_VULVU Interleukin-6 OS=Vulpes vulpes OX=9627 GN=I...   237    5e-77 
  sp|Q28319|IL6_CAPHI Interleukin-6 OS=Capra hircus OX=9925 GN=IL...   227    4e-73 
  sp|P26892|IL6_BOVIN Interleukin-6 OS=Bos taurus OX=9913 GN=IL6 ...   225    1e-72 
  sp|P29455|IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 ...   225    2e-72 
  sp|Q2MH06|IL6_BUBCA Interleukin-6 OS=Bubalus carabanensis OX=34...   224    6e-72 
  sp|Q6V919|IL6_BUBBU Interleukin-6 OS=Bubalus bubalis OX=89462 G...   224    6e-72 
  sp|O35736|IL6_MARMO Interleukin-6 OS=Marmota monax OX=9995 GN=I...   191    6e-59 
  sp|Q9MZR1|IL6_RABIT Interleukin-6 OS=Oryctolagus cuniculus OX=9...   178    7e-54 
  sp|P20607|IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 G...   175    5e-53 
  sp|P08505|IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=I...   172    8e-52 
  sp|P41693|IL6_NEOVI Interleukin-6 (Fragment) OS=Neovison vison ...   139    7e-40 
  sp|Q90YI0|IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=I...   135    2e-37 
  sp|Q2HRC7|VIL6_HHV8P Viral interleukin-6 homolog OS=Human herpe...  78.2    2e-16 
  sp|A0S0B0|IL6_PAROL Interleukin-6 OS=Paralichthys olivaceus OX=...  50.8    2e-06 
  sp|P13854|MGF_CHICK Myelomonocytic growth factor OS=Gallus gall...  48.5    8e-06 
  sp|Q0GGL7|IL6_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=802...  47.8    2e-05 
  sp|Q6L6X6|IL6_TAKRU Interleukin-6 OS=Takifugu rubripes OX=31033...  47.4    2e-05 
  sp|P09920|CSF3_MOUSE Granulocyte colony-stimulating factor OS=M...  40.8    0.004 
  sp|Q8TXI4|RAD50_METKA DNA double-strand break repair Rad50 ATPa...  33.5    1.3   
  sp|Q2NV92|EX7S_SODGM Exodeoxyribonuclease 7 small subunit OS=So...  30.0    4.7   
  sp|C6DB39|EX7S_PECCP Exodeoxyribonuclease 7 small subunit OS=Pe...  29.6    6.2   
  sp|Q6D842|EX7S_PECAS Exodeoxyribonuclease 7 small subunit OS=Pe...  29.6    6.6   


> sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 
PE=1 SV=1
Length=212

 Score =  437 bits (1123),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
Sbjct  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|P79341|IL6_MACFA Interleukin-6 OS=Macaca fascicularis OX=9541 
GN=IL6 PE=2 SV=1
Length=212

 Score =  422 bits (1085),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|P51494|IL6_MACMU Interleukin-6 OS=Macaca mulatta OX=9544 GN=IL6 
PE=2 SV=1
Length=212

 Score =  421 bits (1083),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 209/212 (99%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPV PGEDSK+VAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQS+LRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSNLRALRQM  212


> sp|Q5I6E3|IL6_MACTH Interleukin-6 OS=Macaca thibetana OX=54602 
GN=IL6 PE=2 SV=1
Length=212

 Score =  420 bits (1080),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTK LIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKALIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|P46650|IL6_CERAT Interleukin-6 OS=Cercocebus atys OX=9531 
GN=IL6 PE=2 SV=1
Length=212

 Score =  420 bits (1079),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMC+S+KEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCDSTKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQ LQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQLLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|Q8MKH0|IL6_SAISC Interleukin-6 OS=Saimiri sciureus OX=9521 
GN=IL6 PE=2 SV=1
Length=212

 Score =  377 bits (967),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M SFSTSAF PVAFSLGLLLV+PAAFPAPV  GEDSK+VAAP+RQ LTS+ERIDK I YI
Sbjct  1    MTSFSTSAFRPVAFSLGLLLVMPAAFPAPVTLGEDSKEVAAPNRQLLTSTERIDKHIWYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKE CNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCL+KI TGLL
Sbjct  61   LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESS+EQA AVQMSTK LIQ LQ+KAKNL AI TPDP TNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQRKAKNLSAIATPDPATNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQ+QWLQ +TTHLILRSFKEFLQ SLRALRQM
Sbjct  181  AQDQWLQGVTTHLILRSFKEFLQCSLRALRQM  212


> sp|Q865W7|IL6_CAMBA Interleukin-6 OS=Camelus bactrianus OX=9837 
GN=IL6 PE=2 SV=1
Length=211

 Score =  267 bits (683),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 163/212 (77%), Gaps = 1/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP PVP GED KD    +R P TS ++ ++ I+YI
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPVPLGEDFKDGTTSNR-PFTSPDKSEELIKYI  59

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEAL+ENNLNLPKM EKDGCFQSGFN+ETCL++I  GLL
Sbjct  60   LGRISAMRKEMCEKYDKCENSKEALSENNLNLPKMTEKDGCFQSGFNQETCLMRITIGLL  119

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQN +E  +    AVQ+STK LIQ L++K K  + ++TP+P T +SLL KLQ
Sbjct  120  EFQIYLDYLQNYYEGDKGNTEAVQISTKALIQLLRQKVKQPEEVSTPNPITGSSLLNKLQ  179

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +NQW+++    LILRS ++FLQ SLRA+R M
Sbjct  180  TENQWMKNTKMILILRSLEDFLQFSLRAVRIM  211


> sp|Q95181|IL6_HORSE Interleukin-6 OS=Equus caballus OX=9796 GN=IL6 
PE=2 SV=2
Length=208

 Score =  267 bits (682),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 162/212 (76%), Gaps = 4/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS   PVAFSLGLLLV+  AFP P+P GED      P    LT++++  + I+YI
Sbjct  1    MNSLSTSTVTPVAFSLGLLLVMATAFPTPLPLGEDETTSNGPL---LTTADKTKQHIKYI  57

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+ E CN  + CE+SKE LAENNLNLPKMAEKDGCFQSGFN+ETCL+KI TGL 
Sbjct  58   LGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLS  117

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YLEYLQN F+  +E  + +Q+STKVL+Q L +K KN + +TTPDPT  +SLL KL 
Sbjct  118  EFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNPE-VTTPDPTAKSSLLAKLH  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+WL++ TTHLILRS ++FLQ SLRA+R M
Sbjct  177  SQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM  208


> sp|P26893|IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 
PE=2 SV=2
Length=212

 Score =  266 bits (681),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 162/212 (76%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP P    ED+K  A   +   TS ++ ++ I+YI
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K   CE+SKE LAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGL+
Sbjct  61   LGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLV  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQ  +ES++    AVQ+STK LIQ L++K KN D  TTP+PTTNA LL KLQ
Sbjct  121  EFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+W+++    LILRS ++FLQ SLRA+R M
Sbjct  181  SQNEWMKNTKIILILRSLEDFLQFSLRAIRIM  212


> sp|Q865X6|IL6_LAMGL Interleukin-6 OS=Lama glama OX=9844 GN=IL6 
PE=2 SV=1
Length=211

 Score =  266 bits (679),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 162/212 (76%), Gaps = 1/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS F PVAFSLGLLLV+  AFP PVP GED KD     ++P TS ++ ++ I+YI
Sbjct  1    MNSLSTSTFSPVAFSLGLLLVMATAFPTPVPLGEDFKD-GTTSKRPFTSPDKTEELIKYI  59

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEAL+ENNLNLPKM EKDGCFQSGFN+ETCL++I  GLL
Sbjct  60   LGRISAMRKEMCEKYDKCENSKEALSENNLNLPKMTEKDGCFQSGFNQETCLMRITIGLL  119

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQN +E  +    AVQ+STK LIQ L++K K  + ++TP+P T +SLL KLQ
Sbjct  120  EFQIYLDYLQNYYEGDKGNTEAVQISTKALIQLLRQKVKQPEEVSTPNPITGSSLLNKLQ  179

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +NQW+++    LILRS ++FLQ SLRA+R M
Sbjct  180  TENQWMKNTKMILILRSLEDFLQFSLRAVRIM  211


> sp|P41683|IL6_FELCA Interleukin-6 OS=Felis catus OX=9685 GN=IL6 
PE=2 SV=1
Length=208

 Score =  255 bits (651),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 157/212 (74%), Gaps = 4/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M   STSAF P+AFSLGLLLV+  AFP P P G D    A  +R PLTS++++++ I+YI
Sbjct  1    MTFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGD----ATSNRLPLTSADKMEELIKYI  56

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+KE C+  N CE SKEALAENNLNLPK+AEKDGCFQSGFN+ETCL +I TGL 
Sbjct  57   LGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKDGCFQSGFNQETCLTRITTGLQ  116

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL++LQ+++E  EE A++V  ST VL+Q L++K KN D +T P PT    L  KLQ
Sbjct  117  EFQIYLKFLQDKYEGDEENAKSVYTSTNVLLQMLKRKGKNQDEVTIPVPTVEVGLQAKLQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q +WL+  T HL LR  ++FLQ SLRA+R M
Sbjct  177  SQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM  208


> sp|P41323|IL6_CANLF Interleukin-6 OS=Canis lupus familiaris OX=9615 
GN=IL6 PE=2 SV=1
Length=207

 Score =  254 bits (650),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 159/212 (75%), Gaps = 5/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF     SLGLLLV+  AFP P P   DSKD A  +  PLTS+ ++++ I+YI
Sbjct  1    MNSLSTSAF-----SLGLLLVMATAFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISALRKE C+K N CE SKEALAENNL+LPK+  KDGCFQSGFN+ETCL +I TGL+
Sbjct  56   LGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLV  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L  LQN +E  +E  ++V MSTK+L+Q L+ K KN D +TTPDPTT+ASL   LQ
Sbjct  116  EFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQ  175

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q++ ++  T HLILRS ++FLQ SLRA+R M
Sbjct  176  SQDECVKHTTIHLILRSLEDFLQFSLRAVRIM  207


> sp|Q9XT80|IL6_DELLE Interleukin-6 OS=Delphinapterus leucas OX=9749 
GN=IL6 PE=2 SV=1
Length=208

 Score =  252 bits (643),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 155/211 (73%), Gaps = 6/211 (3%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS ST     +AFSLGLLLV   AFP P P GED KD     R  LTS ++ +  I+YI
Sbjct  1    MNSLST-----IAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEALAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGLL
Sbjct  56   LGKISAMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLL  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E  +    AVQ+S K L Q L++K KN D +TTPDPTTNASL+  LQ
Sbjct  116  EYQIYLDYLQNEYEGDKGSIEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQ  175

Query  181  AQN-QWLQDMTTHLILRSFKEFLQSSLRALR  210
            +QN  W+++    LILRS + FLQ SLRA+R
Sbjct  176  SQNDDWMRNTKIILILRSLENFLQFSLRAVR  206


> sp|Q28747|IL6_ORCOR Interleukin-6 (Fragment) OS=Orcinus orca 
OX=9733 GN=IL6 PE=2 SV=1
Length=205

 Score =  251 bits (640),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 1/199 (1%)

Query  13   AFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC  72
            AFSLGLLLV   AFP P P GED KD     R  LTS ++ +  I+YIL  ISA+RKE C
Sbjct  5    AFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLYLTSPDKTEALIKYILGKISAMRKEMC  64

Query  73   NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNR  132
             K + CE+SKEALAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGLLE+++YL+YLQN 
Sbjct  65   EKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLLEYQIYLDYLQNE  124

Query  133  FESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQN-QWLQDMTT  191
            +E  +E   AVQ+S+K L Q L++K KN D +TTPDPTTNASL+  LQ+QN  W+++   
Sbjct  125  YEGDKEAIEAVQISSKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQSQNDDWMKNTKI  184

Query  192  HLILRSFKEFLQSSLRALR  210
             LILRS + FLQ SLRA+R
Sbjct  185  ILILRSLENFLQFSLRAIR  203


> sp|A3FBE9|IL6_MUSPF Interleukin-6 OS=Mustela putorius furo OX=9669 
GN=IL6 PE=2 SV=1
Length=210

 Score =  249 bits (637),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 161/212 (76%), Gaps = 2/212 (1%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP P P G DSKD A  +R PLTS+++++  IR+I
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPGPLGGDSKDDATSNRPPLTSADKMEDFIRFI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+KE C K N CE SKEALAENNLNLPK+AE+D CFQS FN+ETCL +I TGL 
Sbjct  61   LGKISALKKEMCEKYNKCEDSKEALAENNLNLPKLAEEDKCFQSQFNQETCLTRITTGLQ  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L+YL+  +E ++  A +V +STK L+Q L  +  N   +TTPDPTT++SL    +
Sbjct  121  EFQIHLKYLEANYEGNKNNAHSVYISTKHLLQKL--RPMNRVEVTTPDPTTDSSLQALFK  178

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q++WL+ +T HLILRS ++FLQ SLRA+R M
Sbjct  179  SQDKWLKHVTIHLILRSLEDFLQFSLRAIRIM  210


> sp|Q28819|IL6_PHOVI Interleukin-6 (Fragment) OS=Phoca vitulina 
OX=9720 GN=IL6 PE=2 SV=1
Length=209

 Score =  246 bits (627),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 163/207 (79%), Gaps = 0/207 (0%)

Query  6    TSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGIS  65
            TSAF PVAFSLGLLLV+  AFP P P G +S+  A  +R PLTS +++++ I+YIL  IS
Sbjct  3    TSAFSPVAFSLGLLLVMATAFPTPGPVGGESQADATSNRPPLTSPDKMEEFIKYILGKIS  62

Query  66   ALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVY  125
            ALRKE C+K N CE SKEALAENNL LPK+AEKDGCFQSGFN+ETCL +I TGLLEF+++
Sbjct  63   ALRKEMCDKYNKCEDSKEALAENNLRLPKLAEKDGCFQSGFNQETCLTRITTGLLEFQIH  122

Query  126  LEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQW  185
            L+Y+Q  +E ++E A +V +STK+L+Q L KK K+ D +TTPDPTT+ SL   L+AQ++W
Sbjct  123  LKYIQANYEGNKEDANSVYISTKLLVQMLMKKVKSQDEVTTPDPTTDTSLQAILKAQDKW  182

Query  186  LQDMTTHLILRSFKEFLQSSLRALRQM  212
            L+  T HLILRS ++FLQ SLRA+R M
Sbjct  183  LKHTTIHLILRSLEDFLQFSLRAVRIM  209


> sp|Q25BC2|IL6_VULVU Interleukin-6 OS=Vulpes vulpes OX=9627 GN=IL6 
PE=2 SV=1
Length=207

 Score =  237 bits (604),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 159/212 (75%), Gaps = 5/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF     SLGLLLV+  AFP P P   DSKD A     PLTS+ ++++ I+YI
Sbjct  1    MNSLSTSAF-----SLGLLLVMATAFPTPGPLAGDSKDDATSISLPLTSANKVEELIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISALRKE C+K N CE SKEALAENNL+LP +  KDGCFQSGFN+ETCL +I TGL+
Sbjct  56   LGKISALRKEMCDKFNKCEDSKEALAENNLHLPILEGKDGCFQSGFNQETCLTRITTGLM  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L  LQN +E  +E A++V MSTK+L+Q L+ K KN D +TTPDPTT+A+L   LQ
Sbjct  116  EFQLHLNILQNNYEGDKENAQSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDATLQAILQ  175

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+WL+  T HLILRS ++FLQ SLRA+R M
Sbjct  176  SQNEWLKHTTIHLILRSLEDFLQFSLRAVRIM  207


> sp|Q28319|IL6_CAPHI Interleukin-6 OS=Capra hircus OX=9925 GN=IL6 
PE=2 SV=1
Length=208

 Score =  227 bits (578),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 149/210 (71%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P+A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I++I
Sbjct  1    MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CE+SKE LAEN L LPKM EKDGCFQSGFN+  CL+K   GLL
Sbjct  61   VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL++LQN FE ++E    +Q S + LIQ L++K   L  ITT  P TN  +L K+Q
Sbjct  121  EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGL--ITT--PATNTDMLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    +ILRS + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKVIIILRSLENFLQFSLRAIR  206


> sp|P26892|IL6_BOVIN Interleukin-6 OS=Bos taurus OX=9913 GN=IL6 
PE=2 SV=1
Length=208

 Score =  225 bits (574),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 149/210 (71%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSKE LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E ++E  R ++ + + LIQ L++K    D ITT  P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIA--DLITT--PATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|P29455|IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 
PE=2 SV=2
Length=208

 Score =  225 bits (573),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 149/210 (71%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P+A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I++I
Sbjct  1    MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CE+SKE LAEN L LPKM EKDGCFQSGFN+  CL+K   GLL
Sbjct  61   VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL++LQN FE ++E    +Q S + LIQ L++K   L  ITT  P T+  +L K+Q
Sbjct  121  EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGL--ITT--PATHTDMLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    +ILRS + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKVIIILRSLENFLQFSLRAIR  206


> sp|Q2MH06|IL6_BUBCA Interleukin-6 OS=Bubalus carabanensis OX=346063 
GN=IL6 PE=2 SV=1
Length=208

 Score =  224 bits (570),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 148/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSK+ LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKDTLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E + E  R ++ + + LIQ L++K    D ITT  P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNRENVRDLRKNIRTLIQILKQKIA--DLITT--PATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|Q6V919|IL6_BUBBU Interleukin-6 OS=Bubalus bubalis OX=89462 
GN=IL6 PE=2 SV=1
Length=208

 Score =  224 bits (570),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 148/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSK+ LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKDTLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E + E  R ++ + + LIQ L++K    D ITT  P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNRENVRDLRKNIRTLIQILKQKIA--DLITT--PATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|O35736|IL6_MARMO Interleukin-6 OS=Marmota monax OX=9995 GN=IL6 
PE=2 SV=1
Length=207

 Score =  191 bits (484),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 134/199 (67%), Gaps = 2/199 (1%)

Query  15   SLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNK  74
            SLGLLLV+  AFPA     ED ++    ++    SS +  +QI Y++  +  +RKE C  
Sbjct  8    SLGLLLVVATAFPASELQREDGENSVTRNKPTRASSGKTRRQISYLIKEVFEMRKELCKN  67

Query  75   SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFE  134
               C  S  A++ENNLNLPKM EKDGCFQ+G+N + CLV+I +GLLEF+VYL Y++N+F+
Sbjct  68   DETCIKSHVAVSENNLNLPKMTEKDGCFQTGYNRDDCLVRITSGLLEFQVYLRYIRNKFQ  127

Query  135  SSEEQARA--VQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTH  192
                + RA  VQ S+K LI+ L+++ K+ + I  P PT N +LL KL++QN W + MT  
Sbjct  128  EGNNRDRAEHVQSSSKALIEILKQEVKDPNKIVFPSPTANINLLAKLESQNDWQKVMTMQ  187

Query  193  LILRSFKEFLQSSLRALRQ  211
            LIL +F++FLQ +LRA+R+
Sbjct  188  LILSNFEDFLQFTLRAVRK  206


> sp|Q9MZR1|IL6_RABIT Interleukin-6 OS=Oryctolagus cuniculus OX=9986 
GN=IL6 PE=2 SV=1
Length=241

 Score =  178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 132/216 (61%), Gaps = 6/216 (3%)

Query  1    MNSFSTSAF--GPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIR  58
            MNSF TSA   GP+  SL LLLV+  AFP   P  EDS   A+P +  LT   R  + IR
Sbjct  1    MNSF-TSALRPGPLGCSLALLLVVATAFPTSAPVREDSNTKASPDKT-LTPPGRTIESIR  58

Query  59   YILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITG  118
             IL+ I  LRKE C+    C + KEALAE NL+LP++ E+DGCF    N ETCL++I +G
Sbjct  59   SILETIKELRKEMCDHDVNCMNRKEALAEVNLHLPRLIEEDGCFPPAVNNETCLLRITSG  118

Query  119  LLEFEVYLEYLQNRFESSEEQARA--VQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLL  176
            L+EF +YLE+LQ +F S EE  R   V  + + LI+ L+ K KNL+   T  P    SL+
Sbjct  119  LMEFRMYLEHLQAKFRSDEENTRVSMVLKNIQHLIKTLRPKVKNLNEEATLKPAVAVSLM  178

Query  177  TKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
              LQ +NQWL+  T H ILR    FL+ +LRA+  M
Sbjct  179  ENLQQKNQWLKTTTIHFILRGLTNFLEFTLRAVDLM  214


> sp|P20607|IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 
GN=Il6 PE=2 SV=1
Length=211

 Score =  175 bits (444),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 142/213 (67%), Gaps = 5/213 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFP-APVPPGEDSKDVAAPHRQPLTSSERIDKQIRY  59
            M   S   F PVAF LGL+L+   AFP + V  G+ ++D    H +P+ ++ ++   I Y
Sbjct  1    MKFLSARDFQPVAF-LGLMLLTATAFPTSQVRRGDFTEDTT--HNRPVYTTSQVGGLITY  57

Query  60   ILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGL  119
            +L  I  +RKE CN ++ C +S +AL+ENNL LP++   DGCFQ+G+N+E CL+KI +GL
Sbjct  58   VLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGL  117

Query  120  LEFEVYLEYLQNRF-ESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK  178
            LEF  YLE+++N   ++ +++AR +Q +T+ L+   +++ K+   I  P PT+NA L+ K
Sbjct  118  LEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEK  177

Query  179  LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            L++Q +WL+  T  LIL++ +EFL+ ++R+ RQ
Sbjct  178  LESQKEWLRTKTIQLILKALEEFLKVTMRSTRQ  210


> sp|P08505|IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 
PE=1 SV=1
Length=211

 Score =  172 bits (436),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 134/212 (63%), Gaps = 3/212 (1%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M   S   F PVAF LGL+LV   AFP       D  +   P+R P+ ++ ++   I ++
Sbjct  1    MKFLSARDFHPVAF-LGLMLVTTTAFPTSQVRRGDFTEDTTPNR-PVYTTSQVGGLITHV  58

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  I  +RKE CN ++ C ++ +ALAENNL LP++   DGC+Q+G+N+E CL+KI +GLL
Sbjct  59   LWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLL  118

Query  121  EFEVYLEYLQNRF-ESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKL  179
            E+  YLEY++N   ++ +++AR +Q  T+ LI    ++ K+L  I  P P +NA L  KL
Sbjct  119  EYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKL  178

Query  180  QAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            ++Q +WL+  T   IL+S +EFL+ +LR+ RQ
Sbjct  179  ESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQ  210


> sp|P41693|IL6_NEOVI Interleukin-6 (Fragment) OS=Neovison vison 
OX=452646 GN=IL6 PE=2 SV=1
Length=125

 Score =  139 bits (349),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  86   AENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQM  145
            AENNL LPK+AEKD CFQS FN+ETC+ +I TGL EF+++L+YL+  +E ++  A +V +
Sbjct  1    AENNLKLPKLAEKDKCFQSQFNQETCMTRITTGLQEFQIHLKYLEANYEGNKNNAHSVYI  60

Query  146  STKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSS  205
            STK L+Q L  +  N   +TTP+PTT++SL    ++Q++WL+ +T HLILRS ++FLQ S
Sbjct  61   STKHLLQKL--RPMNQVEVTTPNPTTDSSLQALFKSQDKWLKHVTIHLILRSLEDFLQFS  118

Query  206  LRALRQM  212
            LRA+R M
Sbjct  119  LRAIRIM  125


> sp|Q90YI0|IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 
PE=2 SV=1
Length=241

 Score =  135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 3/180 (2%)

Query  33   GEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNL  92
            GE   +  A  R+ L   E + + +R   D    L+ E C K  +CE+S E L  NNLNL
Sbjct  57   GEVGLEEEAGARRALLDCEPLARVLR---DRAVQLQDEMCKKFTVCENSMEMLVRNNLNL  113

Query  93   PKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQ  152
            PK+ E+DGC  +GF+EE CL K+ +GL  F+ YLE++Q  F+S ++   ++  STK L  
Sbjct  114  PKVTEEDGCLLAGFDEEKCLTKLSSGLFAFQTYLEFIQETFDSEKQNVESLCYSTKHLAA  173

Query  153  FLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +++   N D +  PD     SLL  L++   W++ +T HLILR F  F++ ++RA+R +
Sbjct  174  TIRQMVINPDEVVIPDSAAQKSLLANLKSDKDWIEKITMHLILRDFTSFMEKTVRAVRYL  233


> sp|Q2HRC7|VIL6_HHV8P Viral interleukin-6 homolog OS=Human herpesvirus 
8 type P (isolate GK18) OX=868565 GN=K2 PE=1 SV=1
Length=204

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/158 (26%), Positives = 77/158 (49%), Gaps = 0/158 (0%)

Query  55   KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK  114
            +++ ++L  I    ++ C ++ +C+   E  A  +L LP + + D C   GFNE +CL K
Sbjct  37   QRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKK  96

Query  115  IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNAS  174
            +  G  EFEV  ++L   F  S      +++ TK L   +Q++   L       P  +  
Sbjct  97   LADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRG  156

Query  175  LLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            LL +LQ    W++   +  +L + ++F   ++R L  +
Sbjct  157  LLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSI  194


> sp|A0S0B0|IL6_PAROL Interleukin-6 OS=Paralichthys olivaceus OX=8255 
GN=il6 PE=2 SV=1
Length=230

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 55/111 (50%), Gaps = 1/111 (1%)

Query  101  CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKN  160
            C  + F++E CL ++  GL  + V  ++++  + SS     A +  +  LI  +++K +N
Sbjct  96   CPSANFSKEACLQRLAEGLHTYMVLFKHVEKEYPSSSILLHA-RYHSGALIGLIKEKMRN  154

Query  161  LDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
               +T P       LL  +   + + + MT H ILR    FL++   A+R+
Sbjct  155  PGQVTVPTSRQEQQLLQDMDNPSTFHRKMTAHNILRQLHNFLRNGKVAIRK  205


> sp|P13854|MGF_CHICK Myelomonocytic growth factor OS=Gallus gallus 
OX=9031 PE=2 SV=1
Length=201

 Score = 48.5 bits (114),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 67/155 (43%), Gaps = 3/155 (2%)

Query  58   RYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIIT  117
            R I   ++AL++  C+   +C   +  L + + +L + A  D C + GF  E C  +I  
Sbjct  47   RKIRGDVAALQRAVCDTFQLCTEEELQLVQPDPHLVQ-APLDQCHKRGFQAEVCFTQIRA  105

Query  118  GLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLT  177
            GL  +   L  +     +       +Q+    L   +Q++ ++L   T   P    S   
Sbjct  106  GLHAYHDSLGAVLRLLPNHTTLVETLQLDAANLSSNIQQQMEDLGLDTVTLPAEQRSPPP  165

Query  178  KLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
                  Q  Q +    IL +F+ FL+++ RALR +
Sbjct  166  TFSGPFQ--QQVGGFFILANFQRFLETAYRALRHL  198


> sp|Q0GGL7|IL6_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 
GN=il6 PE=2 SV=1
Length=219

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 55/109 (50%), Gaps = 1/109 (1%)

Query  104  SGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDA  163
            S  N+E CL +I  GL  +++ L++++  +  S     +V   T VLI  ++ + K  + 
Sbjct  104  SASNKEACLQEISRGLQVYQLLLQHVKAEYPQST-LLPSVTHQTTVLIGLVKDQMKVAEV  162

Query  164  ITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +     +    +L ++    +W +  + H ILR  + FL  + RALR+M
Sbjct  163  VEDLSASERKRVLGEVSTGTEWERKTSVHAILRELRNFLVDTKRALRRM  211


> sp|Q6L6X6|IL6_TAKRU Interleukin-6 OS=Takifugu rubripes OX=31033 
GN=il6 PE=2 SV=1
Length=227

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (48%), Gaps = 3/124 (2%)

Query  88   NNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST  147
            +   +P +  K  C  S F ++ CL +++ GLL + V L+ ++  F SS   +  V+  +
Sbjct  82   DRYKIPSLPAK--CPYSNFGKDACLRRLLEGLLIYSVLLKRVEEEFPSSSILSE-VRFYS  138

Query  148  KVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLR  207
             +LI+ L+ K ++ D +     +    LL      + + + MT H IL +   FL    R
Sbjct  139  NILIKELENKVRDRDQVMRLTSSQEEQLLKDTDYPDTFHRKMTAHGILYNLHYFLVDCRR  198

Query  208  ALRQ  211
             + +
Sbjct  199  VINK  202


> sp|P09920|CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus 
musculus OX=10090 GN=Csf3 PE=1 SV=1
Length=208

 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 51/119 (43%), Gaps = 1/119 (1%)

Query  55   KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVK  114
            +Q+R I    S L ++ C    +C   +  L  ++L +PK A   GC      +  CL +
Sbjct  55   EQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPK-ASLSGCSSQALQQTQCLSQ  113

Query  115  IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNA  173
            + +GL  ++  L+ L     +       +Q+        + ++ +NL    T  PT +A
Sbjct  114  LHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSA  172


> sp|Q8TXI4|RAD50_METKA DNA double-strand break repair Rad50 ATPase 
OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 
9639 / NBRC 100938) OX=190192 GN=rad50 PE=3 SV=1
Length=876

 Score = 33.5 bits (75),  Expect = 1.3, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 4/114 (4%)

Query  31   PPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNL  90
            P  E+ K+     R+     ER++ ++R + + I +L+    +   + E  KEA  E   
Sbjct  220  PEVEELKERLNELREAKREFERLEGELRLLENKIESLKGRRDDLRKLVEEGKEAERE---  276

Query  91   NLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQ  144
             L ++ +     +   NEE  L + I  L      L  L+NR ES+EE+   V+
Sbjct  277  -LQRLGDVPSKVRELENEEAELRRRIEELRNLLDDLRSLRNRLESAEEELEGVK  329


> sp|Q2NV92|EX7S_SODGM Exodeoxyribonuclease 7 small subunit OS=Sodalis 
glossinidius (strain morsitans) OX=343509 GN=xseB PE=3 
SV=1
Length=82

 Score = 30.0 bits (66),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 3/64 (5%)

Query  92   LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLI  151
            +PK AEK   F++   E   L +I+T L   E+ LE   N FE   + AR  Q + +   
Sbjct  1    MPKKAEKPASFETALKE---LEQIVTRLESGELPLEQALNEFEQGVQLARQGQKTLQQAE  57

Query  152  QFLQ  155
            Q +Q
Sbjct  58   QRVQ  61


> sp|C6DB39|EX7S_PECCP Exodeoxyribonuclease 7 small subunit OS=Pectobacterium 
carotovorum subsp. carotovorum (strain PC1) OX=561230 
GN=xseB PE=3 SV=1
Length=82

 Score = 29.6 bits (65),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 10/86 (12%)

Query  92   LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLI  151
            +PK  E+   F+S  NE   L KI+T L   E+ L+   N FE   + AR  Q       
Sbjct  1    MPKKTEQPVSFESSLNE---LEKIVTRLESGELPLDDALNEFEHGIQLARQGQ-------  50

Query  152  QFLQKKAKNLDAITTPDPTTNASLLT  177
            Q LQ+  + +  + + DP    S  T
Sbjct  51   QKLQQAEQRVQILLSDDPDAPLSPFT  76


> sp|Q6D842|EX7S_PECAS Exodeoxyribonuclease 7 small subunit OS=Pectobacterium 
atrosepticum (strain SCRI 1043 / ATCC BAA-672) 
OX=218491 GN=xseB PE=3 SV=1
Length=82

 Score = 29.6 bits (65),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 10/86 (12%)

Query  92   LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLI  151
            +PK  E+   F+S  NE   L KI+T L   E+ L+   N FE   + AR  Q       
Sbjct  1    MPKKTEQPVSFESSLNE---LEKIVTRLESGELPLDDALNEFEHGIQLARQGQ-------  50

Query  152  QFLQKKAKNLDAITTPDPTTNASLLT  177
            Q LQ+  + +  + + DP    S  T
Sbjct  51   QKLQQAEQRVQILLSDDPDAPLSPFT  76



Lambda      K        H        a         alpha
   0.316    0.130    0.363    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13777909200
Results from round 2


Query= sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6
PE=1 SV=1

Length=212
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|P26893|IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE...   334    3e-115
  sp|Q865W7|IL6_CAMBA Interleukin-6 OS=Camelus bactrianus OX=9837...   331    4e-114
  sp|Q865X6|IL6_LAMGL Interleukin-6 OS=Lama glama OX=9844 GN=IL6 ...   328    5e-113
  sp|Q9XT80|IL6_DELLE Interleukin-6 OS=Delphinapterus leucas OX=9...   327    2e-112
  sp|A3FBE9|IL6_MUSPF Interleukin-6 OS=Mustela putorius furo OX=9...   326    6e-112
  sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL...   324    3e-111
  sp|Q28747|IL6_ORCOR Interleukin-6 (Fragment) OS=Orcinus orca OX...   321    3e-110
  sp|P41683|IL6_FELCA Interleukin-6 OS=Felis catus OX=9685 GN=IL6...   321    4e-110
  sp|P79341|IL6_MACFA Interleukin-6 OS=Macaca fascicularis OX=954...   318    7e-109
  sp|Q5I6E3|IL6_MACTH Interleukin-6 OS=Macaca thibetana OX=54602 ...   318    8e-109
  sp|P41323|IL6_CANLF Interleukin-6 OS=Canis lupus familiaris OX=...   317    1e-108
  sp|Q28819|IL6_PHOVI Interleukin-6 (Fragment) OS=Phoca vitulina ...   317    2e-108
  sp|Q8MKH0|IL6_SAISC Interleukin-6 OS=Saimiri sciureus OX=9521 G...   317    3e-108
  sp|P51494|IL6_MACMU Interleukin-6 OS=Macaca mulatta OX=9544 GN=...   316    4e-108
  sp|P46650|IL6_CERAT Interleukin-6 OS=Cercocebus atys OX=9531 GN...   316    5e-108
  sp|Q95181|IL6_HORSE Interleukin-6 OS=Equus caballus OX=9796 GN=...   310    6e-106
  sp|Q25BC2|IL6_VULVU Interleukin-6 OS=Vulpes vulpes OX=9627 GN=I...   300    8e-102
  sp|P26892|IL6_BOVIN Interleukin-6 OS=Bos taurus OX=9913 GN=IL6 ...   296    2e-100
  sp|Q2MH06|IL6_BUBCA Interleukin-6 OS=Bubalus carabanensis OX=34...   296    2e-100
  sp|Q6V919|IL6_BUBBU Interleukin-6 OS=Bubalus bubalis OX=89462 G...   296    2e-100
  sp|Q28319|IL6_CAPHI Interleukin-6 OS=Capra hircus OX=9925 GN=IL...   291    2e-98 
  sp|P29455|IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 ...   290    4e-98 
  sp|P08505|IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=I...   269    1e-89 
  sp|P20607|IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 G...   259    7e-86 
  sp|O35736|IL6_MARMO Interleukin-6 OS=Marmota monax OX=9995 GN=I...   257    5e-85 
  sp|Q9MZR1|IL6_RABIT Interleukin-6 OS=Oryctolagus cuniculus OX=9...   253    6e-83 
  sp|Q90YI0|IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=I...   211    2e-66 
  sp|P41693|IL6_NEOVI Interleukin-6 (Fragment) OS=Neovison vison ...   182    1e-56 
  sp|Q2HRC7|VIL6_HHV8P Viral interleukin-6 homolog OS=Human herpe...   184    2e-56 
  sp|P13854|MGF_CHICK Myelomonocytic growth factor OS=Gallus gall...   155    3e-45 
  sp|A0S0B0|IL6_PAROL Interleukin-6 OS=Paralichthys olivaceus OX=...   145    3e-41 
  sp|Q6L6X6|IL6_TAKRU Interleukin-6 OS=Takifugu rubripes OX=31033...   132    2e-36 
  sp|Q0GGL7|IL6_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=802...   125    1e-33 

Sequences not found previously or not previously below threshold:

  sp|B6CKP4|IL6_SPAAU Interleukin-6 OS=Sparus aurata OX=8175 GN=i...  99.8    6e-24
  sp|P35834|CSF3_CANLF Granulocyte colony-stimulating factor OS=C...  73.2    8e-15
  sp|P09919|CSF3_HUMAN Granulocyte colony-stimulating factor OS=H...  73.6    9e-15
  sp|P09920|CSF3_MOUSE Granulocyte colony-stimulating factor OS=M...  72.0    3e-14
  sp|O02708|CSF3_FELCA Granulocyte colony-stimulating factor (Fra...  71.2    5e-14
  sp|O02837|CSF3_PIG Granulocyte colony-stimulating factor OS=Sus...  66.2    2e-12
  sp|P35833|CSF3_BOVIN Granulocyte colony-stimulating factor OS=B...  65.1    6e-12
  sp|Q28746|CSF3_SHEEP Granulocyte colony-stimulating factor OS=O...  61.2    1e-10
  sp|Q9EQ14|IL23A_MOUSE Interleukin-23 subunit alpha OS=Mus muscu...  49.7    2e-06
  sp|Q91Z84|IL23A_RAT Interleukin-23 subunit alpha OS=Rattus norv...  47.4    2e-05
  sp|Q64FU1|IL23A_HORSE Interleukin-23 subunit alpha OS=Equus cab...  47.4    2e-05
  sp|Q9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha OS=Homo sapi...  38.5    0.017
  sp|Q9N2H9|IL23A_PIG Interleukin-23 subunit alpha OS=Sus scrofa ...  38.1    0.029
  sp|Q6LA37|IL23A_CAVPO Interleukin-23 subunit alpha OS=Cavia por...  37.4    0.043
  sp|Q06194|FA8_MOUSE Coagulation factor VIII OS=Mus musculus OX=...  35.8    0.33 
  sp|Q18237|SMC5_CAEEL Structural maintenance of chromosomes prot...  35.4    0.34 
  sp|Q99567|NUP88_HUMAN Nuclear pore complex protein Nup88 OS=Hom...  33.9    0.99 
  sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo s...  33.5    1.6  
  sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus ...  33.1    1.7  
  sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=E...  32.7    2.1  
  sp|C4ULG3|AFP18_YERRA Toxin Afp18 OS=Yersinia ruckeri serotype ...  33.1    2.3  
  sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus mu...  32.7    2.6  
  sp|B9GE13|KN12F_ORYSJ Kinesin-like protein KIN-12F OS=Oryza sat...  32.7    3.0  
  sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9...  32.3    3.5  
  sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Orycto...  32.3    3.6  
  sp|Q83BT4|NRDR_COXBU Transcriptional repressor NrdR OS=Coxiella...  31.2    4.1  
  sp|A9N8T7|NRDR_COXBR Transcriptional repressor NrdR OS=Coxiella...  31.2    4.1  
  sp|A9KBN5|NRDR_COXBN Transcriptional repressor NrdR OS=Coxiella...  31.2    4.1  
  sp|B6IZ81|NRDR_COXB2 Transcriptional repressor NrdR OS=Coxiella...  31.2    4.1  
  sp|B6J8Q8|NRDR_COXB1 Transcriptional repressor NrdR OS=Coxiella...  31.2    4.1  
  sp|P0CF95|BICL1_DANRE BICD family-like cargo adapter 1 OS=Danio...  32.0    4.3  
  sp|P39723|SPC72_YEAST Spindle pole component SPC72 OS=Saccharom...  31.2    7.3  
  sp|P61584|ROCK1_PANTR Rho-associated protein kinase 1 (Fragment...  31.2    7.9  
  sp|B0BMJ2|CC42M_XENTR Coiled-coil domain-containing protein 42 ...  30.8    9.3  


> sp|P26893|IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 
PE=2 SV=2
Length=212

 Score =  334 bits (856),  Expect = 3e-115, Method: Composition-based stats.
 Identities = 130/212 (61%), Positives = 162/212 (76%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP P    ED+K  A   +   TS ++ ++ I+YI
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K   CE+SKE LAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGL+
Sbjct  61   LGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLV  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQ  +ES++    AVQ+STK LIQ L++K KN D  TTP+PTTNA LL KLQ
Sbjct  121  EFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+W+++    LILRS ++FLQ SLRA+R M
Sbjct  181  SQNEWMKNTKIILILRSLEDFLQFSLRAIRIM  212


> sp|Q865W7|IL6_CAMBA Interleukin-6 OS=Camelus bactrianus OX=9837 
GN=IL6 PE=2 SV=1
Length=211

 Score =  331 bits (849),  Expect = 4e-114, Method: Composition-based stats.
 Identities = 129/212 (61%), Positives = 163/212 (77%), Gaps = 1/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP PVP GED KD    +R P TS ++ ++ I+YI
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPVPLGEDFKDGTTSNR-PFTSPDKSEELIKYI  59

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEAL+ENNLNLPKM EKDGCFQSGFN+ETCL++I  GLL
Sbjct  60   LGRISAMRKEMCEKYDKCENSKEALSENNLNLPKMTEKDGCFQSGFNQETCLMRITIGLL  119

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQN +E  +    AVQ+STK LIQ L++K K  + ++TP+P T +SLL KLQ
Sbjct  120  EFQIYLDYLQNYYEGDKGNTEAVQISTKALIQLLRQKVKQPEEVSTPNPITGSSLLNKLQ  179

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +NQW+++    LILRS ++FLQ SLRA+R M
Sbjct  180  TENQWMKNTKMILILRSLEDFLQFSLRAVRIM  211


> sp|Q865X6|IL6_LAMGL Interleukin-6 OS=Lama glama OX=9844 GN=IL6 
PE=2 SV=1
Length=211

 Score =  328 bits (842),  Expect = 5e-113, Method: Composition-based stats.
 Identities = 127/212 (60%), Positives = 162/212 (76%), Gaps = 1/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS F PVAFSLGLLLV+  AFP PVP GED KD     ++P TS ++ ++ I+YI
Sbjct  1    MNSLSTSTFSPVAFSLGLLLVMATAFPTPVPLGEDFKDGTTS-KRPFTSPDKTEELIKYI  59

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEAL+ENNLNLPKM EKDGCFQSGFN+ETCL++I  GLL
Sbjct  60   LGRISAMRKEMCEKYDKCENSKEALSENNLNLPKMTEKDGCFQSGFNQETCLMRITIGLL  119

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL+YLQN +E  +    AVQ+STK LIQ L++K K  + ++TP+P T +SLL KLQ
Sbjct  120  EFQIYLDYLQNYYEGDKGNTEAVQISTKALIQLLRQKVKQPEEVSTPNPITGSSLLNKLQ  179

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +NQW+++    LILRS ++FLQ SLRA+R M
Sbjct  180  TENQWMKNTKMILILRSLEDFLQFSLRAVRIM  211


> sp|Q9XT80|IL6_DELLE Interleukin-6 OS=Delphinapterus leucas OX=9749 
GN=IL6 PE=2 SV=1
Length=208

 Score =  327 bits (838),  Expect = 2e-112, Method: Composition-based stats.
 Identities = 127/212 (60%), Positives = 155/212 (73%), Gaps = 6/212 (3%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS ST     +AFSLGLLLV   AFP P P GED KD     R  LTS ++ +  I+YI
Sbjct  1    MNSLST-----IAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISA+RKE C K + CE+SKEALAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGLL
Sbjct  56   LGKISAMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLL  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E  +    AVQ+S K L Q L++K KN D +TTPDPTTNASL+  LQ
Sbjct  116  EYQIYLDYLQNEYEGDKGSIEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQ  175

Query  181  AQN-QWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            +QN  W+++    LILRS + FLQ SLRA+R 
Sbjct  176  SQNDDWMRNTKIILILRSLENFLQFSLRAVRI  207


> sp|A3FBE9|IL6_MUSPF Interleukin-6 OS=Mustela putorius furo OX=9669 
GN=IL6 PE=2 SV=1
Length=210

 Score =  326 bits (835),  Expect = 6e-112, Method: Composition-based stats.
 Identities = 124/212 (58%), Positives = 161/212 (76%), Gaps = 2/212 (1%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAF PVAFSLGLLLV+  AFP P P G DSKD A  +R PLTS+++++  IR+I
Sbjct  1    MNSLSTSAFSPVAFSLGLLLVMATAFPTPGPLGGDSKDDATSNRPPLTSADKMEDFIRFI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+KE C K N CE SKEALAENNLNLPK+AE+D CFQS FN+ETCL +I TGL 
Sbjct  61   LGKISALKKEMCEKYNKCEDSKEALAENNLNLPKLAEEDKCFQSQFNQETCLTRITTGLQ  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L+YL+  +E ++  A +V +STK L+Q L+    N   +TTPDPTT++SL    +
Sbjct  121  EFQIHLKYLEANYEGNKNNAHSVYISTKHLLQKLRPM--NRVEVTTPDPTTDSSLQALFK  178

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q++WL+ +T HLILRS ++FLQ SLRA+R M
Sbjct  179  SQDKWLKHVTIHLILRSLEDFLQFSLRAIRIM  210


> sp|P05231|IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 
PE=1 SV=1
Length=212

 Score =  324 bits (830),  Expect = 3e-111, Method: Composition-based stats.
 Identities = 212/212 (100%), Positives = 212/212 (100%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
Sbjct  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|Q28747|IL6_ORCOR Interleukin-6 (Fragment) OS=Orcinus orca 
OX=9733 GN=IL6 PE=2 SV=1
Length=205

 Score =  321 bits (823),  Expect = 3e-110, Method: Composition-based stats.
 Identities = 123/200 (62%), Positives = 151/200 (76%), Gaps = 1/200 (1%)

Query  13   AFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC  72
            AFSLGLLLV   AFP P P GED KD     R  LTS ++ +  I+YIL  ISA+RKE C
Sbjct  5    AFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLYLTSPDKTEALIKYILGKISAMRKEMC  64

Query  73   NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNR  132
             K + CE+SKEALAENNLNLPKMAEKDGCFQSGFN+ETCL++I TGLLE+++YL+YLQN 
Sbjct  65   EKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLLEYQIYLDYLQNE  124

Query  133  FESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQN-QWLQDMTT  191
            +E  +E   AVQ+S+K L Q L++K KN D +TTPDPTTNASL+  LQ+QN  W+++   
Sbjct  125  YEGDKEAIEAVQISSKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQSQNDDWMKNTKI  184

Query  192  HLILRSFKEFLQSSLRALRQ  211
             LILRS + FLQ SLRA+R 
Sbjct  185  ILILRSLENFLQFSLRAIRI  204


> sp|P41683|IL6_FELCA Interleukin-6 OS=Felis catus OX=9685 GN=IL6 
PE=2 SV=1
Length=208

 Score =  321 bits (822),  Expect = 4e-110, Method: Composition-based stats.
 Identities = 123/212 (58%), Positives = 157/212 (74%), Gaps = 4/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M   STSAF P+AFSLGLLLV+  AFP P P G D    A  +R PLTS++++++ I+YI
Sbjct  1    MTFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGD----ATSNRLPLTSADKMEELIKYI  56

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+KE C+  N CE SKEALAENNLNLPK+AEKDGCFQSGFN+ETCL +I TGL 
Sbjct  57   LGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKDGCFQSGFNQETCLTRITTGLQ  116

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YL++LQ+++E  EE A++V  ST VL+Q L++K KN D +T P PT    L  KLQ
Sbjct  117  EFQIYLKFLQDKYEGDEENAKSVYTSTNVLLQMLKRKGKNQDEVTIPVPTVEVGLQAKLQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q +WL+  T HL LR  ++FLQ SLRA+R M
Sbjct  177  SQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM  208


> sp|P79341|IL6_MACFA Interleukin-6 OS=Macaca fascicularis OX=9541 
GN=IL6 PE=2 SV=1
Length=212

 Score =  318 bits (815),  Expect = 7e-109, Method: Composition-based stats.
 Identities = 205/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|Q5I6E3|IL6_MACTH Interleukin-6 OS=Macaca thibetana OX=54602 
GN=IL6 PE=2 SV=1
Length=212

 Score =  318 bits (814),  Expect = 8e-109, Method: Composition-based stats.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTK LIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKALIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|P41323|IL6_CANLF Interleukin-6 OS=Canis lupus familiaris OX=9615 
GN=IL6 PE=2 SV=1
Length=207

 Score =  317 bits (812),  Expect = 1e-108, Method: Composition-based stats.
 Identities = 125/212 (59%), Positives = 159/212 (75%), Gaps = 5/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS     AFSLGLLLV+  AFP P P   DSKD A  +  PLTS+ ++++ I+YI
Sbjct  1    MNSLSTS-----AFSLGLLLVMATAFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISALRKE C+K N CE SKEALAENNL+LPK+  KDGCFQSGFN+ETCL +I TGL+
Sbjct  56   LGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLV  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L  LQN +E  +E  ++V MSTK+L+Q L+ K KN D +TTPDPTT+ASL   LQ
Sbjct  116  EFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQ  175

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +Q++ ++  T HLILRS ++FLQ SLRA+R M
Sbjct  176  SQDECVKHTTIHLILRSLEDFLQFSLRAVRIM  207


> sp|Q28819|IL6_PHOVI Interleukin-6 (Fragment) OS=Phoca vitulina 
OX=9720 GN=IL6 PE=2 SV=1
Length=209

 Score =  317 bits (811),  Expect = 2e-108, Method: Composition-based stats.
 Identities = 127/208 (61%), Positives = 163/208 (78%), Gaps = 0/208 (0%)

Query  5    STSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGI  64
             TSAF PVAFSLGLLLV+  AFP P P G +S+  A  +R PLTS +++++ I+YIL  I
Sbjct  2    FTSAFSPVAFSLGLLLVMATAFPTPGPVGGESQADATSNRPPLTSPDKMEEFIKYILGKI  61

Query  65   SALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEV  124
            SALRKE C+K N CE SKEALAENNL LPK+AEKDGCFQSGFN+ETCL +I TGLLEF++
Sbjct  62   SALRKEMCDKYNKCEDSKEALAENNLRLPKLAEKDGCFQSGFNQETCLTRITTGLLEFQI  121

Query  125  YLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQ  184
            +L+Y+Q  +E ++E A +V +STK+L+Q L KK K+ D +TTPDPTT+ SL   L+AQ++
Sbjct  122  HLKYIQANYEGNKEDANSVYISTKLLVQMLMKKVKSQDEVTTPDPTTDTSLQAILKAQDK  181

Query  185  WLQDMTTHLILRSFKEFLQSSLRALRQM  212
            WL+  T HLILRS ++FLQ SLRA+R M
Sbjct  182  WLKHTTIHLILRSLEDFLQFSLRAVRIM  209


> sp|Q8MKH0|IL6_SAISC Interleukin-6 OS=Saimiri sciureus OX=9521 
GN=IL6 PE=2 SV=1
Length=212

 Score =  317 bits (811),  Expect = 3e-108, Method: Composition-based stats.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M SFSTSAF PVAFSLGLLLV+PAAFPAPV  GEDSK+VAAP+RQ LTS+ERIDK I YI
Sbjct  1    MTSFSTSAFRPVAFSLGLLLVMPAAFPAPVTLGEDSKEVAAPNRQLLTSTERIDKHIWYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKE CNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCL+KI TGLL
Sbjct  61   LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESS+EQA AVQMSTK LIQ LQ+KAKNL AI TPDP TNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQRKAKNLSAIATPDPATNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQ+QWLQ +TTHLILRSFKEFLQ SLRALRQM
Sbjct  181  AQDQWLQGVTTHLILRSFKEFLQCSLRALRQM  212


> sp|P51494|IL6_MACMU Interleukin-6 OS=Macaca mulatta OX=9544 GN=IL6 
PE=2 SV=1
Length=212

 Score =  316 bits (810),  Expect = 4e-108, Method: Composition-based stats.
 Identities = 204/212 (96%), Positives = 209/212 (99%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPV PGEDSK+VAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQS+LRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSNLRALRQM  212


> sp|P46650|IL6_CERAT Interleukin-6 OS=Cercocebus atys OX=9531 
GN=IL6 PE=2 SV=1
Length=212

 Score =  316 bits (809),  Expect = 5e-108, Method: Composition-based stats.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNSFSTSAFGPVAFSLGLLLVLPAAFPAPV PGEDSKDVAAPH QPLTSSERIDK IRYI
Sbjct  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            LDGISALRKETCN+SNMC+S+KEALAENNLNLPKMAEKDGCFQSGFNE+TCLVKIITGLL
Sbjct  61   LDGISALRKETCNRSNMCDSTKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQ LQKKAKNLDAITTP+PTTNASLLTKLQ
Sbjct  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQLLQKKAKNLDAITTPEPTTNASLLTKLQ  180

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sbjct  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212


> sp|Q95181|IL6_HORSE Interleukin-6 OS=Equus caballus OX=9796 GN=IL6 
PE=2 SV=2
Length=208

 Score =  310 bits (795),  Expect = 6e-106, Method: Composition-based stats.
 Identities = 129/212 (61%), Positives = 161/212 (76%), Gaps = 4/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS   PVAFSLGLLLV+  AFP P+P GED       +   LT++++  + I+YI
Sbjct  1    MNSLSTSTVTPVAFSLGLLLVMATAFPTPLPLGED---ETTSNGPLLTTADKTKQHIKYI  57

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISAL+ E CN  + CE+SKE LAENNLNLPKMAEKDGCFQSGFN+ETCL+KI TGL 
Sbjct  58   LGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLS  117

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF++YLEYLQN F+  +E  + +Q+STKVL+Q L +K KN   +TTPDPT  +SLL KL 
Sbjct  118  EFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNP-EVTTPDPTAKSSLLAKLH  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+WL++ TTHLILRS ++FLQ SLRA+R M
Sbjct  177  SQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM  208


> sp|Q25BC2|IL6_VULVU Interleukin-6 OS=Vulpes vulpes OX=9627 GN=IL6 
PE=2 SV=1
Length=207

 Score =  300 bits (768),  Expect = 8e-102, Method: Composition-based stats.
 Identities = 127/212 (60%), Positives = 159/212 (75%), Gaps = 5/212 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS STS     AFSLGLLLV+  AFP P P   DSKD A     PLTS+ ++++ I+YI
Sbjct  1    MNSLSTS-----AFSLGLLLVMATAFPTPGPLAGDSKDDATSISLPLTSANKVEELIKYI  55

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  ISALRKE C+K N CE SKEALAENNL+LP +  KDGCFQSGFN+ETCL +I TGL+
Sbjct  56   LGKISALRKEMCDKFNKCEDSKEALAENNLHLPILEGKDGCFQSGFNQETCLTRITTGLM  115

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            EF+++L  LQN +E  +E A++V MSTK+L+Q L+ K KN D +TTPDPTT+A+L   LQ
Sbjct  116  EFQLHLNILQNNYEGDKENAQSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDATLQAILQ  175

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            +QN+WL+  T HLILRS ++FLQ SLRA+R M
Sbjct  176  SQNEWLKHTTIHLILRSLEDFLQFSLRAVRIM  207


> sp|P26892|IL6_BOVIN Interleukin-6 OS=Bos taurus OX=9913 GN=IL6 
PE=2 SV=1
Length=208

 Score =  296 bits (759),  Expect = 2e-100, Method: Composition-based stats.
 Identities = 109/210 (52%), Positives = 147/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSKE LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E ++E  R ++ + + LIQ L++K  +L       P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIADL----ITTPATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|Q2MH06|IL6_BUBCA Interleukin-6 OS=Bubalus carabanensis OX=346063 
GN=IL6 PE=2 SV=1
Length=208

 Score =  296 bits (758),  Expect = 2e-100, Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 146/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSK+ LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKDTLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E + E  R ++ + + LIQ L++K  +L       P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNRENVRDLRKNIRTLIQILKQKIADL----ITTPATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|Q6V919|IL6_BUBBU Interleukin-6 OS=Bubalus bubalis OX=89462 
GN=IL6 PE=2 SV=1
Length=208

 Score =  296 bits (758),  Expect = 2e-100, Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 146/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I+ +
Sbjct  1    MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CESSK+ LAEN LNLPKM EKDGCFQSGFN+  CL++   GLL
Sbjct  61   VDKISAMRKEICEKNDECESSKDTLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL+YLQN +E + E  R ++ + + LIQ L++K  +L       P TN  LL K+Q
Sbjct  121  EYQIYLDYLQNEYEGNRENVRDLRKNIRTLIQILKQKIADL----ITTPATNTDLLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    LILR+ + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKIILILRNLENFLQFSLRAIR  206


> sp|Q28319|IL6_CAPHI Interleukin-6 OS=Capra hircus OX=9925 GN=IL6 
PE=2 SV=1
Length=208

 Score =  291 bits (746),  Expect = 2e-98, Method: Composition-based stats.
 Identities = 109/210 (52%), Positives = 146/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P+A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I++I
Sbjct  1    MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CE+SKE LAEN L LPKM EKDGCFQSGFN+  CL+K   GLL
Sbjct  61   VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL++LQN FE ++E    +Q S + LIQ L++K   L       P TN  +L K+Q
Sbjct  121  EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGL----ITTPATNTDMLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    +ILRS + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKVIIILRSLENFLQFSLRAIR  206


> sp|P29455|IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 
PE=2 SV=2
Length=208

 Score =  290 bits (743),  Expect = 4e-98, Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 146/210 (70%), Gaps = 4/210 (2%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            MNS  TSAF P+A SLGLLLV+ +AFP P P GED K+   P R  LT+ E+ +  I++I
Sbjct  1    MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI  60

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +D ISA+RKE C K++ CE+SKE LAEN L LPKM EKDGCFQSGFN+  CL+K   GLL
Sbjct  61   VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL  120

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E+++YL++LQN FE ++E    +Q S + LIQ L++K   L       P T+  +L K+Q
Sbjct  121  EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGL----ITTPATHTDMLEKMQ  176

Query  181  AQNQWLQDMTTHLILRSFKEFLQSSLRALR  210
            + N+W+++    +ILRS + FLQ SLRA+R
Sbjct  177  SSNEWVKNAKVIIILRSLENFLQFSLRAIR  206


> sp|P08505|IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 
PE=1 SV=1
Length=211

 Score =  269 bits (688),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 87/212 (41%), Positives = 134/212 (63%), Gaps = 3/212 (1%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M   S   F PVAF LGL+LV   AFP       D  +   P+R P+ ++ ++   I ++
Sbjct  1    MKFLSARDFHPVAF-LGLMLVTTTAFPTSQVRRGDFTEDTTPNR-PVYTTSQVGGLITHV  58

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  I  +RKE CN ++ C ++ +ALAENNL LP++   DGC+Q+G+N+E CL+KI +GLL
Sbjct  59   LWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLL  118

Query  121  EFEVYLEYLQNRF-ESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKL  179
            E+  YLEY++N   ++ +++AR +Q  T+ LI    ++ K+L  I  P P +NA L  KL
Sbjct  119  EYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKL  178

Query  180  QAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            ++Q +WL+  T   IL+S +EFL+ +LR+ RQ
Sbjct  179  ESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQ  210


> sp|P20607|IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 
GN=Il6 PE=2 SV=1
Length=211

 Score =  259 bits (663),  Expect = 7e-86, Method: Composition-based stats.
 Identities = 85/212 (40%), Positives = 137/212 (65%), Gaps = 3/212 (1%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M   S   F PVAF LGL+L+   AFP       D  +    +R P+ ++ ++   I Y+
Sbjct  1    MKFLSARDFQPVAF-LGLMLLTATAFPTSQVRRGDFTEDTTHNR-PVYTTSQVGGLITYV  58

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            L  I  +RKE CN ++ C +S +AL+ENNL LP++   DGCFQ+G+N+E CL+KI +GLL
Sbjct  59   LREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLL  118

Query  121  EFEVYLEYLQNRF-ESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKL  179
            EF  YLE+++N   ++ +++AR +Q +T+ L+   +++ K+   I  P PT+NA L+ KL
Sbjct  119  EFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKL  178

Query  180  QAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            ++Q +WL+  T  LIL++ +EFL+ ++R+ RQ
Sbjct  179  ESQKEWLRTKTIQLILKALEEFLKVTMRSTRQ  210


> sp|O35736|IL6_MARMO Interleukin-6 OS=Marmota monax OX=9995 GN=IL6 
PE=2 SV=1
Length=207

 Score =  257 bits (656),  Expect = 5e-85, Method: Composition-based stats.
 Identities = 95/213 (45%), Positives = 140/213 (66%), Gaps = 9/213 (4%)

Query  1    MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI  60
            M  FS +       SLGLLLV+  AFPA     ED ++    ++    SS +  +QI Y+
Sbjct  1    MKFFSIA-------SLGLLLVVATAFPASELQREDGENSVTRNKPTRASSGKTRRQISYL  53

Query  61   LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL  120
            +  +  +RKE C     C  S  A++ENNLNLPKM EKDGCFQ+G+N + CLV+I +GLL
Sbjct  54   IKEVFEMRKELCKNDETCIKSHVAVSENNLNLPKMTEKDGCFQTGYNRDDCLVRITSGLL  113

Query  121  EFEVYLEYLQNRFE--SSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK  178
            EF+VYL Y++N+F+  ++ ++A  VQ S+K LI+ L+++ K+ + I  P PT N +LL K
Sbjct  114  EFQVYLRYIRNKFQEGNNRDRAEHVQSSSKALIEILKQEVKDPNKIVFPSPTANINLLAK  173

Query  179  LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
            L++QN W + MT  LIL +F++FLQ +LRA+R+
Sbjct  174  LESQNDWQKVMTMQLILSNFEDFLQFTLRAVRK  206


> sp|Q9MZR1|IL6_RABIT Interleukin-6 OS=Oryctolagus cuniculus OX=9986 
GN=IL6 PE=2 SV=1
Length=241

 Score =  253 bits (646),  Expect = 6e-83, Method: Composition-based stats.
 Identities = 102/216 (47%), Positives = 132/216 (61%), Gaps = 6/216 (3%)

Query  1    MNSFSTSAF--GPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIR  58
            MNSF TSA   GP+  SL LLLV+  AFP   P  EDS   A+P +  LT   R  + IR
Sbjct  1    MNSF-TSALRPGPLGCSLALLLVVATAFPTSAPVREDSNTKASPDK-TLTPPGRTIESIR  58

Query  59   YILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITG  118
             IL+ I  LRKE C+    C + KEALAE NL+LP++ E+DGCF    N ETCL++I +G
Sbjct  59   SILETIKELRKEMCDHDVNCMNRKEALAEVNLHLPRLIEEDGCFPPAVNNETCLLRITSG  118

Query  119  LLEFEVYLEYLQNRFESSEEQARA--VQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLL  176
            L+EF +YLE+LQ +F S EE  R   V  + + LI+ L+ K KNL+   T  P    SL+
Sbjct  119  LMEFRMYLEHLQAKFRSDEENTRVSMVLKNIQHLIKTLRPKVKNLNEEATLKPAVAVSLM  178

Query  177  TKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
              LQ +NQWL+  T H ILR    FL+ +LRA+  M
Sbjct  179  ENLQQKNQWLKTTTIHFILRGLTNFLEFTLRAVDLM  214


> sp|Q90YI0|IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 
PE=2 SV=1
Length=241

 Score =  211 bits (537),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 3/180 (2%)

Query  33   GEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNL  92
            GE   +  A  R+ L   E + + +R   D    L+ E C K  +CE+S E L  NNLNL
Sbjct  57   GEVGLEEEAGARRALLDCEPLARVLR---DRAVQLQDEMCKKFTVCENSMEMLVRNNLNL  113

Query  93   PKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQ  152
            PK+ E+DGC  +GF+EE CL K+ +GL  F+ YLE++Q  F+S ++   ++  STK L  
Sbjct  114  PKVTEEDGCLLAGFDEEKCLTKLSSGLFAFQTYLEFIQETFDSEKQNVESLCYSTKHLAA  173

Query  153  FLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
             +++   N D +  PD     SLL  L++   W++ +T HLILR F  F++ ++RA+R +
Sbjct  174  TIRQMVINPDEVVIPDSAAQKSLLANLKSDKDWIEKITMHLILRDFTSFMEKTVRAVRYL  233


> sp|P41693|IL6_NEOVI Interleukin-6 (Fragment) OS=Neovison vison 
OX=452646 GN=IL6 PE=2 SV=1
Length=125

 Score =  182 bits (461),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 67/127 (53%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  86   AENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQM  145
            AENNL LPK+AEKD CFQS FN+ETC+ +I TGL EF+++L+YL+  +E ++  A +V +
Sbjct  1    AENNLKLPKLAEKDKCFQSQFNQETCMTRITTGLQEFQIHLKYLEANYEGNKNNAHSVYI  60

Query  146  STKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSS  205
            STK L+Q L+    N   +TTP+PTT++SL    ++Q++WL+ +T HLILRS ++FLQ S
Sbjct  61   STKHLLQKLRPM--NQVEVTTPNPTTDSSLQALFKSQDKWLKHVTIHLILRSLEDFLQFS  118

Query  206  LRALRQM  212
            LRA+R M
Sbjct  119  LRAIRIM  125


> sp|Q2HRC7|VIL6_HHV8P Viral interleukin-6 homolog OS=Human herpesvirus 
8 type P (isolate GK18) OX=868565 GN=K2 PE=1 SV=1
Length=204

 Score =  184 bits (467),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 42/167 (25%), Positives = 80/167 (48%), Gaps = 0/167 (0%)

Query  46   PLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSG  105
            P    + + +++ ++L  I    ++ C ++ +C+   E  A  +L LP + + D C   G
Sbjct  28   PEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIG  87

Query  106  FNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAIT  165
            FNE +CL K+  G  EFEV  ++L   F  S      +++ TK L   +Q++   L    
Sbjct  88   FNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTH  147

Query  166  TPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
               P  +  LL +LQ    W++   +  +L + ++F   ++R L  +
Sbjct  148  YSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSI  194


> sp|P13854|MGF_CHICK Myelomonocytic growth factor OS=Gallus gallus 
OX=9031 PE=2 SV=1
Length=201

 Score =  155 bits (391),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 37/161 (23%), Positives = 69/161 (43%), Gaps = 3/161 (2%)

Query  52   RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETC  111
            +  +  R I   ++AL++  C+   +C   +  L + + +L + A  D C + GF  E C
Sbjct  41   KNLEFTRKIRGDVAALQRAVCDTFQLCTEEELQLVQPDPHLVQ-APLDQCHKRGFQAEVC  99

Query  112  LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT  171
              +I  GL  +   L  +     +       +Q+    L   +Q++ ++L   T   P  
Sbjct  100  FTQIRAGLHAYHDSLGAVLRLLPNHTTLVETLQLDAANLSSNIQQQMEDLGLDTVTLPAE  159

Query  172  NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
              S         Q  Q +    IL +F+ FL+++ RALR +
Sbjct  160  QRSPPPTFSGPFQ--QQVGGFFILANFQRFLETAYRALRHL  198


> sp|A0S0B0|IL6_PAROL Interleukin-6 OS=Paralichthys olivaceus OX=8255 
GN=il6 PE=2 SV=1
Length=230

 Score =  145 bits (366),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 40/185 (22%), Positives = 76/185 (41%), Gaps = 10/185 (5%)

Query  27   PAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALA  86
            P   P G D           L S+  +   I   +   +  +KE  ++        +   
Sbjct  31   PTDSPAG-DFSGEEQEVTPDLLSASPVWDLI---IGVTAHHQKEFEDEFQ---QEVKYRF  83

Query  87   ENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS  146
             N+  L  +     C  + F++E CL ++  GL  + V  ++++  + SS     A +  
Sbjct  84   LNHYKLSSLPAD--CPSANFSKEACLQRLAEGLHTYMVLFKHVEKEYPSSSILLHA-RYH  140

Query  147  TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSL  206
            +  LI  +++K +N   +T P       LL  +   + + + MT H ILR    FL++  
Sbjct  141  SGALIGLIKEKMRNPGQVTVPTSRQEQQLLQDMDNPSTFHRKMTAHNILRQLHNFLRNGK  200

Query  207  RALRQ  211
             A+R+
Sbjct  201  VAIRK  205


> sp|Q6L6X6|IL6_TAKRU Interleukin-6 OS=Takifugu rubripes OX=31033 
GN=il6 PE=2 SV=1
Length=227

 Score =  132 bits (333),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 77/185 (42%), Gaps = 10/185 (5%)

Query  27   PAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALA  86
            P   P GE S + A          + +   +  +L      + E   +    E   + L 
Sbjct  28   PTESPAGETSGEEAETGSP----DDALAVALESVLGATKLHKNEFLVEFQG-EVKYDFL-  81

Query  87   ENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS  146
             +   +P +  K  C  S F ++ CL +++ GLL + V L+ ++  F SS   +  V+  
Sbjct  82   -DRYKIPSLPAK--CPYSNFGKDACLRRLLEGLLIYSVLLKRVEEEFPSSSILSE-VRFY  137

Query  147  TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSL  206
            + +LI+ L+ K ++ D +     +    LL      + + + MT H IL +   FL    
Sbjct  138  SNILIKELENKVRDRDQVMRLTSSQEEQLLKDTDYPDTFHRKMTAHGILYNLHYFLVDCR  197

Query  207  RALRQ  211
            R + +
Sbjct  198  RVINK  202


> sp|Q0GGL7|IL6_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 
GN=il6 PE=2 SV=1
Length=219

 Score =  125 bits (314),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 44/205 (21%), Positives = 91/205 (44%), Gaps = 16/205 (8%)

Query  10   GPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALR-  68
             PV  +L  L  + + + +    G D +  A P         + +K I+ ++  ++ LR 
Sbjct  21   NPVPSALAEL--MTSGWTSGEELGTDGETGAPP---------KWEKMIKMLVHEVTTLRN  69

Query  69   KETCNKSNMCESSKEALAENN-LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLE  127
            ++   +         + +++   + P    K  C  S  N+E CL +I  GL  +++ L+
Sbjct  70   QQFVEEFQKPVEEISSFSQHQVPSTPPHLSKTLC--SASNKEACLQEISRGLQVYQLLLQ  127

Query  128  YLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQ  187
            +++  +  S     +V   T VLI  ++ + K  + +     +    +L ++    +W +
Sbjct  128  HVKAEYPQST-LLPSVTHQTTVLIGLVKDQMKVAEVVEDLSASERKRVLGEVSTGTEWER  186

Query  188  DMTTHLILRSFKEFLQSSLRALRQM  212
              + H ILR  + FL  + RALR+M
Sbjct  187  KTSVHAILRELRNFLVDTKRALRRM  211


> sp|B6CKP4|IL6_SPAAU Interleukin-6 OS=Sparus aurata OX=8175 GN=il6 
PE=2 SV=1
Length=225

 Score = 99.8 bits (247),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 39/187 (21%), Positives = 84/187 (45%), Gaps = 13/187 (7%)

Query  25   AFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEA  84
            AF    P G+ S +     R     ++ +   ++ +L+ I   R+E   + ++     + 
Sbjct  30   AF-TDNPAGDTSGEEWETERP----ADPLIALLKVVLEVIKTHRQEFEAEFHI---RYDV  81

Query  85   LAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQ  144
            LA+   N+P +     C  + F+ E  L +++ GL  +   L+Y++     S+  +R  +
Sbjct  82   LAQ--YNIPSLPAD--CPSTNFSMEALLHRLLQGLPVYTALLKYVEKEEPKSQIPSR-FR  136

Query  145  MSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQS  204
             ++++L Q +  K ++   +T    +    LL  L + + + + MT H IL   + FL  
Sbjct  137  QNSELLKQRITGKMRHAVQVTPLTSSQEQQLLRDLDSSDTFHRKMTAHSILYQLRSFLVD  196

Query  205  SLRALRQ  211
               A+ +
Sbjct  197  CKNAINK  203


> sp|P35834|CSF3_CANLF Granulocyte colony-stimulating factor OS=Canis 
lupus familiaris OX=9615 GN=CSF3 PE=1 SV=1
Length=175

 Score = 73.2 bits (178),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 62/160 (39%), Gaps = 5/160 (3%)

Query  52   RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETC  111
            +  +Q+R +    +AL++  C    +C   +  L  + L +P+      C         C
Sbjct  17   KCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQ-PPLSSCSSQALQLMGC  75

Query  112  LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT  171
            L ++ +GL  ++  L+ L             +Q+ T      + ++ ++L       PT 
Sbjct  76   LRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQ  135

Query  172  NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
                +    +  Q  +     L+  + + FL+ + RALR 
Sbjct  136  GT--MPAFTSAFQ--RRAGGVLVASNLQSFLELAYRALRH  171


> sp|P09919|CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo 
sapiens OX=9606 GN=CSF3 PE=1 SV=1
Length=207

 Score = 73.6 bits (179),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 31/164 (19%), Positives = 63/164 (38%), Gaps = 8/164 (5%)

Query  52   RIDKQIRYILDGISALRKET---CNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE  108
            +  +Q+R I    +AL+++    C    +C   +  L  ++L +P  A    C       
Sbjct  46   KCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIP-WAPLSSCPSQALQL  104

Query  109  ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPD  168
              CL ++ +GL  ++  L+ L+            +Q+        + ++ + L       
Sbjct  105  AGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQ  164

Query  169  PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            PT  A  +    +  Q  +     L+    + FL+ S R LR +
Sbjct  165  PTQGA--MPAFASAFQ--RRAGGVLVASHLQSFLEVSYRVLRHL  204


> sp|P09920|CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus 
musculus OX=10090 GN=Csf3 PE=1 SV=1
Length=208

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 76/193 (39%), Gaps = 18/193 (9%)

Query  20   LVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCE  79
            LV  +A P  +P              P +   +  +Q+R I    S L ++ C    +C 
Sbjct  33   LVTVSALPPSLPL-------------PRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCH  79

Query  80   SSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQ  139
              +  L  ++L +PK A   GC      +  CL ++ +GL  ++  L+ L     +    
Sbjct  80   PEELVLLGHSLGIPK-ASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPT  138

Query  140  ARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFK  199
               +Q+        + ++ +NL    T  PT +A  +    +  Q  +     L +   +
Sbjct  139  LDLLQLDVANFATTIWQQMENLGVAPTVQPTQSA--MPAFTSAFQ--RRAGGVLAISYLQ  194

Query  200  EFLQSSLRALRQM  212
             FL+++  AL  +
Sbjct  195  GFLETARLALHHL  207


> sp|O02708|CSF3_FELCA Granulocyte colony-stimulating factor (Fragment) 
OS=Felis catus OX=9685 GN=CSF3 PE=2 SV=1
Length=194

 Score = 71.2 bits (173),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 28/160 (18%), Positives = 62/160 (39%), Gaps = 5/160 (3%)

Query  52   RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETC  111
            +  +Q+R +    +AL++  C    +C   +  L  + L +P+ A    C         C
Sbjct  36   KCLEQVRKVQADGTALQERLCAAHKLCHPEELVLLGHALGIPQ-APLSSCSSQALQLTGC  94

Query  112  LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT  171
            L ++ +GL  ++  L+ L             +Q+        + ++ +++       PT 
Sbjct  95   LRQLHSGLFLYQGLLQALAGISPELAPTLDMLQLDITDFAINIWQQMEDVGMAPAVPPTQ  154

Query  172  NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ  211
                +    +  Q  +     L+  + + FL+ + RALR 
Sbjct  155  GT--MPTFTSAFQ--RRAGGTLVASNLQSFLEVAYRALRH  190


> sp|O02837|CSF3_PIG Granulocyte colony-stimulating factor OS=Sus 
scrofa OX=9823 GN=CSF3 PE=2 SV=2
Length=195

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/161 (19%), Positives = 62/161 (39%), Gaps = 5/161 (3%)

Query  52   RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETC  111
            +  +Q+R I    + L++  C    +C   +  L  ++L LP+ A    C         C
Sbjct  37   KCLEQVRKIQADGAELQERLCATHKLCHPQELVLLGHSLGLPQ-ASLSSCSSQALQLTGC  95

Query  112  LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT  171
            L ++  GL+ ++  L+ L             +Q+    L   +  + ++L       PT 
Sbjct  96   LNQLHGGLVLYQGLLQALAGISPELAPALDILQLDVTDLATNIWLQMEDLRMAPASLPTQ  155

Query  172  NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
                +    +  Q  +     L++   + FL+ + R LR +
Sbjct  156  GT--VPTFTSAFQ--RRAGGVLVVSQLQSFLELAYRVLRYL  192


> sp|P35833|CSF3_BOVIN Granulocyte colony-stimulating factor OS=Bos 
taurus OX=9913 GN=CSF3 PE=1 SV=2
Length=195

 Score = 65.1 bits (157),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/178 (18%), Positives = 65/178 (37%), Gaps = 9/178 (5%)

Query  39   VAAPHRQPLTSSE----RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK  94
             A P     +  +    +  +Q+R I    + L++  C    +C   +  L  ++L +P+
Sbjct  20   EATPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQ  79

Query  95   MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFL  154
             A    C        +CL ++  GL  ++  L+ L             +Q+        +
Sbjct  80   -APLSSCSSQSLQLTSCLNQLHGGLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNI  138

Query  155  QKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
              + ++L A     PT  A  +    +  Q  +     L+      FL+ + R LR +
Sbjct  139  WLQMEDLGAAPAVQPTQGA--MPTFTSAFQ--RRAGGVLVASQLHRFLELAYRGLRYL  192


> sp|Q28746|CSF3_SHEEP Granulocyte colony-stimulating factor OS=Ovis 
aries OX=9940 GN=CSF3 PE=2 SV=1
Length=174

 Score = 61.2 bits (147),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 59/161 (37%), Gaps = 5/161 (3%)

Query  52   RIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETC  111
            +  +Q+R I    + L++  C    +C   +  L  ++L +P+ A    C        +C
Sbjct  16   KCLEQVRKIQADGAELQERLCATHKLCHPEELVLLGHSLGIPQ-APLSSCSSQSLQLTSC  74

Query  112  LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT  171
            L ++  GL  ++  L+ L             +Q+        +  + ++L       PT 
Sbjct  75   LDQLHGGLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDLGVAPAVQPTQ  134

Query  172  NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM  212
                +    +  Q  +     L+    + FL  + R LR +
Sbjct  135  GT--MPTFTSAFQ--RRAGGVLVASQLQRFLGLAYRGLRYL  171


> sp|Q9EQ14|IL23A_MOUSE Interleukin-23 subunit alpha OS=Mus musculus 
OX=10090 GN=Il23a PE=1 SV=1
Length=196

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/130 (22%), Positives = 48/130 (37%), Gaps = 9/130 (7%)

Query  81   SKEALAENNLNLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEYLQNRFESSEE  138
             +E   E   N+P++  +DGC   G   N + CL +I  GL  ++  L+   + F+    
Sbjct  58   REEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLD--SDIFKGEPA  115

Query  139  QARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSF  198
                  M           +    +     D       +  L +  QW + +    ILRS 
Sbjct  116  LLPDSPMEQLHTSLLGLSQLLQPE-----DHPRETQQMPSLSSSQQWQRPLLRSKILRSL  170

Query  199  KEFLQSSLRA  208
            + FL  + R 
Sbjct  171  QAFLAIAARV  180


> sp|Q91Z84|IL23A_RAT Interleukin-23 subunit alpha OS=Rattus norvegicus 
OX=10116 GN=Il23a PE=2 SV=1
Length=196

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 53/131 (40%), Gaps = 11/131 (8%)

Query  81   SKEALAENNLNLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEY-LQNRFESSE  137
             +E   E   ++P++   DGC   G   N + CL +I  GL+ ++  L+  +     S  
Sbjct  58   REEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLL  117

Query  138  EQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRS  197
              +   Q+ T +L      + ++    T          + +L    QW + +    ILRS
Sbjct  118  PDSPVDQLHTSLLGLSQLLQPEDHHWET--------QQMPRLSPSQQWQRSLLRSKILRS  169

Query  198  FKEFLQSSLRA  208
             + FL  + R 
Sbjct  170  LQAFLAIAARV  180


> sp|Q64FU1|IL23A_HORSE Interleukin-23 subunit alpha OS=Equus caballus 
OX=9796 GN=IL23A PE=3 SV=1
Length=192

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/134 (24%), Positives = 54/134 (40%), Gaps = 17/134 (13%)

Query  81   SKEALAENNLNLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEY-LQNRFESSE  137
             +E  AE   ++P +  +DGC   G   N + CL +I  GL+ +E  L   +     S  
Sbjct  60   REEGDAETTNDVPHIQCEDGCDPEGLRDNSQPCLQRIHQGLVFYEKLLGSDIFTGEPSLL  119

Query  138  EQARAVQMSTKVLI--QFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQ-WLQDMTTHLI  194
                  Q+   +L   Q LQ +  + +    P P           + +Q W + +    I
Sbjct  120  PNGPVDQLHASLLGLRQLLQPEGHHWETEQIPSP-----------SPSQPWQRLLLRPKI  168

Query  195  LRSFKEFLQSSLRA  208
            LRS + F+  + R 
Sbjct  169  LRSLQAFVAVAARV  182


> sp|Q9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha OS=Homo sapiens 
OX=9606 GN=IL23A PE=1 SV=1
Length=189

 Score = 38.5 bits (88),  Expect = 0.017, Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 62/181 (34%), Gaps = 18/181 (10%)

Query  31   PPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNL  90
            P     + V        T  +++ +++  +      L        ++ E   E   E   
Sbjct  14   PWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHM----DLREEGDE---ETTN  66

Query  91   NLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEY-LQNRFESSEEQARAVQMST  147
            ++P +   DGC   G   N + CL +I  GL+ +E  L   +     S    +   Q+  
Sbjct  67   DVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHA  126

Query  148  KVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLR  207
             +L      + +     T   P+        L     W + +    ILRS + F+  + R
Sbjct  127  SLLGLSQLLQPEGHHWETQQIPS--------LSPSQPWQRLLLRFKILRSLQAFVAVAAR  178

Query  208  A  208
             
Sbjct  179  V  179


> sp|Q9N2H9|IL23A_PIG Interleukin-23 subunit alpha OS=Sus scrofa 
OX=9823 GN=IL23A PE=3 SV=1
Length=193

 Score = 38.1 bits (87),  Expect = 0.029, Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 13/99 (13%)

Query  79   ESSKEALAENNLNLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEYLQNRFESS  136
            E   E  +E    +P +   DGC   G   N ++CL +I  GL+ +E  L    + F   
Sbjct  63   EGDDETTSE----VPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLG--SDIFTGE  116

Query  137  EEQ-----ARAVQMSTKVLIQFLQKKAKNLDAITTPDPT  170
                       +  S   L Q LQ +  + +   TP P+
Sbjct  117  PSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPS  155


> sp|Q6LA37|IL23A_CAVPO Interleukin-23 subunit alpha OS=Cavia porcellus 
OX=10141 GN=IL23A PE=2 SV=1
Length=189

 Score = 37.4 bits (85),  Expect = 0.043, Method: Composition-based stats.
 Identities = 27/130 (21%), Positives = 46/130 (35%), Gaps = 10/130 (8%)

Query  81   SKEALAENNLNLPKMAEKDGCFQSGF--NEETCLVKIITGLLEFEVYLEYLQNRFESSEE  138
             +EA  E    +P +   DGC   G   N + CL +I  GL+ ++  L    + F     
Sbjct  58   REEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLG--SDIFTGEPP  115

Query  139  QARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSF  198
                  +S          +      +   +P      +  L     W + +    ILRSF
Sbjct  116  LFPDGPVSQLHASLLGLSQLLQP-EVHQWEPQ-----IPSLSPNQPWQRLLLRIKILRSF  169

Query  199  KEFLQSSLRA  208
            + F+  + R 
Sbjct  170  QAFVAVAARV  179


> sp|Q06194|FA8_MOUSE Coagulation factor VIII OS=Mus musculus OX=10090 
GN=F8 PE=2 SV=2
Length=2319

 Score = 35.8 bits (81),  Expect = 0.33, Method: Composition-based stats.
 Identities = 27/131 (21%), Positives = 50/131 (38%), Gaps = 17/131 (13%)

Query  73    NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNR  132
              K+   E  KEAL E  + LP++ E  G     F ++  ++     +  +EV++  LQN 
Sbjct  1212  EKNIQEEIEKEALIEEKVVLPQVHEATG--SKNFLKDILILGTRQNISLYEVHVPVLQN-  1268

Query  133   FESSEEQARAVQMSTKV--------------LIQFLQKKAKNLDAITTPDPTTNASLLTK  178
               S       VQ+  +               L+   ++  KN  +        +   L +
Sbjct  1269  ITSINNSTNTVQIHMEHFFKRRKDKETNSEGLVNKTREMVKNYPSQKNITTQRSKRALGQ  1328

Query  179   LQAQNQWLQDM  189
              +   QWL+ +
Sbjct  1329  FRLSTQWLKTI  1339


> sp|Q18237|SMC5_CAEEL Structural maintenance of chromosomes protein 
5 OS=Caenorhabditis elegans OX=6239 GN=smc-5 PE=1 SV=2
Length=1076

 Score = 35.4 bits (80),  Expect = 0.34, Method: Composition-based stats.
 Identities = 42/169 (25%), Positives = 72/169 (43%), Gaps = 5/169 (3%)

Query  16   LGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKS  75
            LG   ++   F AP P  +   +V+  +R P   S+ ++K+I  +   I   R      +
Sbjct  525  LGFKYLVSNCFDAPAPLKQFLCNVSGLNRIPFGGSD-VEKKIAEVSQAIEQTRYSVFLTA  583

Query  76   NM-CESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITG--LLEFEVYLEYLQNR  132
            N+ C++SK   A N L       +   ++  F + + + K      L E +     +  R
Sbjct  584  NIRCQNSKSRYANNTLQSQSATREANTWRDQFFKVSPVAKRTDNSILEEIQKLKAEIDIR  643

Query  133  FESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQA  181
             E   E+  A+Q    VL Q  Q + K+   + T   T  AS + KL+A
Sbjct  644  SEQLREKRGAIQKERDVLRQE-QMQWKSKKQVHTKWKTELASEMAKLEA  691


> sp|Q99567|NUP88_HUMAN Nuclear pore complex protein Nup88 OS=Homo 
sapiens OX=9606 GN=NUP88 PE=1 SV=2
Length=741

 Score = 33.9 bits (76),  Expect = 0.99, Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 47/145 (32%), Gaps = 37/145 (26%)

Query  21   VLPAAFPAPVPP---GEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNM  77
            +L    PA  P     ED +   +P R    + +  +K IR IL    A           
Sbjct  494  LLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRSVA-----------  542

Query  78   CESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSE  137
                       N    K +EKD         E CL  +      F         ++   +
Sbjct  543  -----------NPAFLKASEKDIAPPP----EECLQLLSRATQVFR-------EQYILKQ  580

Query  138  EQA-RAVQMSTKVLIQFLQKKAKNL  161
            + A   +Q   K+L    +K+ ++L
Sbjct  581  DLAKEEIQRRVKLLCDQKKKQLEDL  605


> sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo 
sapiens OX=9606 GN=ROCK1 PE=1 SV=1
Length=1354

 Score = 33.5 bits (75),  Expect = 1.6, Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 61/158 (39%), Gaps = 18/158 (11%)

Query  35   DSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK  94
            D++  +   +    S ++   ++   L     L+ E       C +S       N+ L K
Sbjct  413  DNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEM---EQKCRTS-------NIKLDK  462

Query  95   -MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQF  153
             M E D       N E+ + +I       ++ L++  N ++   EQ    + + +  +  
Sbjct  463  IMKELDEEGNQRRNLESTVSQIEKE----KMLLQHRINEYQRKAEQENEKRRNVENEVST  518

Query  154  LQKKAKNLDAITTPDPTTN---ASLLTKLQAQNQWLQD  188
            L+ + ++L  ++      N   + L  +L+  N  L+ 
Sbjct  519  LKDQLEDLKKVSQNSQLANEKLSQLQKQLEEANDLLRT  556


> sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus 
purpuratus OX=7668 PE=2 SV=1
Length=1031

 Score = 33.1 bits (74),  Expect = 1.7, Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 61/171 (36%), Gaps = 5/171 (3%)

Query  21   VLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCES  80
            ++ +        G      AA  +  + + E++D++       +S ++ E    S  C+ 
Sbjct  541  MMASLLKDLGEIGTALGGNAADMKPNVENIEKVDEEFTMARLFVSKMKTEVKTMSQRCKI  600

Query  81   SKEALAENNLNL-PKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQ  139
             + + AEN   +     E D C  +    E  +  +   + E E    +L++        
Sbjct  601  LEASNAENETKIRTSEDELDSCRMTIQQHEAKMKSLSENIRETEGKKRHLEDSL--DMLN  658

Query  140  ARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT--NASLLTKLQAQNQWLQD  188
               V++     I+   ++ K  +        T   AS+  ++++     Q 
Sbjct  659  EEIVKLRAAEEIRLTDQEDKKREEEDKMQSATEMQASMSEQMESHRDAHQK  709


> sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=Emericella 
nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 
/ NRRL 194 / M139) OX=227321 GN=cpr6 PE=3 SV=1
Length=372

 Score = 32.7 bits (73),  Expect = 2.1, Method: Composition-based stats.
 Identities = 16/71 (23%), Positives = 28/71 (39%), Gaps = 11/71 (15%)

Query  115  IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNAS  174
            I  GL +++  L YL N F   EE             + L+ + K+L      + +  A+
Sbjct  231  IALGLEKYQKGLRYL-NEFPEPEENDP----------KDLEPQMKSLRFTLHSNSSLLAN  279

Query  175  LLTKLQAQNQW  185
             L + +    W
Sbjct  280  KLGQFKNGKTW  290


> sp|C4ULG3|AFP18_YERRA Toxin Afp18 OS=Yersinia ruckeri serotype 
O1 (strain ATCC 29473 / DSM 18506 / JCM 15110 / NCIMB 2194 
/ NCTC 12986 / 2396-61) OX=527005 GN=afp18 PE=1 SV=1
Length=2123

 Score = 33.1 bits (74),  Expect = 2.3, Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 5/89 (6%)

Query  124  VYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQN  183
            ++ E +Q+        ++      + L+Q L+ +  N    TT  P T A +L  +++  
Sbjct  634  LFFEVIQHYLP---LLSKETDPQGERLLQRLRLEVSNAAEGTTVYPATMAEILAGMKSTE  690

Query  184  QWLQDMTTHLILRSFKEFLQSSLRALRQM  212
            Q ++D +   +LR    FL + L  ++ M
Sbjct  691  QAIRDWSGRKLLRVV--FLAACLEGVKLM  717


> sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus 
musculus OX=10090 GN=Rock1 PE=1 SV=1
Length=1354

 Score = 32.7 bits (73),  Expect = 2.6, Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 60/164 (37%), Gaps = 18/164 (11%)

Query  29   PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAEN  88
            P     +++  +   +    S ++   ++   L     L+ E       C +S       
Sbjct  407  PSANASENRSSSNVDKSLQESLQKTIYKLEEQLHNEMQLKDEM---EQKCRTS-------  456

Query  89   NLNLPK-MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST  147
            NL L K M E D       N E+ + +I       ++ L++  N ++   EQ    + + 
Sbjct  457  NLKLDKIMKELDEEGNQRRNLESAVSQIEKE----KMLLQHRINEYQRKVEQENEKRRNI  512

Query  148  KVLIQFLQKKAKNLDAITTPDPTTN---ASLLTKLQAQNQWLQD  188
            +  +  L+ + ++L   +      N     L  +L+  N  L+ 
Sbjct  513  ENEVSTLKDQLEDLRKASQTSQLANEKLTQLQKQLEEANDLLRT  556


> sp|B9GE13|KN12F_ORYSJ Kinesin-like protein KIN-12F OS=Oryza sativa 
subsp. japonica OX=39947 GN=KIN12F PE=3 SV=1
Length=2798

 Score = 32.7 bits (73),  Expect = 3.0, Method: Composition-based stats.
 Identities = 34/202 (17%), Positives = 66/202 (33%), Gaps = 37/202 (18%)

Query  23   PAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCN--------K  74
            P  FP        S+++     +     E   K  R     I+ L+ E  N         
Sbjct  784  PNNFPTNFELKRTSQELETCRGELQACLEANKKLAR----EIADLQNELSNIHSSNREGH  839

Query  75   SNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFE  134
             N+ E    AL + + + P+  +KD CFQ GF      +     +L  ++ L+ ++    
Sbjct  840  PNVVEKFSSALNQYDSHAPE--KKDQCFQEGF------MINTDDILNLQLELDIIKTILA  891

Query  135  SSEEQARAVQMSTKVL-----------------IQFLQKKAKNLDAITTPDPTTNASLLT  177
                    V+     L                  + +Q++  +  ++     +    L+ 
Sbjct  892  EERTTRAEVEKRITCLDDELKAANIHILQTCRQSETMQRELSDARSVIEALESQQIMLIN  951

Query  178  KLQAQNQWLQDMTTHLILRSFK  199
            +L    +  Q    HL  R  +
Sbjct  952  ELDELKESNQQSLEHLKKRDLE  973


> sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 
GN=KIF5B PE=1 SV=1
Length=963

 Score = 32.3 bits (72),  Expect = 3.5, Method: Composition-based stats.
 Identities = 24/127 (19%), Positives = 48/127 (38%), Gaps = 10/127 (8%)

Query  64   ISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFE  123
            IS ++ E       C+  +    E+N    KM E +           C ++I     + +
Sbjct  594  ISKMKSEVKTMVKRCKQLESTQTESN---KKMEENEK------ELAACQLRISQHEAKIK  644

Query  124  VYLEYLQNRFESSEEQARAVQMSTKVLIQF-LQKKAKNLDAITTPDPTTNASLLTKLQAQ  182
               EYLQN  +   +   +V   ++ L+Q   Q+K   ++        T   +   ++ Q
Sbjct  645  SLTEYLQNVEQKKRQLEESVDALSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQ  704

Query  183  NQWLQDM  189
             Q  ++ 
Sbjct  705  IQSHRET  711


> sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus 
cuniculus OX=9986 GN=ROCK1 PE=1 SV=1
Length=1354

 Score = 32.3 bits (72),  Expect = 3.6, Method: Composition-based stats.
 Identities = 28/160 (18%), Positives = 65/160 (41%), Gaps = 17/160 (11%)

Query  42   PHRQPLTSSERIDKQIRYILDG---------ISALRKETCNKSNMCESSKEALAENNLNL  92
             +R+ L+ +   D +    +D          I  L ++  N+  + +  ++    +N+ L
Sbjct  401  SNRRYLSPANPNDNRTSSNVDKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKL  460

Query  93   PK-MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLI  151
             K M E D       N E+ + +I       ++ L++  N ++   EQ    + + +  +
Sbjct  461  DKIMKELDEEGNQRRNLESTVSQIEKE----KMLLQHRINEYQRKAEQENEKRRNVENEV  516

Query  152  QFLQKKAKNLDAITTPDPTTN---ASLLTKLQAQNQWLQD  188
              L+ + ++L  ++      N   A L  +L+  N  L+ 
Sbjct  517  STLKDQLEDLKKVSQNSQLANEKLAQLQKQLEEANDLLRT  556


> sp|Q83BT4|NRDR_COXBU Transcriptional repressor NrdR OS=Coxiella 
burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=nrdR 
PE=3 SV=1
Length=157

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 26/104 (25%)

Query  77   MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESS  136
             C+          LNLP++ ++DG  +S F+EE    K+  GL      L+ L+ R   S
Sbjct  33   KCQERFTTFETAELNLPRIIKRDG-RRSAFDEE----KLRAGL------LKALEKR-PIS  80

Query  137  EEQARAV--------------QMSTKVLIQFLQKKAKNLDAITT  166
             EQ                  ++S++ L + +  + + LD +  
Sbjct  81   TEQIETAVQRIIHKLRARGECEVSSQWLGELVMDELRALDEVAY  124


> sp|A9N8T7|NRDR_COXBR Transcriptional repressor NrdR OS=Coxiella 
burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=nrdR 
PE=3 SV=1
Length=157

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 26/104 (25%)

Query  77   MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESS  136
             C+          LNLP++ ++DG  +S F+EE    K+  GL      L+ L+ R   S
Sbjct  33   KCQERFTTFETAELNLPRIIKRDG-RRSAFDEE----KLRAGL------LKALEKR-PIS  80

Query  137  EEQARAV--------------QMSTKVLIQFLQKKAKNLDAITT  166
             EQ                  ++S++ L + +  + + LD +  
Sbjct  81   TEQIETAVQRIIHKLRARGECEVSSQWLGELVMDELRALDEVAY  124


> sp|A9KBN5|NRDR_COXBN Transcriptional repressor NrdR OS=Coxiella 
burnetii (strain Dugway 5J108-111) OX=434922 GN=nrdR PE=3 
SV=1
Length=157

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 26/104 (25%)

Query  77   MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESS  136
             C+          LNLP++ ++DG  +S F+EE    K+  GL      L+ L+ R   S
Sbjct  33   KCQERFTTFETAELNLPRIIKRDG-RRSAFDEE----KLRAGL------LKALEKR-PIS  80

Query  137  EEQARAV--------------QMSTKVLIQFLQKKAKNLDAITT  166
             EQ                  ++S++ L + +  + + LD +  
Sbjct  81   TEQIETAVQRIIHKLRARGECEVSSQWLGELVMDELRALDEVAY  124


> sp|B6IZ81|NRDR_COXB2 Transcriptional repressor NrdR OS=Coxiella 
burnetii (strain CbuG_Q212) OX=434923 GN=nrdR PE=3 SV=1
Length=157

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 26/104 (25%)

Query  77   MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESS  136
             C+          LNLP++ ++DG  +S F+EE    K+  GL      L+ L+ R   S
Sbjct  33   KCQERFTTFETAELNLPRIIKRDG-RRSAFDEE----KLRAGL------LKALEKR-PIS  80

Query  137  EEQARAV--------------QMSTKVLIQFLQKKAKNLDAITT  166
             EQ                  ++S++ L + +  + + LD +  
Sbjct  81   TEQIETAVQRIIHKLRARGECEVSSQWLGELVMDELRALDEVAY  124


> sp|B6J8Q8|NRDR_COXB1 Transcriptional repressor NrdR OS=Coxiella 
burnetii (strain CbuK_Q154) OX=434924 GN=nrdR PE=3 SV=1
Length=157

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 26/104 (25%)

Query  77   MCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESS  136
             C+          LNLP++ ++DG  +S F+EE    K+  GL      L+ L+ R   S
Sbjct  33   KCQERFTTFETAELNLPRIIKRDG-RRSAFDEE----KLRAGL------LKALEKR-PIS  80

Query  137  EEQARAV--------------QMSTKVLIQFLQKKAKNLDAITT  166
             EQ                  ++S++ L + +  + + LD +  
Sbjct  81   TEQIETAVQRIIHKLRARGECEVSSQWLGELVMDELRALDEVAY  124


> sp|P0CF95|BICL1_DANRE BICD family-like cargo adapter 1 OS=Danio 
rerio OX=7955 GN=bicdl1 PE=2 SV=1
Length=569

 Score = 32.0 bits (71),  Expect = 4.3, Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 47/120 (39%), Gaps = 17/120 (14%)

Query  32   PGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC---NKSNMCESSKEALAEN  88
              +D K+ +    Q +T  E +  +IR + +    L +  C    ++   +++ E L E 
Sbjct  214  LRDDFKEKSISSNQHMTRLETLQAEIRMLSERKQDLERRVCAVLEENQQLQNTVEELRER  273

Query  89   NLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK  148
             L L K      C          L KI   L E  + +  L+  +   +++   + + T+
Sbjct  274  TLELEK-----HCHHKD------LQKI---LPETLLTIIKLKTNYSQKKKKTEHLILHTR  319


> sp|P39723|SPC72_YEAST Spindle pole component SPC72 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC72 
PE=1 SV=2
Length=622

 Score = 31.2 bits (69),  Expect = 7.3, Method: Composition-based stats.
 Identities = 17/90 (19%), Positives = 37/90 (41%), Gaps = 4/90 (4%)

Query  121  EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ  180
            E++  L+++Q   E+SE     +      ++    ++ +N   +            T   
Sbjct  129  EYQDTLQFVQENLENSESIVNTINHLLSFILTHFNEQDENAHLLD--KEERETLEETLEL  186

Query  181  AQNQWLQDMTT--HLILRSFKEFLQSSLRA  208
            + +  L+ M T    I++  ++FL S  RA
Sbjct  187  SSDYVLEKMDTLSKFIIQFLQDFLHSKSRA  216


> sp|P61584|ROCK1_PANTR Rho-associated protein kinase 1 (Fragment) 
OS=Pan troglodytes OX=9598 GN=ROCK1 PE=3 SV=1
Length=1003

 Score = 31.2 bits (69),  Expect = 7.9, Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 61/158 (39%), Gaps = 18/158 (11%)

Query  35   DSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK  94
            D++  +   +    S ++   ++   L     L+ E       C +S       N+ L K
Sbjct  62   DNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEM---EQKCRTS-------NIKLDK  111

Query  95   -MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQF  153
             M E D       N E+ + +I       ++ L++  N ++   EQ    + + +  +  
Sbjct  112  IMKELDEEGNQRRNLESTVSQIEKE----KMLLQHRINEYQRKAEQENEKRRNVENEVST  167

Query  154  LQKKAKNLDAITTPDPTTN---ASLLTKLQAQNQWLQD  188
            L+ + ++L  ++      N   + L  +L+  N  L+ 
Sbjct  168  LKDQLEDLKKVSQNSQLANEKLSQLQKQLEEANDLLRT  205


> sp|B0BMJ2|CC42M_XENTR Coiled-coil domain-containing protein 42 
like-2 OS=Xenopus tropicalis OX=8364 GN=TNeu058c09.1 PE=2 
SV=2
Length=314

 Score = 30.8 bits (68),  Expect = 9.3, Method: Composition-based stats.
 Identities = 22/140 (16%), Positives = 55/140 (39%), Gaps = 18/140 (13%)

Query  51   ERIDKQIRYILDGISALR--KETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE  108
             +  + ++ +L+     +  +E  ++ N   +++  L + +L   ++AE++      + E
Sbjct  141  SKYQQYLQRVLERTDEFQEVQEMIDRFNTLMATQNKLLKRDLENQELAEREKARLLHYQE  200

Query  109  ETC----------------LVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQ  152
            ET                 L ++     ++E     +QN    +  +   ++MST  L Q
Sbjct  201  ETRSQILELNNQIAQLQGELERVRAVAFQWESRWAQIQNTAAENTLRLGRIRMSTLNLFQ  260

Query  153  FLQKKAKNLDAITTPDPTTN  172
             + K+ +    I+  D    
Sbjct  261  TISKQMRLKTEISVEDTEAQ  280



Lambda      K        H        a         alpha
   0.306    0.134    0.361    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0419    0.140     1.90     42.6     43.6 

Effective search space used: 13777909200


  Database: uniprot_sprot.fasta
    Posted date:  Aug 19, 2020  9:15 PM
  Number of letters in database: 202,799,066
  Number of sequences in database:  563,082



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40