PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo
sapiens OX=9606 GN=IL6R PE=1 SV=1

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=H...   961    0.0   
  sp|O18796|IL6RA_PIG Interleukin-6 receptor subunit alpha OS=Sus...   733    0.0   
  sp|P22273|IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rat...   476    5e-163
  sp|P22272|IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=M...   451    3e-153
  sp|Q5RF19|I11RA_PONAB Interleukin-11 receptor subunit alpha OS=...   112    5e-26 
  sp|Q14626|I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=...   112    7e-26 
  sp|Q64385|I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 O...   112    1e-25 
  sp|P51641|CNTFR_CHICK Ciliary neurotrophic factor receptor subu...   107    2e-24 
  sp|P70225|I11RB_MOUSE Interleukin-11 receptor subunit alpha-2 O...   107    3e-24 
  sp|Q99MF4|I11RA_RAT Interleukin-11 receptor subunit alpha OS=Ra...   105    2e-23 
  sp|O88507|CNTFR_MOUSE Ciliary neurotrophic factor receptor subu...   103    4e-23 
  sp|Q08406|CNTFR_RAT Ciliary neurotrophic factor receptor subuni...   102    8e-23 
  sp|Q71DR4|CNTFR_CANLF Ciliary neurotrophic factor receptor subu...   101    3e-22 
  sp|P26992|CNTFR_HUMAN Ciliary neurotrophic factor receptor subu...   100    9e-22 
  sp|Q91094|PRLR_MELGA Prolactin receptor OS=Meleagris gallopavo ...  63.9    2e-09 
  sp|O46561|PRLR_SHEEP Prolactin receptor OS=Ovis aries OX=9940 G...  62.4    4e-09 
  sp|O75462|CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo s...  61.6    5e-09 
  sp|Q9JM58|CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus mu...  61.6    6e-09 
  sp|P29460|IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapie...  60.8    8e-09 
  sp|Q28172|PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 G...  61.6    8e-09 
  sp|Q04594|PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=903...  61.6    9e-09 
  sp|Q6JTA8|PRLR_PIG Prolactin receptor OS=Sus scrofa OX=9823 GN=...  60.8    1e-08 
  sp|P46282|IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus...  59.7    2e-08 
  sp|Q28938|IL12B_PIG Interleukin-12 subunit beta OS=Sus scrofa O...  59.3    2e-08 
  sp|P46658|IL12B_CERAT Interleukin-12 subunit beta OS=Cercocebus...  59.3    3e-08 
  sp|Q924V5|IL12B_CAVPO Interleukin-12 subunit beta OS=Cavia porc...  58.9    3e-08 
  sp|Q61729|IL12B_MARMO Interleukin-12 subunit beta OS=Marmota mo...  58.9    3e-08 
  sp|Q28268|IL12B_CANLF Interleukin-12 subunit beta OS=Canis lupu...  58.5    4e-08 
  sp|Q866G3|IL12B_BUBBU Interleukin-12 subunit beta OS=Bubalus bu...  58.5    5e-08 
  sp|Q2PE76|IL12B_BUBCA Interleukin-12 subunit beta OS=Bubalus ca...  58.2    6e-08 
  sp|P68220|IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries...  58.2    6e-08 
  sp|P68221|IL12B_CAPHI Interleukin-12 subunit beta OS=Capra hirc...  58.2    6e-08 
  sp|P48095|IL12B_MACMU Interleukin-12 subunit beta OS=Macaca mul...  57.0    1e-07 
  sp|O02744|IL12B_FELCA Interleukin-12 subunit beta OS=Felis catu...  56.6    2e-07 
  sp|Q90374|PRLR_COLLI Prolactin receptor OS=Columba livia OX=893...  57.8    2e-07 
  sp|Q9XSQ5|IL12B_HORSE Interleukin-12 subunit beta OS=Equus caba...  56.6    2e-07 
  sp|Q865Y3|IL12B_PAPAN Interleukin-12 subunit beta OS=Papio anub...  55.8    3e-07 
  sp|Q28234|IL12B_CEREL Interleukin-12 subunit beta OS=Cervus ela...  55.1    5e-07 
  sp|P14787|PRLR_RABIT Prolactin receptor OS=Oryctolagus cuniculu...  55.8    5e-07 
  sp|P40189|IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Ho...  55.8    6e-07 
  sp|P40190|IL6RB_RAT Interleukin-6 receptor subunit beta OS=Ratt...  53.9    2e-06 
  sp|Q00560|IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mu...  53.9    3e-06 
  sp|Q28235|PRLR_CEREL Prolactin receptor OS=Cervus elaphus OX=98...  53.5    3e-06 
  sp|Q8MJS1|I12R2_PIG Interleukin-12 receptor subunit beta-2 OS=S...  53.5    3e-06 
  sp|Q91513|PRLR_ORENI Prolactin receptor OS=Oreochromis niloticu...  52.4    6e-06 
  sp|P05710|PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=1...  51.2    1e-05 
  sp|Q91ZK7|IL12B_SIGHI Interleukin-12 subunit beta OS=Sigmodon h...  50.4    1e-05 
  sp|Q9BEG2|I12R2_BOVIN Interleukin-12 receptor subunit beta-2 OS...  50.8    2e-05 
  sp|Q865W9|IL12B_LAMGL Interleukin-12 subunit beta OS=Lama glama...  50.1    2e-05 
  sp|Q08501|PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=1009...  50.4    2e-05 
  sp|P16471|PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606...  47.4    2e-04 
  sp|Q99665|I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS...  46.6    5e-04 
  sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like...  46.6    6e-04 
  sp|Q8CJE6|IL12B_MESAU Interleukin-12 subunit beta OS=Mesocricet...  45.4    6e-04 
  sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like...  46.6    6e-04 
  sp|Q14213|IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapie...  44.3    0.001 
  sp|E1C8P7|DSCL1_CHICK Down syndrome cell adhesion molecule-like...  45.1    0.001 
  sp|P97378|I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS...  44.7    0.002 
  sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 ...  43.9    0.004 
  sp|P43432|IL12B_MOUSE Interleukin-12 subunit beta OS=Mus muscul...  42.4    0.006 
  sp|P48356|LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 G...  41.6    0.016 
  sp|F1NY98|DSCAM_CHICK Down syndrome cell adhesion molecule homo...  41.6    0.020 
  sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=H...  41.2    0.023 
  sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homo...  40.8    0.027 
  sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolo...  40.4    0.037 
  sp|Q2KJF1|A1BG_BOVIN Alpha-1B-glycoprotein OS=Bos taurus OX=991...  39.3    0.071 
  sp|Q62959|LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=1011...  37.7    0.24  
  sp|P12371|FCERA_RAT High affinity immunoglobulin epsilon recept...  37.0    0.26  
  sp|A2AJ76|HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=...  37.7    0.32  
  sp|P40223|CSF3R_MOUSE Granulocyte colony-stimulating factor rec...  37.4    0.35  
  sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=...  37.4    0.36  
  sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=H...  37.4    0.39  
  sp|Q90610|NEO1_CHICK Neogenin (Fragment) OS=Gallus gallus OX=90...  37.0    0.41  
  sp|P59045|NAL11_HUMAN NACHT, LRR and PYD domains-containing pro...  37.0    0.45  
  sp|P16382|IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=M...  36.6    0.51  
  sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1...  37.0    0.51  
  sp|Q8NI17|IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=...  36.6    0.53  
  sp|A5WAK1|TYSY_PSEP1 Thymidylate synthase OS=Pseudomonas putida...  35.8    0.58  
  sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like ...  36.6    0.63  
  sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus ...  36.6    0.67  
  sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens ...  36.2    0.68  
  sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegic...  36.2    0.69  
  sp|P01681|KVX01_RAT Ig kappa chain V region S211 OS=Rattus norv...  33.9    0.76  
  sp|Q29JX6|IHOG_DROPS Interference hedgehog OS=Drosophila pseudo...  36.2    0.87  
  sp|B4GKZ8|IHOG_DROPE Interference hedgehog OS=Drosophila persim...  35.8    0.91  
  sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN...  35.8    1.0   
  sp|Q9HBE5|IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens O...  35.4    1.1   
  sp|Q0WYX8|MDGA1_CHICK MAM domain-containing glycosylphosphatidy...  35.4    1.5   
  sp|P85171|MDGA1_RAT MAM domain-containing glycosylphosphatidyli...  35.0    1.6   
  sp|O02671|LEPR_PIG Leptin receptor OS=Sus scrofa OX=9823 GN=LEP...  35.0    1.6   
  sp|Q4LFA9|SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 GN...  35.0    1.8   
  sp|P27645|FCGR3_RAT Low affinity immunoglobulin gamma Fc region...  34.3    1.8   
  sp|Q0PMG2|MDGA1_MOUSE MAM domain-containing glycosylphosphatidy...  35.0    1.9   
  sp|P0C673|IGS11_MOUSE Immunoglobulin superfamily member 11 OS=M...  34.7    2.0   
  sp|Q8BLK3|LSAMP_MOUSE Limbic system-associated membrane protein...  34.3    2.4   
  sp|Q8TDY8|IGDC4_HUMAN Immunoglobulin superfamily DCC subclass m...  34.7    2.7   
  sp|P11044|TYSY2_BACSU Thymidylate synthase 2 OS=Bacillus subtil...  33.9    2.8   
  sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=...  34.3    2.9   
  sp|Q62813|LSAMP_RAT Limbic system-associated membrane protein O...  33.9    3.0   
  sp|B4KPU0|PTK7_DROMO Tyrosine-protein kinase-like otk OS=Drosop...  34.3    3.2   
  sp|Q96RL6|SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=...  33.9    3.5   
  sp|Q13449|LSAMP_HUMAN Limbic system-associated membrane protein...  33.5    3.7   
  sp|P97798|NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 ...  33.9    3.8   
  sp|Q9EQS9|IGDC4_MOUSE Immunoglobulin superfamily DCC subclass m...  33.9    4.3   
  sp|H0VDZ8|FCGR4_CAVPO Low affinity immunoglobulin gamma Fc regi...  33.1    4.3   
  sp|Q86VR7|VS10L_HUMAN V-set and immunoglobulin domain-containin...  33.9    4.5   
  sp|P16882|GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=...  33.5    4.9   
  sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus OX=10090 GN=Obsc...  33.5    5.6   
  sp|O75015|FCG3B_HUMAN Low affinity immunoglobulin gamma Fc regi...  32.7    5.6   
  sp|D3YXG0|HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=...  33.5    5.6   
  sp|Q9JHX3|IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus O...  33.1    5.6   
  sp|P04943|KV6A9_MOUSE Ig kappa chain V-VI region NQ6-8.3.1 OS=M...  31.2    5.8   
  sp|A0A0C4DH26|KVD41_HUMAN Probable non-functional immunoglobuli...  31.6    6.0   
  sp|A6UB24|TYSY_SINMW Thymidylate synthase OS=Sinorhizobium medi...  32.7    6.3   
  sp|Q5VWK5|IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens O...  32.7    7.8   
  sp|O09127|EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus ...  33.1    7.9   
  sp|P29322|EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens ...  32.7    8.0   
  sp|Q60ZN5|SDK_CAEBR Protein sidekick homolog OS=Caenorhabditis ...  32.7    8.7   
  sp|Q6WRH9|IGS10_RAT Immunoglobulin superfamily member 10 OS=Rat...  32.7    8.9   
  sp|P22182|FGFR1_XENLA Fibroblast growth factor receptor 1 OS=Xe...  32.7    9.7   
  sp|B3MKS0|IHOG_DROAN Interference hedgehog OS=Drosophila ananas...  32.7    9.7   


> sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL6R PE=1 SV=1
Length=468

 Score =  961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/468 (100%), Positives = 468/468 (100%), Gaps = 0/468 (0%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
Sbjct  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
Sbjct  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
Sbjct  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
Sbjct  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
            PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
Sbjct  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
Sbjct  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
            SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
Sbjct  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420

Query  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
            TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Sbjct  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468


> sp|O18796|IL6RA_PIG Interleukin-6 receptor subunit alpha OS=Sus 
scrofa OX=9823 GN=IL6R PE=2 SV=2
Length=467

 Score =  733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/468 (79%), Positives = 407/468 (87%), Gaps = 1/468 (0%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGCALL ALLAAPG ALAPR C   EVA+ VLTSLPG SVTLTCPG EP DNAT+HW
Sbjct  1    MLAVGCALLTALLAAPGMALAPRGCSKLEVAQDVLTSLPGASVTLTCPGGEPGDNATIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            VLR    GS   R AG+GRRLLL+SVQL DSGNYSCY+ G PAG+V LLVD PPEEPQLS
Sbjct  61   VLRNQVTGSPDGRPAGVGRRLLLKSVQLSDSGNYSCYQDGVPAGSVRLLVDAPPEEPQLS  120

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            CFRKSPLSNV CEW PRS PS TTKAVLLVRKFQNSP EDFQEPCQYS E+Q+F CQLAV
Sbjct  121  CFRKSPLSNVGCEWRPRSPPSPTTKAVLLVRKFQNSPVEDFQEPCQYSLEAQRFFCQLAV  180

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            PEGD+SF+IV++CVA+S GS+ S  QTF+G GILQPDPP NITV+AV RNPRWLSVTWQD
Sbjct  181  PEGDNSFHIVTLCVANSAGSQSSTPQTFEGYGILQPDPPVNITVSAVDRNPRWLSVTWQD  240

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
            P SWNS FYRL+FELRYRAERSKTFTTWMVK+LQHHC+IHDAWSG+RHVVQLRAQEEFG 
Sbjct  241  PPSWNSYFYRLQFELRYRAERSKTFTTWMVKELQHHCIIHDAWSGMRHVVQLRAQEEFGH  300

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            G WSEWS E  G PWTESRS PAE E+    QA TTN+DD++I  ++SANATSLPVQDS+
Sbjct  301  GLWSEWSQEVTGIPWTESRSSPAETELPLSTQAPTTNEDDEDISSKESANATSLPVQDSA  360

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
            SVPLPTFLVAGGSLAFGTLLCI I+LRFKKT +L+ALKEGKT+MHPPYSLGQLVPERP+ 
Sbjct  361  SVPLPTFLVAGGSLAFGTLLCIGIILRFKKTGQLQALKEGKTNMHPPYSLGQLVPERPKS  420

Query  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
            TPVLVPLISPPVSP+SLG DNTS ++RP+AR P+SPYD+SN DYFFPR
Sbjct  421  TPVLVPLISPPVSPNSLG-DNTSRNSRPEARGPQSPYDVSNRDYFFPR  467


> sp|P22273|IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rattus 
norvegicus OX=10116 GN=Il6r PE=2 SV=2
Length=462

 Score =  476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 258/472 (55%), Positives = 320/472 (68%), Gaps = 14/472 (3%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGC LL ALLAAP  AL    C A EVA G +TSLPG +VTL CPG E   NAT+HW
Sbjct  1    MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            V     +GS    W   G  L+LR+VQ++D+G+Y C+      GTV LLVDVPPEEP+LS
Sbjct  61   VY----SGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLS  116

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAE-DFQEPCQYSQESQKFSCQLA  179
            CFRK+PL N  CEW P STPS TTKAV+  +K   +  + DFQ PCQYSQ+ + FSC++ 
Sbjct  117  CFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVE  176

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
            + EGD  ++IVS+CVA+SVGS+ S    FQ   ++QPDPPAN+ V+A+   PRWL V+WQ
Sbjct  177  ILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQ  236

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
            DP SW+ S+Y L+FELRYR   SK FT W ++  QH CVIHDA  G++HVVQ+R +EEF 
Sbjct  237  DPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFD  296

Query  300  QGEWSEWSPEAMGTPW-TESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL--PV  356
             G+WS+WSPE  GTPW  E R+ PA      P Q    + D+    +  S  ATS+  PV
Sbjct  297  IGQWSKWSPEVTGTPWLAEPRTTPA-GIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPV  355

Query  357  QDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPE  416
            Q SS +PLPTFLVAGGSLAFG LLC+ I+LR KK WK +A KE KT+  PPY LG L   
Sbjct  356  QGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPL---  412

Query  417  RPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
              +PT +LVPL++P  S +S G+DNT SH+    RDP+ P D SN DY FPR
Sbjct  413  --KPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR  462


> sp|P22272|IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il6ra PE=1 SV=2
Length=460

 Score =  451 bits (1159),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 253/474 (53%), Positives = 313/474 (66%), Gaps = 20/474 (4%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            ML VGC LL ALLAAP  AL    C A EVA G +TSLPG +VTL CPG E   N T+HW
Sbjct  1    MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            V     +GS    W   G  L+LR VQL D+G+Y C       GTV LLVDVPPEEP+LS
Sbjct  61   VY----SGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLS  116

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAE-DFQEPCQYSQESQKFSCQLA  179
            CFRK+PL N +CEW P STPS TTKAVL  +K   +  + DFQ PCQYSQ+ + FSCQ+ 
Sbjct  117  CFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVE  176

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
            + EGD  ++IVS+CVA+SVGSK S  + F    ++QPDPPAN+ V+A+   PRWL V+WQ
Sbjct  177  ILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQ  236

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
             P +W+ S+Y L+F+LRYR   SK FT  ++   Q+ CVIHDA  G++HVVQ+R +EE  
Sbjct  237  HPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELD  296

Query  300  QGEWSEWSPEAMGTPWT-ESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL--PV  356
             G+WSEWSPE  GTPW  E R+ PA   +  P Q    +  +    +  S  ATS+  PV
Sbjct  297  LGQWSEWSPEVTGTPWIAEPRTTPA-GILWNPTQVSVEDSANHEDQYESSTEATSVLAPV  355

Query  357  QDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTS--MHPPYSLGQLV  414
            Q+SSS+ LPTFLVAGGSLAFG LLC+ I+LR K+ WK  A KE KT+    PPYSLG L 
Sbjct  356  QESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPL-  414

Query  415  PERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
                +PT +LVPL+    +P S GSDNT +H+    RD +SPYD SN DY FPR
Sbjct  415  ----KPTFLLVPLL----TPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR  460


> sp|Q5RF19|I11RA_PONAB Interleukin-11 receptor subunit alpha OS=Pongo 
abelii OX=9601 GN=IL11RA PE=2 SV=1
Length=422

 Score =  112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 127/430 (30%), Positives = 181/430 (42%), Gaps = 34/430 (8%)

Query  2    LAVGCALLAALLAAPGAAL--APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L+ +L A   AL  A   CP      GV    PG SV L CPGV   D   V 
Sbjct  1    MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVS  58

Query  60   WVLR-KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEP  117
            W    +P     P   +G+G  L+L      D G Y C    G   GTV L +  PP  P
Sbjct  59   WFRDGEPKLLQGPD--SGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPPARP  116

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PCQYSQE  170
             +SC + +   N  C W P     L T+ +   RK     A+  +        PC     
Sbjct  117  VVSC-QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPC----P  171

Query  171  SQKFSCQLAVPEGDS--SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
                     V  G    S Y +++   + +G+  ++        IL+PDPP  + V +V 
Sbjct  172  QDPLGAARCVVHGAEFWSQYRINVTEVNPLGAS-TRLLDVSLQSILRPDPPQGLRVESVP  230

Query  229  RNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              PR L  +W  P SW     + L+F L+YR  +   ++T     L+   VI DA +GL 
Sbjct  231  GYPRRLRASWTYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLP  288

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTES--RSPPAENEVSTPMQALTTNKDDDNILF  345
            H V++ A++    G WS WSPEA GTP T +  +  PA  ++ T  Q     + D     
Sbjct  289  HAVRVSARDFLDAGTWSTWSPEAWGTPSTGTVPKEIPAWGQLHT--QPEVEPQVDSPAPP  346

Query  346  RDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMH  405
            R S       +    SV     LV+ G L+F  L+  A+ L     W LR  + GK    
Sbjct  347  RPSLQPHPRLLDHRDSVEQVAVLVSLGILSFLGLVAGALALGL---W-LRLRRGGKDGSP  402

Query  406  PPYSLGQLVP  415
             P  L  ++P
Sbjct  403  KPGFLASVIP  412


> sp|Q14626|I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL11RA PE=1 SV=2
Length=422

 Score =  112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 182/435 (42%), Gaps = 34/435 (8%)

Query  2    LAVGCALLAALLAAPGAAL--APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L+ +L A   AL  A   CP      GV    PG SV L CPGV   D   V 
Sbjct  1    MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVS  58

Query  60   WVLR-KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEP  117
            W    +P     P   +G+G  L+L      D G Y C    G   GTV L +  PP  P
Sbjct  59   WFRDGEPKLLQGPD--SGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARP  116

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PCQYSQE  170
             +SC + +   N  C W P     L T+ +   RK     A+  +        PC     
Sbjct  117  VVSC-QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPC----P  171

Query  171  SQKFSCQLAVPEGDS--SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
                     V  G    S Y +++   + +G+  ++        IL+PDPP  + V +V 
Sbjct  172  QDPLGAARCVVHGAEFWSQYRINVTEVNPLGAS-TRLLDVSLQSILRPDPPQGLRVESVP  230

Query  229  RNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              PR L  +W  P SW     + L+F L+YR  +   ++T     L+   VI DA +GL 
Sbjct  231  GYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEE--VITDAVAGLP  288

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTES--RSPPAENEVSTPMQALTTNKDDDNILF  345
            H V++ A++    G WS WSPEA GTP T +  +  PA  ++ T  Q     + D     
Sbjct  289  HAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHT--QPEVEPQVDSPAPP  346

Query  346  RDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMH  405
            R S       +    SV     L + G L+F  L+  A+ L     W LR  + GK    
Sbjct  347  RPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGL---W-LRLRRGGKDGSP  402

Query  406  PPYSLGQLVPERPRP  420
             P  L  ++P   RP
Sbjct  403  KPGFLASVIPVDRRP  417


> sp|Q64385|I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 
OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
Length=432

 Score =  112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 128/438 (29%), Positives = 183/438 (42%), Gaps = 48/438 (11%)

Query  2    LAVGCALLAALLAAPGAALAPRR--CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L  +L A   AL      CP      GV    PG  V L CPGV       V 
Sbjct  1    MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVS--AGTPVS  58

Query  60   W-------VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVD  111
            W       +L+ P +G        +G RL+L  V   D G Y C    G   G V L + 
Sbjct  59   WFRDGDSRLLQGPDSG--------LGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLG  110

Query  112  VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------P  164
             PP  P++SC +     N  C W P     L T+ +   RK     AE  +E       P
Sbjct  111  FPPARPEVSC-QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWP  169

Query  165  C-QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
            C Q   E+ +  C +   E  S + I    V     S        Q   IL+PDPP  + 
Sbjct  170  CPQDPLEASR--CVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQS--ILRPDPPQGLR  225

Query  224  VTAVARNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            V +V   PR L  +W  P SW     + L+F L+YR  +   ++T  V+ +    VI DA
Sbjct  226  VESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWST--VEPIGLEEVITDA  283

Query  283  WSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDN  342
             +GL H V++ A++    G WS WSPEA GTP T     P ++E+  P  +    +  + 
Sbjct  284  VAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTG----PLQDEI--PDWSQGHGQQLEA  337

Query  343  ILFRDSANATSLPVQDSSSVPL----PTFLVAG-GSLAFGTLLCIAIVLRFKKTWKLRAL  397
            ++ ++ + A + P       PL    P   VA   SL   + L +A+       W LR  
Sbjct  338  VVAQEDSPAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLW-LRLR  396

Query  398  KEGKTSMHPPYSLGQLVP  415
            + GK     P  L  ++P
Sbjct  397  RSGKDGPQKPGLLAPMIP  414


> sp|P51641|CNTFR_CHICK Ciliary neurotrophic factor receptor subunit 
alpha OS=Gallus gallus OX=9031 GN=CNTFR PE=2 SV=1
Length=362

 Score =  107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/284 (31%), Positives = 132/284 (46%), Gaps = 24/284 (8%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA  99
            G  VT+ C  ++ +  A V W     A G+        G  L+L++V L  SG YSCY  
Sbjct  37   GADVTMKCGSMDWD--AAVTWT----ANGTDIDDSHLNGSYLILKNVDLTQSGQYSCYEG  90

Query  100  G--RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEW---GPRSTPSLTTKAVLLVRKFQ  154
                     +L V VPP+EP L C   +      C W    P   P+    +V+   +  
Sbjct  91   SSWHLKYQTYLRVGVPPKEPVLMCRSNNYPKGFYCSWHLPSPTYIPNSFNISVIHGTREM  150

Query  155  NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL  214
                + F +   + +  Q FS         +  Y V++ V +++G K S T TF    I+
Sbjct  151  VCEKDIFPKNRCHIRYLQLFS---------TVKYKVTLTVTNALG-KNSTTLTFDEFAIV  200

Query  215  QPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDL  273
            +PDPP ++    V  NPR L V+WQ+P SW +   + L+F LRYR      +    + D 
Sbjct  201  KPDPPESVVAKPVPNNPRRLEVSWQNPSSWPDPESFPLKFFLRYRPLILDQWQHVELSDG  260

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
              H  I DA++G  +++Q+ A++    G WS+WS     TPWTE
Sbjct  261  TSH-TITDAYAGKEYIIQVAAKDN-DIGTWSDWSVAVHATPWTE  302


> sp|P70225|I11RB_MOUSE Interleukin-11 receptor subunit alpha-2 
OS=Mus musculus OX=10090 GN=Il11ra2 PE=2 SV=4
Length=432

 Score =  107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 104/327 (32%), Positives = 140/327 (43%), Gaps = 22/327 (7%)

Query  2    LAVGCALLAALLAAPGAALAPRR--CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L  +L A   AL      CP      GV    PG  V L CPGV       V 
Sbjct  1    MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVS--AGTPVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQ  118
            W  R   +       +G+G RL+L  V   D G Y C    G   G V L +  PP  P+
Sbjct  59   W-FRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPE  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PC-QYSQE  170
            +SC +     N  C W P     L T+ +   RK     AE  +E       PC Q   E
Sbjct  118  VSC-QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLE  176

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
            + +  C +   E  S + I    V     S        Q   IL+PDPP  + V +V   
Sbjct  177  ASR--CVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQS--ILRPDPPQGLRVESVPGY  232

Query  231  PRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
            PR L  +W  P SW     + L+F L+YR  +   ++T  V+ +    VI D  +GL H 
Sbjct  233  PRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWST--VEPIGLEEVITDTVAGLPHA  290

Query  290  VQLRAQEEFGQGEWSEWSPEAMGTPWT  316
            V++ A++    G WS WSPEA GTP T
Sbjct  291  VRVSARDFLDAGTWSAWSPEAWGTPST  317


> sp|Q99MF4|I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus 
norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
Length=431

 Score =  105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 131/302 (43%), Gaps = 20/302 (7%)

Query  25   CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLR  84
            CP      GV    PG  V L CPGV       V W  R   +       +G+G RL+L 
Sbjct  26   CPQAWGPPGVQYGQPGRPVMLCCPGVN--AGTPVSW-FRDGDSRLLQGPDSGLGHRLVLA  82

Query  85   SVQLHDSGNYSCYRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT  143
             V   D G Y C    G   G V L +  PP  P++SC +     N  C W P     L 
Sbjct  83   QVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSC-QAVDYENFSCTWSPGRVSGLP  141

Query  144  TKAVLLVRKFQNSPAEDFQE-------PC-QYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
            T+ +   RK     AE  +E       PC Q   E+ +  C +   E  S + I    V 
Sbjct  142  TRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASR--CVVHGAEFWSEYRINVTEVN  199

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FYRLRFE  254
                S        Q   IL+PDPP  + V +V   PR L  +W  P SW     + L+F 
Sbjct  200  PLGASTCLLDVRLQR--ILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFR  257

Query  255  LRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
            L+YR  +   ++T  V+ +    +I DA +GL H V++ A++    G WS WSPEA GTP
Sbjct  258  LQYRPAQHPAWST--VEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTP  315

Query  315  WT  316
             T
Sbjct  316  ST  317


> sp|O88507|CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit 
alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
Length=372

 Score =  103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 118/247 (48%), Gaps = 20/247 (8%)

Query  78   GRRLLLRSVQLHDSGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
            G +L+LRS++L  SG Y+C+   +      V L V +PP EP LSC   +      C W 
Sbjct  71   GSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWH  130

Query  136  ---PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVS  191
               P   P+     VL   K            C+    + K  C +      S+  Y VS
Sbjct  131  LPTPTYIPNTFNVTVLHGSKIMV---------CE-KDPALKNRCHIRYMHLFSTIKYKVS  180

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYR  250
            + V++++G   +   TF    I++PDPP N+    V  NPR L VTWQ P +W +   + 
Sbjct  181  ISVSNALGHNTTAI-TFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFP  239

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
            L+F LRYR      +    + D   H  I DA++G  +++Q+ A++    G WS+WS  A
Sbjct  240  LKFFLRYRPLILDQWQHVELSDGTAH-TITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAA  297

Query  311  MGTPWTE  317
              TPWTE
Sbjct  298  HATPWTE  304


> sp|Q08406|CNTFR_RAT Ciliary neurotrophic factor receptor subunit 
alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
Length=372

 Score =  102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 118/249 (47%), Gaps = 24/249 (10%)

Query  78   GRRLLLRSVQLHDSGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEW-  134
            G +L+LRS++L  SG Y+C+   +      V L V +PP EP LSC   +      C W 
Sbjct  71   GSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWH  130

Query  135  --GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVS  191
               P   P+     VL   K            C+    + K  C +      S+  Y VS
Sbjct  131  LSAPTYIPNTFNVTVLHGSKMMV---------CE-KDPALKNRCHIRYMHLFSTIKYKVS  180

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYR  250
            + V++++G   +   TF    I++PDPP N+    V  NPR L VTWQ P +W +   + 
Sbjct  181  ISVSNALGHNTTAI-TFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFP  239

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
            L+F LRYR         W   +L +     I DA++G  +++Q+ A++    G WS+WS 
Sbjct  240  LKFFLRYRP---LILDQWQHVELSNGTAHTITDAYAGKEYIIQVAAKDN-EIGTWSDWSV  295

Query  309  EAMGTPWTE  317
             A  TPWTE
Sbjct  296  AAHATPWTE  304


> sp|Q71DR4|CNTFR_CANLF Ciliary neurotrophic factor receptor subunit 
alpha OS=Canis lupus familiaris OX=9615 GN=CNTFR PE=2 
SV=1
Length=372

 Score =  101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 117/247 (47%), Gaps = 20/247 (8%)

Query  78   GRRLLLRSVQLHDSGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
            G +L+L  ++L  SG Y+C+   +      V L V +PP EP LSC   +      C W 
Sbjct  71   GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWH  130

Query  136  ---PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVS  191
               P   P+     VL   K            C+    + K  C +      S+  Y VS
Sbjct  131  LPTPTYIPNTFNVTVLHGSKIMV---------CE-KDPALKNRCHIRYMHLFSTIKYKVS  180

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYR  250
            + V++++G   +   TF    I++PDPP N+    V  NPR L VTWQ P +W +   + 
Sbjct  181  ISVSNALGHNATAI-TFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFP  239

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
            L+F LRYR      +    + D   H  I DA++G  +++Q+ A+ ++  G WS+WS  A
Sbjct  240  LKFFLRYRPLILDQWQHVELSDGTTH-TITDAYAGKEYIIQVAAK-DYEIGTWSDWSVAA  297

Query  311  MGTPWTE  317
              TPWTE
Sbjct  298  HATPWTE  304


> sp|P26992|CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit 
alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
Length=372

 Score =  100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 116/247 (47%), Gaps = 20/247 (8%)

Query  78   GRRLLLRSVQLHDSGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
            G +L+L  ++L  SG Y+C+   +      V L V +PP EP LSC   +      C W 
Sbjct  71   GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWH  130

Query  136  ---PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVS  191
               P   P+     VL   K            C+    + K  C +      S+  Y VS
Sbjct  131  LPTPTYIPNTFNVTVLHGSKIMV---------CE-KDPALKNRCHIRYMHLFSTIKYKVS  180

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYR  250
            + V++++G   +   TF    I++PDPP N+    V  NPR L VTWQ P +W +   + 
Sbjct  181  ISVSNALGHNATAI-TFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFP  239

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
            L+F LRYR      +    + D   H  I DA++G  +++Q+ A++    G WS+WS  A
Sbjct  240  LKFFLRYRPLILDQWQHVELSDGTAH-TITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAA  297

Query  311  MGTPWTE  317
              TPWTE
Sbjct  298  HATPWTE  304


> sp|Q91094|PRLR_MELGA Prolactin receptor OS=Meleagris gallopavo 
OX=9103 GN=PRLR PE=2 SV=1
Length=831

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 92/211 (44%), Gaps = 10/211 (5%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
            P  TV L     P +P++   R        C W P S   L T   L    F +  +E+ 
Sbjct  16   PLTTVGLTSQSFPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTL----FYSKDSEEK  71

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
               C   + S   SC       +S + Y +++   + +GS  S  Q      I+QP  P 
Sbjct  72   IYECPDYRTSGPNSCYFNRNYTNSWTTYNITVTATNEIGSNSSDPQYVDVTSIVQPGSPV  131

Query  221  NITV-TAVARNPRWLSVTWQDPHSWNSSFYRL-RFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+T+ T    N  +L   W  P   ++S   L  +ELR + E  + + T  V  +Q  C 
Sbjct  132  NLTLETQRYANIMYLWAKWSPPLLADASSNHLYHYELRLKPEEKEEWETVPV-GVQTQCK  190

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            I+   +G+R+VVQ+R       GEWSEWS E
Sbjct  191  INRLNAGMRYVVQVRCM--LDPGEWSEWSSE  219


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 103/243 (42%), Gaps = 25/243 (10%)

Query  78   GRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVD---VPPEEPQLSCFRKSPLSNVVCEW  134
            G R +++   + D G +S + + R      +L+     PPE+P ++  R        C W
Sbjct  197  GMRYVVQVRCMLDPGEWSEWSSER-----RILISGGLSPPEKPTITKCRSPEKETFTCWW  251

Query  135  GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF---YIVS  191
             P       T   LL  K      E+    C   + +   SC     +  +SF   Y ++
Sbjct  252  KPGLDGGHPTNYTLLYSK----EGEEQVYECPDYRTAGPNSCYFD--KKHTSFWTVYNIT  305

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA---VARNPRWLSVTWQDP--HSWNS  246
            +   + +GS  S         I+QPDPPAN+T+     + R P +L +TW  P      S
Sbjct  306  VKATNEMGSNSSDPHYVDVTYIVQPDPPANVTLELKKPINRKP-YLMLTWSPPPLADVRS  364

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
             +  L +ELR + E  + + T  V   Q    +     G +++VQ+  + +   G WSEW
Sbjct  365  GWLTLDYELRLKPEEGEEWETVFVGQ-QTQYKMFSLNPGKKYIVQIHCKPDH-HGSWSEW  422

Query  307  SPE  309
            S E
Sbjct  423  SSE  425


> sp|O46561|PRLR_SHEEP Prolactin receptor OS=Ovis aries OX=9940 
GN=PRLR PE=2 SV=1
Length=581

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 87/204 (43%), Gaps = 12/204 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PPE+P+L   R        C W P +   L T   L  RK      E     C   +   
Sbjct  27   PPEKPKLIKCRSPGKETFTCWWEPGADGGLPTNYTLTYRK----EGETLIHECPDYKTGG  82

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              SC  +         Y++++   + +G   S         I++P+PP N+T+       
Sbjct  83   PNSCYFSKKYTSIWKMYVITVSAINQMGISSSDPLYVDVTYIVEPEPPVNLTLELKHPED  142

Query  232  R--WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            R  +L + W  P      S ++ +++E+R + E++  + T     L     I + + G +
Sbjct  143  RKPYLWIKWSPPTLTDVKSGWFSIQYEIRLKPEKATDWETHFAPKLT-QLKIFNLYPGQK  201

Query  288  HVVQLRAQEEFGQGEWSEWSPEAM  311
            ++VQ+R + +   G WSEWSPE+ 
Sbjct  202  YLVQIRCKPD--HGYWSEWSPESF  223


> sp|O75462|CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo 
sapiens OX=9606 GN=CRLF1 PE=1 SV=1
Length=422

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 99/241 (41%), Gaps = 19/241 (8%)

Query  93   NYSCY-RAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV  150
            N  C+ R G       L V +PPE+P  +SC+ K+ + ++ C W P +           +
Sbjct  113  NLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKN-MKDLTCRWTPGAHGETFLHTNYSL  171

Query  151  RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG  210
            +       +D    C+        SC +       + Y + +   + +GS  S   T   
Sbjct  172  KYKLRWYGQD--NTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDI  229

Query  211  CGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV  270
              ++  DPP ++ V+ V      LSV W  P +     ++ ++++RYR E S     W V
Sbjct  230  LDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDS---VDWKV  286

Query  271  KD---LQHHCVIHDAWSGLRHVVQLRAQEEFG------QGEWSEWS-PEAMGTPWTESRS  320
             D    Q  C +     G  + VQ+R    FG       G WSEWS P A  TP +E   
Sbjct  287  VDDVSNQTSCRLAGLKPGTVYFVQVRCN-PFGIYGSKKAGIWSEWSHPTAASTPRSERPG  345

Query  321  P  321
            P
Sbjct  346  P  346


> sp|Q9JM58|CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus 
musculus OX=10090 GN=Crlf1 PE=1 SV=1
Length=425

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 119/308 (39%), Gaps = 32/308 (10%)

Query  36   TSLPGDSVTLTC------PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLL----LRS  85
            T L G S+  TC      PG   E    ++W L      S  SR        L    L  
Sbjct  52   TLLIGSSLQATCSIHGDTPGATAEG---LYWTLNGRRLPSELSRLLNTSTLALALANLNG  108

Query  86   VQLHDSGNYSCY-RAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLT  143
             +     N  C+ R G       L V +PPE+P  +SC+ ++ + ++ C W P +     
Sbjct  109  SRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRN-MKDLTCRWTPGAHGETF  167

Query  144  TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFS  203
                  ++       +D    C+        SC +       + Y + +   + +GS  S
Sbjct  168  LHTNYSLKYKLRWYGQD--NTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARS  225

Query  204  KTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
               T     ++  DPP ++ V+ V      LSV W  P +     ++ ++++RYR E S 
Sbjct  226  DVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDS-  284

Query  264  TFTTWMVKD---LQHHCVIHDAWSGLRHVVQLRAQEEFG------QGEWSEWS-PEAMGT  313
                W V D    Q  C +     G  + VQ+R    FG       G WSEWS P A  T
Sbjct  285  --VDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCN-PFGIYGSKKAGIWSEWSHPTAAST  341

Query  314  PWTESRSP  321
            P +E   P
Sbjct  342  PRSERPGP  349


> sp|P29460|IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens 
OX=9606 GN=IL12B PE=1 SV=1
Length=328

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 128/331 (39%), Gaps = 55/331 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
              LA+P  A+   +     V        PG+ V LTC    PE++  + W L        
Sbjct  14   VFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDT--PEEDG-ITWTL------DQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--PP  114
             S   G G+ L ++  +  D+G Y+C++ G                  +  +L D   P 
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  115  EEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPA  158
             +  L C  K+      C W                G      +T  A  L  +      
Sbjct  125  NKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDN  184

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            +++    +YS E Q+ S   A P  + S  I  M  A       + T +F    I++PDP
Sbjct  185  KEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDP  237

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            P N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D    
Sbjct  238  PKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSA  296

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             VI          + +RAQ+ +    WSEW+
Sbjct  297  TVI----CRKNASISVRAQDRYYSSSWSEWA  323


> sp|Q28172|PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 
GN=PRLR PE=1 SV=1
Length=581

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 88/203 (43%), Gaps = 12/203 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PPE+P+L   R        C W P +   L T   L   K      E     C   +   
Sbjct  27   PPEKPKLVKCRSPGKETFTCWWEPGADGGLPTNYTLTYHK----EGETLIHECPDYKTGG  82

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              SC  +         Y++++   + +G   S         I++P+PPAN+T+       
Sbjct  83   PNSCYFSKKHTSIWKMYVITVNAINQMGISSSDPLYVHVTYIVEPEPPANLTLELKHPED  142

Query  232  R--WLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            R  +L + W  P   +  S ++ +++E+R + E++  + T      Q    I + + G +
Sbjct  143  RKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDWETHFTLK-QTQLKIFNLYPGQK  201

Query  288  HVVQLRAQEEFGQGEWSEWSPEA  310
            ++VQ+R + +   G WSEWSPE+
Sbjct  202  YLVQIRCKPD--HGYWSEWSPES  222


> sp|Q04594|PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 
GN=PRLR PE=2 SV=1
Length=831

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 92/211 (44%), Gaps = 10/211 (5%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
            P  TV L     P +P++   R        C W P S   L T   L   K  +S  E +
Sbjct  16   PLTTVGLAGQSFPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTLFYSK--DSEEEIY  73

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
            +  C   + S   SC          + + +++   + +GS  S  Q      I+QP  P 
Sbjct  74   E--CPDYRTSGPNSCYFNKNHTSPWTTFNITVTATNEIGSNSSDPQYVDVTSIVQPGSPV  131

Query  221  NITV-TAVARNPRWLSVTWQDPHSWNSSFYRL-RFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+T+ T  + N  +L   W  P   ++S   L  +ELR + E  + + T  V  +Q  C 
Sbjct  132  NLTLETKRSANIMYLWAKWSPPLLADASSNHLYHYELRIKPEEKEEWETISV-GVQTQCK  190

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            I+   +G+R+VVQ+R       GEWSEWS E
Sbjct  191  INRLNAGMRYVVQVRCT--LDPGEWSEWSSE  219


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 101/243 (42%), Gaps = 25/243 (10%)

Query  78   GRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV---DVPPEEPQLSCFRKSPLSNVVCEW  134
            G R +++     D G +S + + R     H+L+     PPE+P +   R        C W
Sbjct  197  GMRYVVQVRCTLDPGEWSEWSSER-----HILIPSGQSPPEKPTIIKCRSPEKETFTCWW  251

Query  135  GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF---YIVS  191
             P       T   LL  K      E+    C   + +   SC     +  +SF   Y ++
Sbjct  252  KPGLDGGHPTNYTLLYSK----EGEEQVYECPDYRTAGPNSCYFD--KKHTSFWTIYNIT  305

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA---VARNPRWLSVTWQDP--HSWNS  246
            +   + +GS  S         I+QPDPP N+T+     + R P +L +TW  P      S
Sbjct  306  VRATNEMGSNSSDPHYVDVTYIVQPDPPVNVTLELKKPINRKP-YLVLTWSPPPLADVRS  364

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
             +  L +ELR + E  + + T  V   Q    +     G ++++Q+  + +   G WSEW
Sbjct  365  GWLTLEYELRLKPEEGEEWETIFVGQ-QTQYKMFSLNPGKKYIIQIHCKPDH-HGSWSEW  422

Query  307  SPE  309
            S E
Sbjct  423  SSE  425


> sp|Q6JTA8|PRLR_PIG Prolactin receptor OS=Sus scrofa OX=9823 GN=PRLR 
PE=2 SV=2
Length=625

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 86/203 (42%), Gaps = 12/203 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP +P++   R        C W P +   L T   L   K      E F   C   +   
Sbjct  27   PPGKPEIFKCRSPEKETFTCWWKPGADGGLPTNYTLTYHK----EGETFTHECPDYKTGG  82

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              SC          + YI+++   + +GS  S  +      I++PDPP N+T+       
Sbjct  83   PNSCYFNKKHTSIWTIYIITVNATNQMGSSSSDPRYVDVTYIVEPDPPVNLTLELKKPED  142

Query  232  R--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            +  +L + W  P      S +  L++E+R + E++  + T      Q    I   + G +
Sbjct  143  QKPYLWIKWLPPTLVDVRSGWLTLQYEIRLQPEKTAEWETHFAGQ-QTQFKILSLYPGQK  201

Query  288  HVVQLRAQEEFGQGEWSEWSPEA  310
            ++VQ+R + +   G WSEWSPE+
Sbjct  202  YLVQVRCKPD--HGFWSEWSPES  222


> sp|P46282|IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus 
OX=9913 GN=IL12B PE=2 SV=1
Length=327

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 134/331 (40%), Gaps = 56/331 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V        PG++V LTC    PE++  + W          
Sbjct  14   VLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDT--PEEDG-ITW------TSDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPA  158
                L C  K    +  C W                G      +T  A LL  +     +
Sbjct  125  AKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAALLSAE---KVS  181

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
             + +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++PDP
Sbjct  182  LEHREYNKYTVECQEGS---ACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPDP  238

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            P N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +     
Sbjct  239  PKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAKV  297

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                DA       V+++A++ +    WSEW+
Sbjct  298  TCHKDA------NVRVQARDRYYSSFWSEWA  322


> sp|Q28938|IL12B_PIG Interleukin-12 subunit beta OS=Sus scrofa 
OX=9823 GN=IL12B PE=2 SV=1
Length=324

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 75/330 (23%), Positives = 133/330 (40%), Gaps = 61/330 (18%)

Query  13   LAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS  72
            LA+P  A+         V      + PG+ V LTC    PE++  + W           S
Sbjct  16   LASPIVAIWELEKNVYVVELDWYPNAPGEMVVLTCNT--PEEDG-ITW------TSDQSS  66

Query  73   RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DV------PPEE  116
               G G+ L +   +  D+G Y+C + G       LL+          D+      P  +
Sbjct  67   EVLGTGKTLTIHVKEFGDAGQYTCRKGGAVLSQSLLLLHKKEDGIWSTDILKDQKEPKNK  126

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP------------AEDFQEP  164
              L C  K+      C W      +++T     V+  + S             +ED  E 
Sbjct  127  SFLKCEAKNYSGRFTCWW----LTAISTDLKFSVKSSRGSTDPRGVTCGTATLSEDLGEY  182

Query  165  CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV  224
             +Y  E Q+ S   A P  + S  I  +  A       + T +F    I++PDPP N+ +
Sbjct  183  KKYRVECQEGS---ACPAAEESLPIEVVLEAVHKLKYENYTSSFFIRDIIKPDPPKNLQL  239

Query  225  TAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRY-----RAERSKTFTTWMVKDLQHHC  277
              + +N R + ++W+ P +W++  S++ L F ++      R ++ K FT  +   +  H 
Sbjct  240  NPL-KNSRHVEISWEYPDTWSTPHSYFSLMFGVQVQGKNKREKKDKLFTDQISAKVTCH-  297

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               DA       ++++A++ +    WSEW+
Sbjct  298  --KDA------NIRVQARDRYYSSSWSEWA  319


> sp|P46658|IL12B_CERAT Interleukin-12 subunit beta OS=Cercocebus 
atys OX=9531 GN=IL12B PE=2 SV=1
Length=328

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 129/331 (39%), Gaps = 55/331 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
              LA+P  A+   +     V        PG+ V LTC    PE++  + W L +      
Sbjct  14   VFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDT--PEEDG-ITWTLDQSGEV--  68

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLL----------VDV------PP  114
                 G G+ L ++  +  D+G Y+C++ G       LL           D+      P 
Sbjct  69   ----LGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLPHKKEDGIWSTDILKDQKEPK  124

Query  115  EEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPA  158
             E  L C  K+    + C W                G  +   +T  A  L  +      
Sbjct  125  NETFLRCEAKNYSGRITCWWLSTISTDLTFSIISSRGSSNPQGVTCGAATLSAERVRGDN  184

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++PDP
Sbjct  185  KEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDP  237

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            P N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D    
Sbjct  238  PKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSA  296

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             VI    +       ++AQ+ +    W+EW+
Sbjct  297  TVICRKNASF----SVQAQDRYYSSSWNEWT  323


> sp|Q924V5|IL12B_CAVPO Interleukin-12 subunit beta OS=Cavia porcellus 
OX=10141 GN=IL12B PE=2 SV=1
Length=332

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 80/338 (24%), Positives = 134/338 (40%), Gaps = 65/338 (19%)

Query  8    LLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA  67
            L   LLA+P  A+   +     V     T  PG++V LTC   E ED  T  W       
Sbjct  11   LSLVLLASPLLAMWELKKDVYVVELDWHTDAPGETVVLTCNTAE-EDGIT--WT------  61

Query  68   GSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEP  117
                S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  E+ 
Sbjct  62   SDRKSDILGSGKTLTIQVKEFEDAGGYTCHKGGEVLSRSQLLLHKKEDEIWSTDILKEQK  121

Query  118  Q------LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-------------A  158
                   L C  +S      C W      +  T     V+  + S              +
Sbjct  122  GSNGKTFLKCEARSYSGRFTCWW----LTAFGTDVKFSVKGSRGSSDPSGVTCGEAERVS  177

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
             D QE  +YS E Q+ S   A P  + S  I  +  A       + T +F    I++PDP
Sbjct  178  GDNQEY-KYSVECQEDS---ACPTAEESLPIEVVVDAIHKFKYENYTSSFYIRDIIKPDP  233

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRY-------RAERSKTFTTWM  269
            P N+ +   + N + + V+W+ P +W++  S++ L F ++        R ++ + FT   
Sbjct  234  PKNLQLKP-SVNSQQVEVSWEYPDTWSTPHSYFSLTFLVQTHGKNKNRREKKYELFTDKT  292

Query  270  VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               +  H +           V++RA++ +    WSEW+
Sbjct  293  SATVSCHKISK---------VEVRARDRYYSSSWSEWA  321


> sp|Q61729|IL12B_MARMO Interleukin-12 subunit beta OS=Marmota 
monax OX=9995 GN=IL12B PE=2 SV=1
Length=327

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 125/300 (42%), Gaps = 50/300 (17%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            PG+ V LTC    PE++  + W           S   G G+ L +   +  D+G+Y+C R
Sbjct  42   PGEKVVLTCDT--PEEDG-ITW------TSEQSSEVLGSGKTLTILVKEFEDAGHYTCRR  92

Query  99   AGRPAGTVHLLVD-----------VPPEEPQ----LSCFRKSPLSNVVCEWGPRSTPSLT  143
             G     + LL+            +  +EP+    ++C  K+      C W      +++
Sbjct  93   GGEVLSQMLLLLHKNEDGIWSTDILKKKEPENKNLVTCEAKNYSGRFTCWW----LTAIS  148

Query  144  TKAVLLVRKFQNS---------PAEDFQEPCQYSQ-ESQKFSCQL----AVPEGDSSFYI  189
            T     V+  + S          A    E  +  Q E +K+S Q     A P  + +  I
Sbjct  149  TDVNFSVKSHRGSSDPQGVTCGEATLSAERVKIEQREYKKYSVQCQEDNACPTAEETLPI  208

Query  190  VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--S  247
              +  A       +   +F    I++PDPP N+ +   ++ P+ + VTW+ P SW++  S
Sbjct  209  TVVVDAVHKLKYENYISSFFIRDIIKPDPPKNLKMKP-SKTPQQVEVTWEYPDSWSTPHS  267

Query  248  FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            ++ L F ++ + ++ K   T  V       V      G +  V ++A++ +    WSEW+
Sbjct  268  YFSLTFSVQVQGKKKKRSNTLHVDKTS---VTVTCQKGAK--VSVQARDRYYNSSWSEWA  322


> sp|Q28268|IL12B_CANLF Interleukin-12 subunit beta OS=Canis lupus 
familiaris OX=9615 GN=IL12B PE=2 SV=1
Length=329

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/303 (22%), Positives = 126/303 (42%), Gaps = 54/303 (18%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            PG+ V LTC   E +D   + W        +  S   G G+ L ++  +  D+G Y+C++
Sbjct  42   PGEMVVLTCHTPEEDD---ITW------TSAQSSEVLGSGKTLTIQVKEFGDAGQYTCHK  92

Query  99   AGRPAGTVHLLV----------DVPPEEPQ------LSCFRKSPLSNVVCEW--------  134
             G+      LL+          D+  E+ +      L C  K+      C W        
Sbjct  93   GGKVLSRSLLLIHKKEDGIWSTDILKEQKESKNKIFLKCEAKNYSGRFTCWWLTAISTDL  152

Query  135  --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
                    G      +T  AV L  +       D++   +Y+ E Q+ S   A P  + S
Sbjct  153  KFSVKSSRGFSDPQGVTCGAVTLSAERVRVDNRDYK---KYTVECQEGS---ACPSAEES  206

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
              I  +  A       + T +F    I++PDPP N+ +  + +N R + V+W+ P +W++
Sbjct  207  LPIEVVVDAIHKLKYENYTSSFFIRDIIKPDPPTNLQLKPL-KNSRHVEVSWEYPDTWST  265

Query  247  --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              S++ L F ++ + + ++     +  D     V+    + +R    ++A++ +    WS
Sbjct  266  PHSYFSLTFCVQAQGKNNREKKDRLCVDKTSAKVVCHKDAKIR----VQARDRYYSSSWS  321

Query  305  EWS  307
            +W+
Sbjct  322  DWA  324


> sp|Q866G3|IL12B_BUBBU Interleukin-12 subunit beta OS=Bubalus 
bubalis OX=89462 GN=IL12B PE=2 SV=1
Length=327

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 134/332 (40%), Gaps = 58/332 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V        PG++V LTC    PE++  + W          
Sbjct  14   VLLASPIVAIWELEKNVYIVELDWYPDAPGETVVLTCDT--PEEDG-ITW------TSDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-----------------  157
                L C  K    +  C W      +++T     V+  + S                  
Sbjct  125  AKSFLKCEAKDYSGHFTCWW----LTAISTDLKFSVKSSRGSADPRGVTCGAASLSAEKV  180

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
            + D +E  +Y+ E Q+ S     P  + S  I  +  A       + T +F    I++PD
Sbjct  181  SVDHREYNKYTVECQEGS---TCPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +    
Sbjct  238  PPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAK  296

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                 DA       V+++A++ +    WSEW+
Sbjct  297  VTCHKDA------NVRVQARDRYYSSFWSEWA  322


> sp|Q2PE76|IL12B_BUBCA Interleukin-12 subunit beta OS=Bubalus 
carabanensis OX=346063 GN=IL12B PE=2 SV=1
Length=327

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 134/332 (40%), Gaps = 58/332 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V        PG++V LTC    PE++  + W          
Sbjct  14   VLLASPIVAIWELEKNVYIVELDWYPDAPGETVVLTCDT--PEEDG-ITW------TSDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-----------------  157
                L C  K    +  C W      +++T     V+  + S                  
Sbjct  125  AKSFLKCEAKDYSGHFTCWW----LTAISTDLKFSVKSSRGSSDPRGVTCGAASLSAEKV  180

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
            + D +E  +Y+ E Q+ S     P  + S  I  +  A       + T +F    I++PD
Sbjct  181  SVDHREYNKYTVECQEGS---TCPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +    
Sbjct  238  PPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAK  296

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                 DA       V+++A++ +    WSEW+
Sbjct  297  VTCHKDA------NVRVQARDRYYSSFWSEWA  322


> sp|P68220|IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries 
OX=9940 GN=IL12B PE=1 SV=1
Length=327

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 74/335 (22%), Positives = 137/335 (41%), Gaps = 64/335 (19%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V      + PG++V LTC    PE++  + W          
Sbjct  14   VLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDT--PEEDG-ITWT------SDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-----------------  157
                L C  K    +  C W      +++T     V+  + S                  
Sbjct  125  AKSFLKCEAKDYSGHFTCSW----LTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKV  180

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
            + D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++PD
Sbjct  181  SMDHREYNKYTVECQEGS---ACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAE---RSKTFTTWMVKD  272
            PP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +     K FT      
Sbjct  238  PPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAK  296

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            +  H    DA       ++++A++ +    WSEW+
Sbjct  297  VTCH---KDA------NIRVQARDRYYSSFWSEWA  322


> sp|P68221|IL12B_CAPHI Interleukin-12 subunit beta OS=Capra hircus 
OX=9925 GN=IL12B PE=2 SV=1
Length=327

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 74/335 (22%), Positives = 137/335 (41%), Gaps = 64/335 (19%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V      + PG++V LTC    PE++  + W          
Sbjct  14   VLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDT--PEEDG-ITWT------SDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-----------------  157
                L C  K    +  C W      +++T     V+  + S                  
Sbjct  125  AKSFLKCEAKDYSGHFTCSW----LTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKV  180

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
            + D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++PD
Sbjct  181  SMDHREYNKYTVECQEGS---ACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAE---RSKTFTTWMVKD  272
            PP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +     K FT      
Sbjct  238  PPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAK  296

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            +  H    DA       ++++A++ +    WSEW+
Sbjct  297  VTCH---KDA------NIRVQARDRYYSSFWSEWA  322


> sp|P48095|IL12B_MACMU Interleukin-12 subunit beta OS=Macaca mulatta 
OX=9544 GN=IL12B PE=2 SV=1
Length=328

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 129/331 (39%), Gaps = 55/331 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
              LA+P  A+   +     V        PG+ V LTC    PE++  + W L +      
Sbjct  14   VFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDT--PEEDG-ITWTLDQSGEV--  68

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--PP  114
                 G G+ L ++  +  D+G Y+C++ G                  +  +L D   P 
Sbjct  69   ----LGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPK  124

Query  115  EEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPA  158
             +  L C  K+      C W                G  +   +T  AV L  +      
Sbjct  125  NKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDN  184

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++PDP
Sbjct  185  KEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDP  237

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            P N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D    
Sbjct  238  PKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSA  296

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             VI    +       ++AQ+ +    WSEW+
Sbjct  297  TVICRKNASF----SVQAQDRYYSSSWSEWA  323


> sp|O02744|IL12B_FELCA Interleukin-12 subunit beta OS=Felis catus 
OX=9685 GN=IL12B PE=2 SV=1
Length=329

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 122/303 (40%), Gaps = 54/303 (18%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            PG+ V LTC   E +D   + W           S   G G+ L ++  +  D+G Y+C++
Sbjct  42   PGEMVVLTCNTPEEDD---ITW------TSDQSSEVLGSGKTLTIQVKEFADAGQYTCHK  92

Query  99   AGRPAGTVHLLV----------DVPPEEPQ------LSCFRKSPLSNVVCEW--------  134
             G       LL+          D+  E+ +      L C  K+      C W        
Sbjct  93   GGEVLSHSFLLIHKKEDGIWSTDILREQKESKNKIFLKCEAKNYSGRFTCWWLTAISTDL  152

Query  135  --------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
                    G      +T  A  L  +       D++   +Y+ E Q+ S   A P  + S
Sbjct  153  KFTVKSSRGSSDPQEVTCGAATLSAEKVRVDNRDYK---KYTVECQEGS---ACPAAEES  206

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
              I  +  A       + T +F    I++PDPP N+ +  + +N R + V+W+ P +W++
Sbjct  207  LPIEVVVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL-KNSRHVEVSWEYPDTWST  265

Query  247  --SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              S++ L F ++ + + ++     +  D     V+    + +R    ++A++ +    WS
Sbjct  266  PHSYFSLTFGVQVQGKNNREKKDRLSVDKTSAKVVCHKDAKIR----VQARDRYYSSSWS  321

Query  305  EWS  307
             W+
Sbjct  322  NWA  324


> sp|Q90374|PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 
GN=PRLR PE=2 SV=1
Length=830

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 105/246 (43%), Gaps = 27/246 (11%)

Query  75   AGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV---DVPPEEPQLSCFRKSPLSNVV  131
            AG+   + +R V   D G +S + + R     H+ +   + PPE+P +   R        
Sbjct  197  AGVKYVVQVRCVL--DIGEWSEWSSER-----HIHIPNGESPPEKPTIIKCRSPEKETFT  249

Query  132  CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF---Y  188
            C W P S     T   LL  K      E+    C   + +   SC     +  +SF   Y
Sbjct  250  CWWKPGSDGGHPTNYTLLYSK----EGEERVYECPDYKTAGPNSCYFD--KKHTSFWTIY  303

Query  189  IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV---TAVARNPRWLSVTWQDP--HS  243
             +++   + +GS  S         I+Q DPP N+T+     V R P +L +TW  P    
Sbjct  304  NITVKATNEIGSNVSDPLYVDVTYIVQTDPPVNVTLELKKTVNRKP-YLVLTWSPPPLAD  362

Query  244  WNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
              S +  L +ELR + E ++ + T  V   Q H  +     G +++VQ+  + +   G W
Sbjct  363  VRSGWLTLDYELRLKPEEAEEWETIFVGQ-QTHYKMFSLNPGKKYIVQIHCKPDH-HGSW  420

Query  304  SEWSPE  309
            SEWS E
Sbjct  421  SEWSLE  426


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 88/200 (44%), Gaps = 11/200 (6%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            P +P++   R        C W P S   L T   L    F +  +E+    C     S  
Sbjct  28   PGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTL----FYSKDSEEKIYECPDYGMSGP  83

Query  174  FSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV-TAVARNP  231
             SC       +  + Y +++   + +GS  S  Q      I+QPD P N+++ T  + + 
Sbjct  84   NSCYFDKNHTNPWTTYNITVMAMNEIGSNSSDPQYVDVTSIVQPDAPVNLSLETKTSAST  143

Query  232  RWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
             +L   W  P      S+ +  R+ELR + E  + + T  V  +Q    ++   +G+++V
Sbjct  144  TYLLAKWSPPPLADVTSNSHVYRYELRLKPEEKEEWETVSV-GVQTQYKVNRLQAGVKYV  202

Query  290  VQLRAQEEFGQGEWSEWSPE  309
            VQ+R   +   GEWSEWS E
Sbjct  203  VQVRCVLDI--GEWSEWSSE  220


> sp|Q9XSQ5|IL12B_HORSE Interleukin-12 subunit beta OS=Equus caballus 
OX=9796 GN=IL12B PE=2 SV=1
Length=329

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/332 (22%), Positives = 131/332 (39%), Gaps = 56/332 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V        PG+ V LTC   E E    + W        + 
Sbjct  14   VLLASPLMAIWELEKDVYVVELDWYPDAPGEMVVLTCNTPEEEG---ITW------TSAQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             +   G G+ L ++  +  D+G Y+C++ G      HLL+          D+  ++ +  
Sbjct  65   SNEVLGSGKTLTIQVKEFGDAGWYTCHKGGEVLSHSHLLLHKKEDGIWSTDILKDQKESK  124

Query  119  ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-----------------  157
                L C  K+      C W      +++T     V+  + S                  
Sbjct  125  NKTFLKCEAKNYSGRFTCWW----LTAISTDLKFSVKSSRGSSDPRGVTCGAATLSAERV  180

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
            + D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T  F    I++PD
Sbjct  181  SVDDREYKKYTVECQEGS---ACPAAEESLPIEIVVDAVHKLKYENYTSGFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  K     +  D   
Sbjct  238  PPKNLQLKPL-KNSRQVEVSWEYPETWSTPHSYFSLTFSIQVQGKNKKERKDRLFMDETS  296

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
              V       +R    ++A++ +    WSEW+
Sbjct  297  ATVTCHKDGQIR----VQARDRYYSSSWSEWA  324


> sp|Q865Y3|IL12B_PAPAN Interleukin-12 subunit beta OS=Papio anubis 
OX=9555 GN=IL12B PE=2 SV=1
Length=328

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 128/331 (39%), Gaps = 55/331 (17%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
              LA+P  A+   +     V        PG+ V LTC    PE++  + W L +      
Sbjct  14   VFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDT--PEEDG-ITWTLDQSGEV--  68

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--PP  114
                 G G+ L ++  +  D+G Y+C++ G                  +  +L D   P 
Sbjct  69   ----LGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPK  124

Query  115  EEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPA  158
             +  L C  K+      C W                G  +   +T  AV L  +      
Sbjct  125  NKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDN  184

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++PDP
Sbjct  185  KEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDP  237

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            P N+ +  + +N R   V+W+ P +W++  S++ L F ++ + +  +     +  D    
Sbjct  238  PKNLQLKPL-KNSRQAEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSA  296

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             VI    +       ++AQ+ +    WSEW+
Sbjct  297  TVICRKNASF----SVQAQDRYYSSSWSEWA  323


> sp|Q28234|IL12B_CEREL Interleukin-12 subunit beta OS=Cervus elaphus 
OX=9860 GN=IL12B PE=2 SV=1
Length=327

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 72/338 (21%), Positives = 134/338 (40%), Gaps = 70/338 (21%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LL +P  A+         V        PG++V L C    PE++  + W          
Sbjct  14   VLLTSPIVAIWELEKNVYVVELDWYPDAPGETVVLRCDT--PEEDG-ITW------TSDQ  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ--  118
             S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +  
Sbjct  65   SSEVLGSGKTLTVQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPK  124

Query  119  ----LSCFRKSPLSNVVCEW-------------------GPRST----PSLTTKAVLLVR  151
                L C  K    +  C W                    PR       SL+T+ V++  
Sbjct  125  AKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAASLSTEKVIV--  182

Query  152  KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
                    D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F   
Sbjct  183  --------DHREYKKYTVECQEGS---ACPAAEESLPIEVVVEAVHKLKYENYTSSFFIR  231

Query  212  GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWM  269
             I++PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M
Sbjct  232  DIIKPDPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFM  290

Query  270  VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             +         DA       ++++A++ +    WSEW+
Sbjct  291  DQTSAKVTCHKDA------SIRVQARDRYYNSFWSEWA  322


> sp|P14787|PRLR_RABIT Prolactin receptor OS=Oryctolagus cuniculus 
OX=9986 GN=PRLR PE=1 SV=1
Length=616

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 84/203 (41%), Gaps = 12/203 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP +P +   R        C W P +   L T   L   K      E     C   +   
Sbjct  27   PPGKPFIFKCRSPEKETFTCWWRPGADGGLPTNYTLTYHK----EGETITHECPDYKTGG  82

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              SC  +       + YI+++   + +GS  S  +      I++PDPP N+T+       
Sbjct  83   PNSCYFSKKHTSIWTIYIITVNATNQMGSSVSDPRYVDVTYIVEPDPPVNLTLEVKHPED  142

Query  232  R--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            R  +L V W  P      S +  L++E+R + E++  + T      Q    I   + G +
Sbjct  143  RKPYLWVKWLPPTLVDVRSGWLTLQYEIRLKPEKAAEWETHFAGQ-QTQFKILSLYPGQK  201

Query  288  HVVQLRAQEEFGQGEWSEWSPEA  310
            ++VQ+R + +   G WS WSPE+
Sbjct  202  YLVQVRCKPD--HGFWSVWSPES  222


> sp|P40189|IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo 
sapiens OX=9606 GN=IL6ST PE=1 SV=2
Length=918

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 103/230 (45%), Gaps = 31/230 (13%)

Query  106  VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAED  160
            + ++  +PPE+P+ LSC        + CEW G R T    + T K+     KF +  A  
Sbjct  118  ITIISGLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA--  174

Query  161  FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQP  216
                    +     SC +      S+ Y V++ V     +++G   S    F     ++P
Sbjct  175  --------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKP  222

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---  273
            +PP N++V         L +TW +P     S   L++ ++YR + + T++    +D    
Sbjct  223  NPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTAST  280

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE--SRSP  321
            +    + D      +V ++R  +E G+G WS+WS EA G  + +  S++P
Sbjct  281  RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAP  330


> sp|P40190|IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus 
norvegicus OX=10116 GN=Il6st PE=1 SV=1
Length=918

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 103/226 (46%), Gaps = 24/226 (11%)

Query  106  VHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
            + +L   PP+ P  LSC       N++C+  P     L T   L          E F + 
Sbjct  118  ITILSGYPPDIPTNLSCIVNEG-KNMLCQLDPGRETYLETNYTLK----SEWATEKFPD-  171

Query  165  CQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKFSKTQTFQGCGILQPDPPA  220
            C+    +   SC +    G +  Y V++ V     +++G+  S+   F     ++P PP 
Sbjct  172  CRTKHGTS--SCMM----GYTPIYFVNIEVWVEAENALGNVSSEPINFDPVDKVKPSPPH  225

Query  221  NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHC  277
            N++VT        L + W +  S   S  RL+ +++YR + + T+    ++D    +   
Sbjct  226  NLSVTNSEELSSILKLAWVN--SGLDSILRLKSDIQYRTKDASTWIQVPLEDTVSPRTSF  283

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE--SRSP  321
             + D      +V ++R+ +E G+G WS+WS EA GT + +  S++P
Sbjct  284  TVQDLKPFTEYVFRIRSIKENGKGYWSDWSEEASGTTYEDRPSKAP  329


> sp|Q00560|IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus 
musculus OX=10090 GN=Il6st PE=1 SV=2
Length=917

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/224 (24%), Positives = 99/224 (44%), Gaps = 21/224 (9%)

Query  106  VHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
            V +L   PP++P  L+C       N++C+W P     L T   L         +E   E 
Sbjct  118  VTMLSGFPPDKPTNLTCIVNEG-KNMLCQWDPGRETYLETNYTL--------KSEWATEK  168

Query  165  CQYSQESQKFSCQLAVPEGDSSFYI---VSMCVASSVGSKFSKTQTFQGCGILQPDPPAN  221
                Q     SC ++      ++Y+   V +   +++G   S++  F     ++P PP N
Sbjct  169  FPDCQSKHGTSCMVSYM---PTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYN  225

Query  222  ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCV  278
            ++VT        L ++W    S       L+ +++YR + + T+    ++D    +    
Sbjct  226  LSVTNSEELSSILKLSWVS--SGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFT  283

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
            + D      +V ++R+ ++ G+G WS+WS EA GT + +  S P
Sbjct  284  VQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSRP  327


> sp|Q28235|PRLR_CEREL Prolactin receptor OS=Cervus elaphus OX=9860 
GN=PRLR PE=2 SV=1
Length=581

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 83/203 (41%), Gaps = 12/203 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP +P++   R        C W P S   L T   L   K      E     C   +   
Sbjct  27   PPGKPKIIKCRSPGKETFTCWWEPGSDGGLPTNYTLTYHK----EGETLIHECPDYKTGG  82

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              +C  +         Y++++   + +G   S         I++P+PPAN+T+       
Sbjct  83   PNTCYFSKKHTSIWKIYVITVNAINQMGVSSSDPLYVDVTYIVEPEPPANLTLELKHPED  142

Query  232  R--WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            R  +L + W  P      S ++ +++E+R + E +  +        Q    I   + G +
Sbjct  143  RKPYLWIKWFPPTLTDVKSGWFMIQYEIRLKPETAADWEIHFAAK-QTQLKIFSLYPGQK  201

Query  288  HVVQLRAQEEFGQGEWSEWSPEA  310
            ++VQ+R + +   G WSEWSPE+
Sbjct  202  YLVQVRCKPD--HGYWSEWSPES  222


> sp|Q8MJS1|I12R2_PIG Interleukin-12 receptor subunit beta-2 OS=Sus 
scrofa OX=9823 GN=IL12RB2 PE=2 SV=1
Length=861

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 83/200 (42%), Gaps = 12/200 (6%)

Query  110  VDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC-QY  167
            V V PE+PQ +SC +K     V C W       L T   L +   +N     +Q+ C  Y
Sbjct  120  VGVVPEQPQNVSCMQKGERGTVACSWDRGRDTHLYTAYTLQLNGPKNL---TWQKQCSDY  176

Query  168  SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV  227
              +S      L  PE   S Y   +   +S+G+  S   TF    +++P PP +I +  V
Sbjct  177  YCDSLDLGINLP-PESPESSYTAQVTAINSLGTASSLPSTFTFLDVVRPLPPWDIRIKCV  235

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              +    ++ W+D          L   LRYR   S+++      + +    + D      
Sbjct  236  NASVSTCTLQWRD------EGLVLLNRLRYRPVYSRSWNMVNATNAKGRHDLVDLKPFTE  289

Query  288  HVVQLRAQEEFGQGEWSEWS  307
            +  Q+ ++    +G WS+WS
Sbjct  290  YEFQISSKPHLQKGRWSDWS  309


> sp|Q91513|PRLR_ORENI Prolactin receptor OS=Oreochromis niloticus 
OX=8128 GN=prlr PE=2 SV=1
Length=630

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 85/204 (42%), Gaps = 19/204 (9%)

Query  112  VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            +P +  ++ C R        C W P S   L T   L  RK       D    C     +
Sbjct  28   LPGKPTEIKC-RSPEKETFTCWWKPGSDGGLPTTYALYYRK----EGSDVVHECPDYHTA  82

Query  172  QKFSCQLAVPEGDSSF----YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV  227
             K SC       +++     Y +++   +++G  +S  Q      I+QP PP  + VT V
Sbjct  83   GKNSCFF---NKNNTLIWVSYNITVVATNALGKTYSDPQDIDVVYIVQPHPPEKLEVT-V  138

Query  228  ARNPRW--LSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAW  283
             ++  W  L V+W+ P   +  S +  L +ELR + E  ++         Q    I    
Sbjct  139  MKDQGWPFLRVSWEPPRKADTRSGWITLIYELRVKLEDEESEWENHAAGQQKMFNIFSLR  198

Query  284  SGLRHVVQLRAQEEFGQGEWSEWS  307
            SG  +++Q+R + +   G WSEWS
Sbjct  199  SGGTYLIQVRCKPD--HGFWSEWS  220


> sp|P05710|PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 
GN=Prlr PE=1 SV=2
Length=610

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 16/205 (8%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP +P++   R        C W P +   L T   L   K      E     C   + S 
Sbjct  22   PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSG  77

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVAR  229
              SC  +         YI+++   + +GS  S         I++P+PP N+T  V  +  
Sbjct  78   PNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKD  137

Query  230  NPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSG  285
               +L V W  P      + ++ + +E+R + E ++    W +    H     + D + G
Sbjct  138  KKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPG  194

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEA  310
             +++VQ R + +   G WS WS E+
Sbjct  195  QKYLVQTRCKPD--HGYWSRWSQES  217


> sp|Q91ZK7|IL12B_SIGHI Interleukin-12 subunit beta OS=Sigmodon 
hispidus OX=42415 GN=IL12B PE=2 SV=1
Length=327

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/304 (22%), Positives = 123/304 (40%), Gaps = 58/304 (19%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            PG+ V LTC   E +D   + W           S   G G+ L+++  +  D+G Y+C++
Sbjct  42   PGERVVLTCDTSEEDD---IIW------TSDQSSEVVGSGKTLIVQVKEFSDAGQYTCHK  92

Query  99   AGRPAGTVHLLV----------DV--PPEEPQLSCFRKSPLSN----VVCEWGPRSTPSL  142
             G       LL+          D+    ++P+   F K   +N      C W    +  L
Sbjct  93   GGETLSHSRLLLHKKEDGIWSTDILKDQKDPKNKTFLKCEAANYSGRFTCWWLTAVSTDL  152

Query  143  ----------------TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
                            T  A  L  +       D+    +YS   Q+    +  P  + +
Sbjct  153  KFSLKSSSSSSDSRSVTCGAASLSTEKVTVDQRDYN---KYSVACQE---DITCPTAEET  206

Query  187  FYIVSMCVASSVGSKFSKTQT-FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              I  + + +    K+    T F    I++PDPP N+ +  +  +   + V+W+ P SW+
Sbjct  207  LPI-ELVMEAQHKYKYENYSTGFFIRDIIKPDPPKNLQLKPLKSSQ--VEVSWEYPDSWS  263

Query  246  S--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
            +  S++ L+F ++   ++ K   + +V   +    I  +  G    V++RAQ+ +    W
Sbjct  264  TPHSYFSLKFFVQVYRKKEKKGESLLVD--KPSAKIRCSKGG---EVRVRAQDHYYNSSW  318

Query  304  SEWS  307
            SEW+
Sbjct  319  SEWA  322


> sp|Q9BEG2|I12R2_BOVIN Interleukin-12 receptor subunit beta-2 
OS=Bos taurus OX=9913 GN=IL12RB2 PE=2 SV=1
Length=861

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 100/240 (42%), Gaps = 14/240 (6%)

Query  110  VDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ-Y  167
            V V PE+P+ LSC +K     V C W       L T   L +   +N     +Q+ C  +
Sbjct  120  VGVVPEQPRNLSCIQKGERGTVTCTWHRGRDTHLYTAYTLQLNGPKNL---TWQKQCNDH  176

Query  168  SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV  227
              +       L  PE   S Y V +   +S+GS  S   +F    I++P PP +I +  V
Sbjct  177  YCDHLDLGINLT-PESLESSYTVKVTAINSLGSASSFPFSFTLLDIVRPLPPWDIRIKFV  235

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              +    ++ W+D          L   LRYR   S+++    V + +    + D      
Sbjct  236  NASVDRCTLLWRD------EGLVLLNRLRYRPINSRSWNMVNVTNAKGRHDLLDLKPFTE  289

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRD  347
            +  Q+ ++    +G WS+WS E++ T  T    P     V    Q +  N+   ++ +++
Sbjct  290  YEFQISSKLHLYKGSWSDWS-ESLRTQ-TPEEEPIGMLNVWYMRQHIDYNRQQISLFWKN  347


> sp|Q865W9|IL12B_LAMGL Interleukin-12 subunit beta OS=Lama glama 
OX=9844 GN=IL12B PE=2 SV=1
Length=330

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 71/335 (21%), Positives = 137/335 (41%), Gaps = 61/335 (18%)

Query  11   ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
             LLA+P  A+         V        PG++V LTC    PE++  + W         H
Sbjct  14   VLLASPIMAIWELEKNVYVVELDWYPDAPGETVVLTCDT--PEEDG-ITW------TSDH  64

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHL-------------LVDVPPEEP  117
             S   G G+ L ++  +  D+G Y+C++ G       L             ++    +EP
Sbjct  65   SSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGVWSTDILKKDQKEP  124

Query  118  Q----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-------------AE-  159
            +    L C  K+   +  C W      +++T     V+  + S              AE 
Sbjct  125  KSKTFLKCEAKNYSGHFTCWW----LTAVSTDLKFSVKSSRGSSDPRGVTCGAATLSAER  180

Query  160  ---DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               + ++  +Y+ E Q+ S   + P  + S  I  +  A       + + +F    I++P
Sbjct  181  VGVEHRDSWKYTVECQEGS---SCPAAEESLPIELVVEAVHKLKYENYSSSFFIRDIIRP  237

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D  
Sbjct  238  DPPKNLQLKPL-KNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQGKHKREKKDKLFVDQT  296

Query  275  HHCVI--HDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               V    DA       ++++A++ +    WSEW+
Sbjct  297  SAKVTCPKDA------SIRVQARDRYYSSSWSEWA  325


> sp|Q08501|PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 
GN=Prlr PE=1 SV=1
Length=608

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 81/204 (40%), Gaps = 16/204 (8%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP +P++   R        C W P S   L T   L   K      E     C   + S 
Sbjct  22   PPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSK----EGEKNTYECPDYKTSG  77

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT--VTAVAR  229
              SC  +         YI+++   + +GS  S         I++P+PP N+T  V  +  
Sbjct  78   PNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKD  137

Query  230  NPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSG  285
               +L V W  P      + ++ + +E+R ++E +     W +    H     + D + G
Sbjct  138  KKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEAD---EWEIHFTGHQTQFKVFDLYPG  194

Query  286  LRHVVQLRAQEEFGQGEWSEWSPE  309
             +++VQ R + +   G WS W  E
Sbjct  195  QKYLVQTRCKPD--HGYWSRWGQE  216


> sp|P16471|PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 
GN=PRLR PE=1 SV=1
Length=622

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 76/202 (38%), Gaps = 12/202 (6%)

Query  112  VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            +PP +P++   R        C W P +   L T   L   +      E     C      
Sbjct  26   LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITG  81

Query  172  QKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
               SC            YI+ +   + +GS FS         I+QPDPP  + V      
Sbjct  82   GPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE  141

Query  231  PR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL  286
             R  +L + W  P      + ++ L +E+R + E++  +        Q    I     G 
Sbjct  142  DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQ-QTEFKILSLHPGQ  200

Query  287  RHVVQLRAQEEFGQGEWSEWSP  308
            +++VQ+R + +   G WS WSP
Sbjct  201  KYLVQVRCKPD--HGYWSAWSP  220


> sp|Q99665|I12R2_HUMAN Interleukin-12 receptor subunit beta-2 
OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
Length=862

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 106/292 (36%), Gaps = 46/292 (16%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS-HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
            L G +V +TC                KP  G  H SR   +      R +  H   + + 
Sbjct  42   LLGSTVNITCS--------------LKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNS  87

Query  97   YRAGRPAGTV-------------------HLLVDVPPEEPQ-LSCFRKSPLSNVVCEWGP  136
               G P GT                     + V V PE+PQ LSC +K     V C W  
Sbjct  88   QVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWER  147

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ-YSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                 L T+  L +   +N     +Q+ C+    +   F   L  PE   S +   +   
Sbjct  148  GRDTHLYTEYTLQLSGPKNL---TWQKQCKDIYCDYLDFGINLT-PESPESNFTAKVTAV  203

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
            +S+GS  S   TF    I++P PP +I +     +    ++ W+D          L   L
Sbjct  204  NSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRD------EGLVLLNRL  257

Query  256  RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            RYR   S+ +    V   +    + D      +  Q+ ++    +G WS+WS
Sbjct  258  RYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWS  309


> sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like 
protein 1 OS=Homo sapiens OX=9606 GN=DSCAML1 PE=1 SV=2
Length=2053

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 57/125 (46%), Gaps = 14/125 (11%)

Query  81    LLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
             LLLR+V+  DSG Y+C      G     V+LLV VPP++P+L+   K+  S++   W P 
Sbjct  1348  LLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLVQVPPDQPRLTV-SKTSASSITLTWIPG  1406

Query  138   STPSLTTKAVLLVRKFQNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                  + +  +L     NS    + F    + S +     C         ++Y V +   
Sbjct  1407  DNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKC--------GTWYKVKLAAK  1458

Query  196   SSVGS  200
             +SVGS
Sbjct  1459  NSVGS  1463


> sp|Q8CJE6|IL12B_MESAU Interleukin-12 subunit beta OS=Mesocricetus 
auratus OX=10036 GN=IL12B PE=2 SV=1
Length=327

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 126/332 (38%), Gaps = 58/332 (17%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
              LLA+P  A+         V         G+ V LTC   E +D   + W   K +   
Sbjct  13   VVLLASPLMAIWELEKDVYVVEVDWSPDAAGERVVLTCDTSEEDD---IIWTSDKNSEA-  68

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DV--PPEEP  117
                  G G+ L ++  +  ++G Y+C++ G+      LL+          D+    ++P
Sbjct  69   -----VGSGKTLTIQVKEFSNAGQYTCHKGGKTLSHSRLLLHKKENGIWSTDILKDQKDP  123

Query  118  QLSCFRKSPLSN----VVCEWGPRSTPSL----------------TTKAVLLVRKFQNSP  157
            +   F K   +N      C W    +  L                T  A  L  +     
Sbjct  124  KNKTFLKCEAANYSGRFTCWWLTAISTDLKFNVKSSSSSSDSRAVTCGAASLSAEKVTVD  183

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT-FQGCGILQP  216
             +D+Q   +YS   Q+    +  P  + +  I  + + +    K+    T F    I++P
Sbjct  184  RKDYQ---KYSVACQE---DITCPTAEETLPI-GLVMEAQHKYKYENYSTGFFIRDIIKP  236

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  +  +   + ++W+ P SW++  S++ L+F ++   +R +   +  V    
Sbjct  237  DPPKNLQLKPLRGSQ--MELSWEYPDSWSTPHSYFSLKFHVQVHRKRERKDESQFVDKTS  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
                           V++RAQ+ +    WS W
Sbjct  295  ATIRCSKG-----AEVRVRAQDHYYNSSWSRW  321


> sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like 
protein 1 homolog OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 
SV=2
Length=2053

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 57/125 (46%), Gaps = 14/125 (11%)

Query  81    LLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
             LLLR+V+  DSG Y+C      G     V+LLV VPP++P+L+   K+  S++   W P 
Sbjct  1348  LLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLVQVPPDQPRLTV-SKTSASSITLTWIPG  1406

Query  138   STPSLTTKAVLLVRKFQNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                  + +  +L     NS    + F    + S +     C         ++Y V +   
Sbjct  1407  DNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKC--------GTWYKVKLAAK  1458

Query  196   SSVGS  200
             +SVGS
Sbjct  1459  NSVGS  1463


> sp|Q14213|IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens 
OX=9606 GN=EBI3 PE=1 SV=2
Length=229

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 82/200 (41%), Gaps = 9/200 (5%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P++ C        V C W     P+ T+    +        A     PC   Q     SC
Sbjct  31   PRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPC-LQQTPTSTSC  89

Query  177  QLA-VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
             +  V     + Y++++      GS  S    F    I++PDPP  + ++ +A   R L 
Sbjct  90   TITDVQLFSMAPYVLNVTAVHPWGSS-SSFVPFITEHIIKPDPPEGVRLSPLAE--RQLQ  146

Query  236  VTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS-GLRHVVQLR  293
            V W+ P SW     + L++ +RY+ + +  F    V  ++    I  A     R+ VQ+ 
Sbjct  147  VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHR--VGPIEATSFILRAVRPRARYYVQVA  204

Query  294  AQEEFGQGEWSEWSPEAMGT  313
            AQ+    GE S+WS  A  T
Sbjct  205  AQDLTDYGELSDWSLPATAT  224


> sp|E1C8P7|DSCL1_CHICK Down syndrome cell adhesion molecule-like 
protein 1 homolog OS=Gallus gallus OX=9031 GN=DSCAML1 PE=1 
SV=2
Length=2042

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query  81    LLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
             L+LRSV+  DSG Y+C      G     ++LLV VPP++P+L+   K+  S++   W P 
Sbjct  1349  LVLRSVKAEDSGYYTCTATNTWGFDTIIINLLVQVPPDQPRLTV-SKTSASSITLAWIPG  1407

Query  138   STPSLTTKAVLLVRKFQNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                  + +  +L     NS    + F    + S + +   C         ++Y V +   
Sbjct  1408  DNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSFKLESLKC--------GTWYKVKLAAK  1459

Query  196   SSVGS  200
             +SVG+
Sbjct  1460  NSVGA  1464


> sp|P97378|I12R2_MOUSE Interleukin-12 receptor subunit beta-2 
OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
Length=874

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 46/210 (22%), Positives = 79/210 (38%), Gaps = 13/210 (6%)

Query  102  PAGTVHLLVDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAED  160
            P   V + V V PE PQ +SC ++     V C W       L T   L +    N     
Sbjct  125  PVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNLTC--  182

Query  161  FQEPCQYSQESQKFSCQLAV---PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             Q+ C            L +   P+   S +IV +   + +G+  S   TF    I+ P 
Sbjct  183  -QKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIPL  241

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            PP +I +  +  +    ++ W+D          +  +LRY+   S ++      + +   
Sbjct  242  PPWDIRINFLNASGSRGTLQWEDEGQ------VVLNQLRYQPLNSTSWNMVNATNAKGKY  295

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             + D      +  Q+ ++     G WS WS
Sbjct  296  DLRDLRPFTEYEFQISSKLHLSGGSWSNWS  325


> sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 
GN=sls PE=1 SV=3
Length=18141

 Score = 43.9 bits (102),  Expect = 0.004, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query  76     GMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
              G  RRL++R V +HD G Y+C   G+      +++++PPE  +       PL++V    G
Sbjct  17059  GKARRLVIRDVTIHDEGQYTCKIEGQECSCELVVIELPPEIVE-------PLNDVAVTKG  17111

Query  136    PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL--AVPE  182
                +   +  +K   LV+ F+N     F E  Q + + +K S ++  A PE
Sbjct  17112  ENAVFEVELSKGDALVKWFKNGKEIVFNERIQLAIDGKKQSLRIVKAKPE  17161


> sp|P43432|IL12B_MOUSE Interleukin-12 subunit beta OS=Mus musculus 
OX=10090 GN=Il12b PE=1 SV=1
Length=335

 Score = 42.4 bits (98),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 91/245 (37%), Gaps = 36/245 (15%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            PG++V LTC   E ED+ T     R    GS        G+ L +   +  D+G Y+C++
Sbjct  42   PGETVNLTCDTPE-EDDITWTSDQRHGVIGS--------GKTLTITVKEFLDAGQYTCHK  92

Query  99   AGRPAGTVHLLVDVP-------------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK  145
             G      HLL+                  +  L C   +      C W  +    L   
Sbjct  93   GGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN  152

Query  146  AVLLV-----RKFQNSPAEDFQEPCQYSQ---ESQKFSCQ--LAVPEGDSSFYIVSMCVA  195
                      R      A    E     Q   E    SCQ  +  P  + +  I     A
Sbjct  153  IKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEA  212

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRF  253
                   + + +F    I++PDPP N+ +  +  +   + V+W+ P SW++  S++ L+F
Sbjct  213  RQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQ--VEVSWEYPDSWSTPHSYFSLKF  270

Query  254  ELRYR  258
             +R +
Sbjct  271  FVRIQ  275


> sp|P48356|LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 
GN=Lepr PE=1 SV=1
Length=1162

 Score = 41.6 bits (96),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 82/200 (41%), Gaps = 10/200 (5%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAED------FQEPCQYSQES  171
             +SC     L+ + C W P +  SL    V L    ++    D        EP     + 
Sbjct  431  NISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQR  490

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              F   +  P    S Y + + +  S+GS  S         +++P PP+N+    +  N 
Sbjct  491  DGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVK-AEITVNT  549

Query  232  RWLSVTWQDP-HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
              L V+W+ P    N+  +++R+ L  +  + KT   +  K      ++ D  +   +VV
Sbjct  550  GLLKVSWEKPVFPENNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVSDLCA--VYVV  607

Query  291  QLRAQEEFGQGEWSEWSPEA  310
            Q+R +   G G WS WS  A
Sbjct  608  QVRCRRLDGLGYWSNWSSPA  627


 Score = 32.7 bits (73),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 67/159 (42%), Gaps = 8/159 (5%)

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQ  215
            P +D  +  Q +   +   C + VP    ++ ++     +S G  F S   + Q   +++
Sbjct  176  PLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PDPP  + +         L ++W    S   + + L+++++Y  E S             
Sbjct  236  PDPPLGLHMEVTDDGN--LKISWD---SQTMAPFPLQYQVKY-LENSTIVREAAEIVSAT  289

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW-SPEAMGT  313
              ++     G  + VQ+R++   G G WS+W SP+   T
Sbjct  290  SLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTT  328


> sp|F1NY98|DSCAM_CHICK Down syndrome cell adhesion molecule homolog 
OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
Length=2034

 Score = 41.6 bits (96),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 117/304 (38%), Gaps = 50/304 (16%)

Query  57    TVHWVLRKPAAGSHPSRWAGMGRR-------LLLRSVQLHDSGNYSCYRA---GRPAGTV  106
             TV W+  K + G+ PS     GRR        ++R+V+  DSG YSC  +   G     +
Sbjct  1342  TVKWM--KDSNGT-PSLVMIDGRRSIFSNGSFVIRTVKAEDSGYYSCVASNNWGSDEIIL  1398

Query  107   HLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ----  162
             +L V VPP++P+L+   K+  S++   W P      + +  +L  ++    +E +     
Sbjct  1399  NLQVQVPPDQPRLTV-SKTTSSSITLSWIPGDNGGSSIRGYIL--QYSEDNSEQWGSFPI  1455

Query  163   EPCQYSQESQKFSC------QLAVPEGDSSFYIVSMCVASSVGS--KFSKTQTFQGCGIL  214
              P + S   +   C       L    G     I  +  A ++G   +FSK Q        
Sbjct  1456  SPSERSYRLETLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELF-----  1510

Query  215   QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ  274
                  A+I  T V  N     + W D     +S     F L YR   +  +TT     L 
Sbjct  1511  -----ASINTTRVRLN----LIGWNDGGCPITS-----FTLEYRPFGTTVWTTAQRTSLS  1556

Query  275   HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
                +++D      + +Q+R     G    +E   +     +  S  PP    V    + L
Sbjct  1557  KSYILYDLQEATWYELQMRVCNSAG---CAEKQAKFATLNYDGSTIPPLIKSVVQSEEGL  1613

Query  335   TTNK  338
              TN+
Sbjct  1614  ATNE  1617


> sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo 
sapiens OX=9606 GN=DSCAM PE=1 SV=2
Length=2012

 Score = 41.2 bits (95),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 62/273 (23%), Positives = 103/273 (38%), Gaps = 40/273 (15%)

Query  81    LLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
              ++R+V+  DSG YSC      G     ++L V VPP++P+L+   K+  S++   W P 
Sbjct  1344  FIIRTVKAEDSGYYSCIANNNWGSDEIILNLQVQVPPDQPRLTV-SKTTSSSITLSWLPG  1402

Query  138   STPSLTTKAVLLVRKFQNSPAEDFQ----EPCQYSQESQKFSC------QLAVPEGDSSF  187
                  + +  +L  ++    +E +      P + S   +   C       L    G    
Sbjct  1403  DNGGSSIRGYIL--QYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPG  1460

Query  188   YIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              I  +  A ++G   +FSK Q             A+I  T V  N     + W D     
Sbjct  1461  RISEIIEAKTLGKEPQFSKEQELF----------ASINTTRVRLN----LIGWNDGGCPI  1506

Query  246   SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             +S     F L YR   +  +TT     L    +++D      + +Q+R     G    +E
Sbjct  1507  TS-----FTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVCNSAG---CAE  1558

Query  306   WSPEAMGTPWTESRSPPAENEVSTPMQALTTNK  338
                      +  S  PP    V    + LTTN+
Sbjct  1559  KQANFATLNYDGSTIPPLIKSVVQNEEGLTTNE  1591


> sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog 
OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1
Length=2013

 Score = 40.8 bits (94),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 62/273 (23%), Positives = 103/273 (38%), Gaps = 40/273 (15%)

Query  81    LLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
              ++R+V+  DSG YSC      G     ++L V VPP++P+L+   K+  S++   W P 
Sbjct  1344  FIIRTVKAEDSGYYSCVANNNWGSDEIILNLQVQVPPDQPRLTV-SKTTSSSITLSWLPG  1402

Query  138   STPSLTTKAVLLVRKFQNSPAEDFQ----EPCQYSQESQKFSC------QLAVPEGDSSF  187
                  + +  +L  ++    +E +      P + S   +   C       L    G    
Sbjct  1403  DNGGSSIRGYIL--QYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPG  1460

Query  188   YIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              I  +  A ++G   +FSK Q             A+I  T V  N     + W D     
Sbjct  1461  RISEIIEAKTLGKEPQFSKEQELF----------ASINTTRVRLN----LIGWNDGGCPI  1506

Query  246   SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             +S     F L YR   +  +TT     L    +++D      + +Q+R     G    +E
Sbjct  1507  TS-----FTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVCNSAG---CAE  1558

Query  306   WSPEAMGTPWTESRSPPAENEVSTPMQALTTNK  338
                      +  S  PP    V    + LTTN+
Sbjct  1559  KQANFATLNYDGSTIPPLIKSVVQSEEGLTTNE  1591


> sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog 
OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1
Length=2013

 Score = 40.4 bits (93),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 62/273 (23%), Positives = 103/273 (38%), Gaps = 40/273 (15%)

Query  81    LLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
              ++R+V+  DSG YSC      G     ++L V VPP++P+L+   K+  S++   W P 
Sbjct  1344  FVIRTVKAEDSGYYSCVANNNWGSDEIILNLQVQVPPDQPRLTV-SKTTSSSITLSWLPG  1402

Query  138   STPSLTTKAVLLVRKFQNSPAEDFQ----EPCQYSQESQKFSC------QLAVPEGDSSF  187
                  + +  +L  ++    +E +      P + S   +   C       L    G    
Sbjct  1403  DNGGSSIRGYIL--QYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPG  1460

Query  188   YIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              I  +  A ++G   +FSK Q             A+I  T V  N     + W D     
Sbjct  1461  RISEIIEAKTLGKEPQFSKEQELF----------ASINTTRVRLN----LIGWNDGGCPI  1506

Query  246   SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             +S     F L YR   +  +TT     L    +++D      + +Q+R     G    +E
Sbjct  1507  TS-----FTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVCNSAG---CAE  1558

Query  306   WSPEAMGTPWTESRSPPAENEVSTPMQALTTNK  338
                      +  S  PP    V    + LTTN+
Sbjct  1559  KQANFATLNYDGSTIPPLIKSVVQSEEGLTTNE  1591


> sp|Q2KJF1|A1BG_BOVIN Alpha-1B-glycoprotein OS=Bos taurus OX=9913 
GN=A1BG PE=1 SV=1
Length=503

 Score = 39.3 bits (90),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 43/98 (44%), Gaps = 16/98 (16%)

Query  34   VLTSLPGDSVTLTCPGVEPEDNATVHWVL-RKPAAGSHPSRW---AGMGRRLLLRSVQLH  89
            +L+  PG  V L C        A V + L RK A G    R    AG   +  LR V   
Sbjct  320  ILSPTPGALVQLRCRA----PRAGVRFALVRKDAGGRQVQRVLSPAGPEAQFELRGVSAV  375

Query  90   DSGNYSC--------YRAGRPAGTVHLLVDVPPEEPQL  119
            DSGNYSC        +   +P+ T+ L VD P   PQL
Sbjct  376  DSGNYSCVYVDTSPPFAGSKPSATLELRVDGPLPRPQL  413


> sp|Q62959|LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=10116 
GN=Lepr PE=1 SV=1
Length=1162

 Score = 37.7 bits (86),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 82/200 (41%), Gaps = 10/200 (5%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV--RKFQNSPAEDFQEPCQYSQ----ES  171
             +SC     L+ + C W P +  SL    V L   R+    P      P    +    ++
Sbjct  431  NISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDNPSIRPTSELKNCVLQT  490

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              F   +  P    S Y + + +  S+GS  S         +++P PP+N+    +  N 
Sbjct  491  DGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVK-AEITINT  549

Query  232  RWLSVTWQDP-HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
              L V+W+ P    N+  +++R+ L  +  + KT   +  K       + D  +   +VV
Sbjct  550  GLLKVSWEKPVFPENNLQFQIRYGLNGKEIQWKTHEVFDAKSKSASLPVSDLCA--VYVV  607

Query  291  QLRAQEEFGQGEWSEWSPEA  310
            Q+R +   G G WS WS  A
Sbjct  608  QVRCRRLDGLGYWSNWSSPA  627


 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 37/169 (22%), Positives = 72/169 (43%), Gaps = 11/169 (7%)

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQ  215
            P +D  +  Q +   ++  C + VP    ++ ++     +S G  F S   + Q   +++
Sbjct  176  PLKDSFQTVQCNCSVRECECHVPVPRAKVNYALLMYLEITSAGVSFQSPLMSLQPMLVVK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF--TTWMVKDL  273
            PDPP  + +         L ++W    S   + + L+++++Y  E S        +V D 
Sbjct  236  PDPPLGLRMEVTDDGN--LKISWD---SQTKAPFPLQYQVKY-LENSTIVREAAEIVSDT  289

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                ++     G  + VQ+R++   G G WS+WS   + T       PP
Sbjct  290  S--LLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSLPQLFTTQDVMYFPP  336


> sp|P12371|FCERA_RAT High affinity immunoglobulin epsilon receptor 
subunit alpha OS=Rattus norvegicus OX=10116 GN=Fcer1a PE=1 
SV=1
Length=245

 Score = 37.0 bits (84),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 7/92 (8%)

Query  9   LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
           LA +L + G  L   +     +    +  L GD VTL C G       +  W+     + 
Sbjct  11  LALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISN  70

Query  69  SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAG  100
              S W       ++ S  + DSG Y C + G
Sbjct  71  VKSSHW-------VIVSATIQDSGKYICQKQG  95


> sp|A2AJ76|HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 
PE=1 SV=1
Length=5100

 Score = 37.7 bits (86),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query  20    LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK-PAAGSHPSRWAGMG  78
             L P     Q    G L S  G+ VT+ CP V+      V W+    P   S  +     G
Sbjct  3342  LVPPTIKQQAGDTGTLVSRTGELVTMVCP-VQGSPPIHVSWLKDGLPLPLSQRTLLHSSG  3400

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVH----LLVDVPP  114
             R L +  VQL DSG ++C  A  PAG       LLV VPP
Sbjct  3401  RTLRISQVQLADSGVFTCV-AASPAGVADRNFTLLVLVPP  3439


 Score = 33.5 bits (75),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 38/83 (46%), Gaps = 9/83 (11%)

Query  38    LPGDSVTLTC--PGVEPEDNATVHWVL-RKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNY  94
             L   SVTL C   GV P D   V W   R+P +       +  GR L +  VQL D+G+Y
Sbjct  1932  LENASVTLECLASGVPPPD---VSWFKGRQPISTQRRVIVSADGRVLHIERVQLSDAGSY  1988

Query  95    SCYR---AGRPAGTVHLLVDVPP  114
              C     AG       L V+VPP
Sbjct  1989  RCVATNVAGSAGLKYGLRVNVPP  2011


> sp|P40223|CSF3R_MOUSE Granulocyte colony-stimulating factor receptor 
OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
Length=837

 Score = 37.4 bits (85),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 51/216 (24%), Positives = 86/216 (40%), Gaps = 34/216 (16%)

Query  113  PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            PP  P  LSC      +++VC+W P     L T  +L  + F++      +  CQY  ++
Sbjct  123  PPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFIL--KSFRS------RADCQYQGDT  174

Query  172  ------QKFSCQLAVPEGDSSFY---IVSMCVASSVGSKFSKTQTFQGCGILQPDPPA--  220
                  +K     ++P  +   Y    + +   + +GS  S         +++ +PP   
Sbjct  175  IPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQ  234

Query  221  --NITVTAVARNPRWLSVTWQDPHSWN-SSFYRLRFELRYR-----AERSKTFTTWMVKD  272
              +I    V+  P  L ++W+    W  S +     ELRY+     A  +  F     KD
Sbjct  235  ALDIGPDVVSHQPGCLWLSWK---PWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKD  291

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
                C +H A     + +Q+R       G WS WSP
Sbjct  292  QFELCGLHQA---PVYTLQMRCIRSSLPGFWSPWSP  324


> sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 
SV=1
Length=35213

 Score = 37.4 bits (85),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (43%), Gaps = 6/120 (5%)

Query  216    PDPPANITVTAVARNPRWLSVTWQDP-HSWNSSFYRLRFELRYRAE-RSKTFTTWMVKDL  273
              P PP N+T+T V R    +S+TW+ P +   +       ELR +   R  T  T   +DL
Sbjct  14980  PGPPLNVTITDVNR--FGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL  15037

Query  274    QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQA  333
                   + D   G  +  ++RAQ   G G+ S  +P        E  SPP     S   Q+
Sbjct  15038  S--ATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNASEQTQS  15095


> sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 
PE=2 SV=3
Length=5059

 Score = 37.4 bits (85),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 40/87 (46%), Gaps = 7/87 (8%)

Query  33    GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK-PAAGSHPSRWAGMGRRLLLRSVQLHDS  91
             G L S PG+ VT+ CP V       V W+    P   S  +   G G  L +  VQL D+
Sbjct  3329  GTLVSRPGELVTMVCP-VRGSPPIHVSWLKDGLPLPLSQRTLLHGSGHTLRISKVQLADA  3387

Query  92    GNYSCYRAGRPAGTVH----LLVDVPP  114
             G ++C  A  PAG       L V VPP
Sbjct  3388  GIFTCV-AASPAGVADRNFTLQVQVPP  3413


> sp|Q90610|NEO1_CHICK Neogenin (Fragment) OS=Gallus gallus OX=9031 
PE=2 SV=1
Length=1443

 Score = 37.0 bits (84),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 46/104 (44%), Gaps = 3/104 (3%)

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCV  278
            P N+T+ A  RN + + + WQ P +   S     +++RYR    K+  T  V   Q   +
Sbjct  623  PQNLTLEA--RNSKSIMLHWQPPPAGTHSGQITGYKIRYRKVSRKSDVTESVGGTQLFQL  680

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSP  321
            I     G  +  ++ A    G G  ++W S E   +   ESR P
Sbjct  681  IEGLERGTEYNFRIAAMTVNGTGPATDWVSAETFESDLDESRVP  724


> sp|P59045|NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 
11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
Length=1033

 Score = 37.0 bits (84),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query  281  DAWSGL-RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD  339
            + W  +  +VV L A E   Q   S  + E +   W + ++P A+  +S P + L   +D
Sbjct  174  EMWQNMISYVVHLTAHE-INQMTNSSLA-ELIAKDWPDGQAPIAD-ILSDPKKLLFILED  230

Query  340  DDNILFRDSANATSLPVQDSSSVPLPTFLVA  370
             DNI F  + N ++L    +  VP+P  LV+
Sbjct  231  LDNIRFELNVNESALCSNSTQKVPIPVLLVS  261


> sp|P16382|IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il4r PE=1 SV=1
Length=810

 Score = 36.6 bits (83),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 6/106 (6%)

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY--RAERSKT  264
            +F   G ++P  P N+T+     +  WL +TW + +  N+  Y+    +    R +    
Sbjct  115  SFSPSGNVKPLAPDNLTLHTNVSD-EWL-LTWNNLYPSNNLLYKDLISMVNISREDNPAE  172

Query  265  FTTWMV--KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
            F  + V  K+ +    I+   SG+ +  ++R + +   G WSEWSP
Sbjct  173  FIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSP  218


> sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 
SV=4
Length=34350

 Score = 37.0 bits (84),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (44%), Gaps = 6/110 (5%)

Query  216    PDPPANITVTAVARNPRWLSVTWQDP-HSWNSSFYRLRFELRYRAE-RSKTFTTWMVKDL  273
              P PP N+T+T V R    +S+TW+ P +   +       ELR +   R  T  T   +DL
Sbjct  14118  PGPPLNVTITDVNR--FGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL  14175

Query  274    QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                   + D   G  +  ++RAQ   G G+ S  +P        E  SPP 
Sbjct  14176  S--ATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPV  14223


> sp|Q8NI17|IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL31RA PE=1 SV=1
Length=732

 Score = 36.6 bits (83),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 55/232 (24%), Positives = 92/232 (40%), Gaps = 41/232 (18%)

Query  109  LVDVPPEEPQLSC---FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF--------QNSP  157
            L  +P +   +SC   +RK    N+ C W P    S T   V     F         NS 
Sbjct  18   LAALPAKPENISCVYYYRK----NLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSS  73

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
              + +  C +      F  ++ +P+     Y + +   +  G   S    ++   I + +
Sbjct  74   TSENRASCSF------FLPRITIPDN----YTIEVEAENGDGVIKSHMTYWRLENIAKTE  123

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM----VKDL  273
            PP    V  V    R + + W  P     S   L++ LR+R   S   T+WM     K+ 
Sbjct  124  PPKIFRVKPVLGIKRMIQIEWIKPELAPVS-SDLKYTLRFRTVNS---TSWMEVNFAKNR  179

Query  274  QHHCVIHDAWSGLR----HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
            +     ++  +GL+    +V+ LR   +  +  WS+WS E MG   TE  +P
Sbjct  180  KDKNQTYNL-TGLQPFTEYVIALRCAVKESKF-WSDWSQEKMGM--TEEEAP  227


> sp|A5WAK1|TYSY_PSEP1 Thymidylate synthase OS=Pseudomonas putida 
(strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 
GN=thyA PE=3 SV=1
Length=277

 Score = 35.8 bits (81),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 47/116 (41%), Gaps = 9/116 (8%)

Query  253  FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE---  309
            F  +YR + SK F     K L    ++++    L     ++   E G   W+EW+ E   
Sbjct  30   FGRQYRHDLSKGFPLLTTKKLHFKSIVNELIWFLSGDTNIKWLNENGVKIWNEWATEEGD  89

Query  310  ---AMGTPWTE--SRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
                 G  WT   ++     N++   + AL TN +   ILF    N   LP +  S
Sbjct  90   LGPVYGKQWTAWPTKDGGTINQIDYVVNALKTNPNSRRILFH-GWNVEYLPDEKVS  144


> sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like 
protein Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 
PE=2 SV=3
Length=2074

 Score = 36.6 bits (83),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 64/257 (25%), Positives = 97/257 (38%), Gaps = 21/257 (8%)

Query  20    LAPRRCPAQEVARGVLTSLP-GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMG  78
             +   R PA+ ++ G     P   +VTL C  V           +     G H S+    G
Sbjct  1306  ITTNRIPARIISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSG  1365

Query  79    RRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
               L++ S+QL D GNYSC      G    T  L+V VPP  P L     +  S+++  W 
Sbjct  1366  D-LIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVLYVTSATS-SSILMHWK  1423

Query  136   PRSTPSLTTKAVLLVRKFQNSPAEDFQ-EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
                T +       L  +  N   ++ Q      S E +   C         S Y + +  
Sbjct  1424  CGFTGNAPITGYTLFYRRANGNTDEMQLSRHASSHELKGLMC--------GSTYQIHLSA  1475

Query  195   ASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRF  253
              + VG+  + T          P  PA+  +  +A N   L V     HSW ++    L F
Sbjct  1476  QNKVGTSPTSTILHVRTQGQSPGHPASTAL--LAPNSTSLLVRL---HSWPDNGCPLLYF  1530

Query  254   ELRYRAERSKTFTTWMV  270
              L+YRA        W++
Sbjct  1531  VLQYRAVTDDPDAEWVL  1547


> sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus 
OX=10090 GN=Ephb1 PE=1 SV=1
Length=984

 Score = 36.6 bits (83),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 47/114 (41%), Gaps = 17/114 (15%)

Query  206  QTFQGCGILQPDPPANITVTA---------------VARNPRWLSVTWQDPHSWNSSFYR  250
            Q   G     P PP +++V                 V+   R ++++W  P   N     
Sbjct  407  QAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGII--  464

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            L +E+RY  +    F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  465  LDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens 
OX=9606 GN=EPHB1 PE=1 SV=1
Length=984

 Score = 36.2 bits (82),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 47/114 (41%), Gaps = 17/114 (15%)

Query  206  QTFQGCGILQPDPPANITVTA---------------VARNPRWLSVTWQDPHSWNSSFYR  250
            Q   G     P PP +++V                 V+   R ++++W  P   N     
Sbjct  407  QAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGII--  464

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            L +E+RY  +    F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  465  LDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus 
OX=10116 GN=Ephb1 PE=1 SV=2
Length=984

 Score = 36.2 bits (82),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 47/114 (41%), Gaps = 17/114 (15%)

Query  206  QTFQGCGILQPDPPANITVTA---------------VARNPRWLSVTWQDPHSWNSSFYR  250
            Q   G     P PP +++V                 V+   R ++++W  P   N     
Sbjct  407  QAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGII--  464

Query  251  LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            L +E+RY  +    F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  465  LDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|P01681|KVX01_RAT Ig kappa chain V region S211 OS=Rattus norvegicus 
OX=10116 PE=1 SV=1
Length=109

 Score = 33.9 bits (76),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 24/94 (26%), Positives = 38/94 (40%), Gaps = 22/94 (23%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH-------------PSRWAGMGR--  79
            L + PG+SV+++C       +  + W   KP   +              PSR++G G   
Sbjct  11   LAASPGESVSISCKASNKSISNNLAWYZZKPGKANKLLISSGSTLQSGTPSRFSGSGSDT  70

Query  80   --RLLLRSVQLHDSGNYSCYRAGRP-----AGTV  106
               L +RS++  D   Y C     P     AGT+
Sbjct  71   DFTLTIRSLEFQDFAVYYCZZYNEPYYTFGAGTM  104


> sp|Q29JX6|IHOG_DROPS Interference hedgehog OS=Drosophila pseudoobscura 
pseudoobscura OX=46245 GN=iHog PE=3 SV=1
Length=903

 Score = 36.2 bits (82),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 7/118 (6%)

Query  2    LAVGCALLAALLAAPGAA-LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            + +  +++  +L+  G+   AP     Q  ++ V T   G ++ L CPGV      T  W
Sbjct  231  IEISSSMVLEVLSGRGSQNKAPHLLSGQPTSQAV-TIREGSTLLLLCPGV-GSPTPTAVW  288

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY--RAGRPA--GTVHLLVDVPP  114
                     H  R   +   L + +VQ HD+G Y CY     RP     +++ V+VPP
Sbjct  289  SSPDVVEAIHNKRTRVLNHGLEISNVQGHDTGTYICYLDNGVRPTLEHFINVTVEVPP  346


> sp|B4GKZ8|IHOG_DROPE Interference hedgehog OS=Drosophila persimilis 
OX=7234 GN=iHog PE=3 SV=1
Length=906

 Score = 35.8 bits (81),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 7/118 (6%)

Query  2    LAVGCALLAALLAAPGAA-LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            + +  +++  +L+  G+   AP     Q  ++ V T   G ++ L CPGV      T  W
Sbjct  231  IEISSSMVLEVLSGRGSQNKAPHLLSGQPTSQAV-TIREGSTLLLLCPGV-GSPTPTAVW  288

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY--RAGRPA--GTVHLLVDVPP  114
                     H  R   +   L + +VQ HD+G Y CY     RP     +++ V+VPP
Sbjct  289  SSPDVVEAIHNKRTRVLNHGLEISNVQGHDTGTYICYLDNGVRPTLEHFINVTVEVPP  346


> sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN 
PE=1 SV=3
Length=7968

 Score = 35.8 bits (81),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (45%), Gaps = 3/65 (5%)

Query  40    GDSVTLTCPGVEPEDNATVHWV---LRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
             GD   L C   + E  A V W+   +   A   +  R  G  R LL+  ++  D+G Y+C
Sbjct  4082  GDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEAKDTGEYAC  4141

Query  97    YRAGR  101
                G+
Sbjct  4142  VTGGQ  4146


 Score = 35.0 bits (79),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 37/83 (45%), Gaps = 6/83 (7%)

Query  35    LTSLPGDSVTLTCPGVEPEDNATVHWV---LRKPAAGSHPSRWAGMGRRLLLRSVQLHDS  91
             L +  G + TL C   EP   ATV W    L+  A G    R  G    L+L+ +Q  D+
Sbjct  3899  LQAEEGSTATLQCELSEP--TATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDT  3956

Query  92    GNYSCYRAGRPAGTVHLLVDVPP  114
             G Y+C   G  A +  L V   P
Sbjct  3957  GEYTCT-CGSQATSATLTVTAAP  3978


 Score = 33.9 bits (76),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query  28   QEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-GMGRRLLLRSV  86
            +++AR  L +  G S TL+C   + +   T +   +K ++ S     A G  RRL+++  
Sbjct  893  EQLARRKLQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVCMEATGCTRRLVVQQA  952

Query  87   QLHDSGNYSCYRAGRPAGTVHLLVDVP  113
               D+G YSC  AG    + HL V  P
Sbjct  953  GQADAGEYSC-EAGGQRLSFHLDVKEP  978


> sp|Q9HBE5|IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens 
OX=9606 GN=IL21R PE=1 SV=1
Length=538

 Score = 35.4 bits (80),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/131 (24%), Positives = 56/131 (43%), Gaps = 17/131 (13%)

Query  189  IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
            I S+ +    G+   +  +F     ++P PP N+TVT   +     +++W+  +  + +F
Sbjct  93   IFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQ----YNISWRSDYE-DPAF  147

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL---------RHVVQLRAQEEFG  299
            Y L+ +L+Y  +       W V   +    +      L          + +Q+RA    G
Sbjct  148  YMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPG  207

Query  300  ---QGEWSEWS  307
               QG WSEWS
Sbjct  208  SSYQGTWSEWS  218


> sp|Q0WYX8|MDGA1_CHICK MAM domain-containing glycosylphosphatidylinositol 
anchor protein 1 OS=Gallus gallus OX=9031 GN=MDGA1 
PE=1 SV=1
Length=949

 Score = 35.4 bits (80),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 80/213 (38%), Gaps = 56/213 (26%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY-  97
            PGD+VT+ C     +    V W     + G  P      G  L +  +++ DSG Y+C  
Sbjct  254  PGDNVTMQCSLTGGDPQPEVLW---SHSPGPLPPNSLVQGGNLTIWRIRVEDSGYYNCTA  310

Query  98   --RAGRPA-GTVHLLV------------DVPPE--------EPQLSCFRKS-PLSNVVCE  133
                G PA  TV+LLV            DV  E        + +LSC   + P   VV  
Sbjct  311  INNVGNPAKKTVNLLVRSMKNATFQITPDVIKESETIQLGQDLKLSCHVDAVPQEKVVYS  370

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
            W     P+  +  +L+ R   N P            E    +C L + +   S Y   +C
Sbjct  371  WYKNGKPARFSDRLLITR---NDP------------ELPPVTCSLEIIDLRFSDYGTYLC  415

Query  194  VASSVGSKFSKTQTFQGCGILQPDPPANITVTA  226
            VA           TFQG  I  PD    + +++
Sbjct  416  VA-----------TFQGAPI--PDLSVEVNISS  435


> sp|P85171|MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol 
anchor protein 1 OS=Rattus norvegicus OX=10116 GN=Mdga1 
PE=1 SV=1
Length=956

 Score = 35.0 bits (79),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 72/187 (39%), Gaps = 43/187 (23%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY-  97
            PG++VT+ C     +    +HW       G  P      G  L + SVQ  DSG Y+C  
Sbjct  254  PGENVTVQCLLTGGDPLPQLHW---SHGPGPLPLGALAQGGTLSIPSVQARDSGYYNCTA  310

Query  98   --RAGRPA-GTVHLLV--------DVPP------------EEPQLSCFRKS-PLSNVVCE  133
                G PA  TV+LLV         + P            ++ +LSC   + P   V  +
Sbjct  311  TNNVGNPAKKTVNLLVRSLKNATFQITPDMIKESENIQLGQDLKLSCHVDAVPQEKVNYQ  370

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
            W     P+ T+K +L+ R     PA                +  L + +   S Y   +C
Sbjct  371  WFKNGKPARTSKRLLVTRNDPELPA---------------VTSSLELIDLHFSDYGTYLC  415

Query  194  VASSVGS  200
            VAS  GS
Sbjct  416  VASFPGS  422


> sp|O02671|LEPR_PIG Leptin receptor OS=Sus scrofa OX=9823 GN=LEPR 
PE=2 SV=3
Length=1165

 Score = 35.0 bits (79),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 60/139 (43%), Gaps = 18/139 (13%)

Query  176  CQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWL  234
            C + V     ++ ++     +S G+ F S   + Q   +++PDPP  + +         L
Sbjct  196  CHVPVSAAKLNYTLLMYLKITSGGAVFHSPLMSVQPINVVKPDPPLGLHMEITDTGN--L  253

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM------VKDLQHHCVIHDAWSGLRH  288
             ++W  P         + F+L+Y+ + S+  TT M      V D     ++     G  +
Sbjct  254  KISWSSPT-------LVPFQLQYQVKYSENSTTNMREADEIVSDTS--LLVDSVLPGSSY  304

Query  289  VVQLRAQEEFGQGEWSEWS  307
             VQ+R +   G G WS+WS
Sbjct  305  EVQVRGKRLDGPGIWSDWS  323


> sp|Q4LFA9|SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 
GN=Sema3g PE=2 SV=1
Length=780

 Score = 35.0 bits (79),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 60/151 (40%), Gaps = 16/151 (11%)

Query  28   QEVARGVLTSLPG---DSVTLTCPGVEPEDNATVHWVLRKPAAGSHP-----SRWAGMGR  79
             + A G++T + G   +S  L C    P+  A V W L++P            R     +
Sbjct  581  NKAASGLMTRVFGTEHNSTFLECLPKSPQ--AAVRWFLQRPGDKGTDQVKTDERVVQTAQ  638

Query  80   RLLLRSVQLHDSGNYSC--YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR  137
             LL R +  HD+GNY+C     G     V   ++V       S F +         WG  
Sbjct  639  GLLFRRLSRHDAGNYTCTTLEHGFSQTVVRFALEVIAAVQLDSLFLRESRLEEPSAWGSL  698

Query  138  STPSLTT--KAVLLVRKFQNSPAEDFQEPCQ  166
            ++ S  T  K +L +  F N P  D  E C+
Sbjct  699  ASASPKTWYKDILQLTGFANLPRVD--EYCE  727


> sp|P27645|FCGR3_RAT Low affinity immunoglobulin gamma Fc region 
receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 
SV=1
Length=267

 Score = 34.3 bits (77),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 40/155 (26%), Positives = 59/155 (38%), Gaps = 25/155 (16%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY  97
            L  D+VTLTC G     N++  W        +  S W  +      ++  ++DSG Y C 
Sbjct  53   LKEDTVTLTCEGTHNPGNSSTQWF------HNQSSTWGQVQASYTFKAT-VNDSGEYRCR  105

Query  98   RAGRPAGT-VHLLVD---VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
             A       VHL V    +  + PQL  F +     + C        S   K +  V  F
Sbjct  106  MAHTSLSDPVHLEVISDWLLLQTPQL-VFEEGETITLRCH-------SWKNKQLTKVLLF  157

Query  154  QNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFY  188
            QN       +P +Y  +S  FS   A      ++Y
Sbjct  158  QNG------KPVRYYYQSSNFSIPKANHSHSGNYY  186


> sp|Q0PMG2|MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol 
anchor protein 1 OS=Mus musculus OX=10090 GN=Mdga1 
PE=2 SV=3
Length=956

 Score = 35.0 bits (79),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 59/145 (41%), Gaps = 28/145 (19%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY-  97
            PG++VT+ C     +    +HW       G  P      G  L + SVQ  DSG Y+C  
Sbjct  254  PGENVTVQCLLTGGDPLPQLHW---SHGPGPLPLGALAQGGTLSIPSVQARDSGYYNCTA  310

Query  98   --RAGRPA-GTVHLLV--------DVPP------------EEPQLSCFRKS-PLSNVVCE  133
                G PA  TV+LLV         + P            ++ +LSC   + P   V  +
Sbjct  311  TNNVGNPAKKTVNLLVRSLKNATFQITPDMIKESENIQLGQDLKLSCHVDAVPQEKVNYQ  370

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPA  158
            W     P+ T+K +L+ R     PA
Sbjct  371  WFKNGKPARTSKRLLVTRNDPELPA  395


> sp|P0C673|IGS11_MOUSE Immunoglobulin superfamily member 11 OS=Mus 
musculus OX=10090 GN=Igsf11 PE=1 SV=1
Length=428

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 21/44 (48%), Gaps = 6/44 (14%)

Query  81   LLLRSVQLHDSGNYSCY------RAGRPAGTVHLLVDVPPEEPQ  118
            + + + QL D+G Y C       R GR  G   L V VPP  PQ
Sbjct  105  IFINNTQLSDTGTYQCLVNNLPDRGGRNIGVTGLTVLVPPSAPQ  148


> sp|Q8BLK3|LSAMP_MOUSE Limbic system-associated membrane protein 
OS=Mus musculus OX=10090 GN=Lsamp PE=1 SV=1
Length=341

 Score = 34.3 bits (77),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (43%), Gaps = 19/126 (15%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-----------GMGRRLLL  83
            +T   GD+  L C  V  + N+ V W+ R     +   +W+            +   L +
Sbjct  41   ITVRQGDTAILRC--VVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRI  98

Query  84   RSVQLHDSGNYSCYRAGR---PAGTVHLLVDVPPEEPQLSC-FRKSPLSNV--VCEWGPR  137
            + V ++D G+Y+C    +       V+L+V VPP+   +S     +  SNV  VC    R
Sbjct  99   QKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGR  158

Query  138  STPSLT  143
              P +T
Sbjct  159  PEPVIT  164


> sp|Q8TDY8|IGDC4_HUMAN Immunoglobulin superfamily DCC subclass 
member 4 OS=Homo sapiens OX=9606 GN=IGDCC4 PE=1 SV=1
Length=1250

 Score = 34.7 bits (78),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 59/273 (22%), Positives = 110/273 (40%), Gaps = 20/273 (7%)

Query  76   GMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQL-SCFRKSPLSN--  129
            G G  L++  + L D+G Y C     AG       L V V    P   +    +PLS+  
Sbjct  385  GGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASLAVVVREGLPSAPTRVTATPLSSSA  444

Query  130  VVCEWGPRSTPSLTTKAVL-LVRKFQNSPAEDFQEPCQYSQESQKFSCQL--AVPEGDSS  186
            V+  W     P + ++ ++     +Q +   D  E  Q++  +     Q+    P  D  
Sbjct  445  VLVAW---ERPEMHSEQIIGFSLHYQKARGMDNVE-YQFAVNNDTTELQVRDLEPNTDYE  500

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
            FY+V+    S +G+  S+T T      L   P A   ++  + NP  + V W       S
Sbjct  501  FYVVAY---SQLGA--SRTSTPALVHTLDDVPSAAPQLSLSSPNPSDIRVAWLPLPPSLS  555

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
            +   +++++ Y   +     +  V+  +   +++       + V++ A    G G  S+W
Sbjct  556  NGQVVKYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVRISAGTAAGFGAPSQW  615

Query  307  SPEAMGTPWTESRSP--PAENEVSTPMQALTTN  337
                  +   +S  P  PAE +V   M++L  +
Sbjct  616  MHHRTPSMHNQSHVPFAPAELKVQAKMESLVVS  648


> sp|P11044|TYSY2_BACSU Thymidylate synthase 2 OS=Bacillus subtilis 
(strain 168) OX=224308 GN=thyA2 PE=1 SV=1
Length=264

 Score = 33.9 bits (76),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 59/139 (42%), Gaps = 22/139 (16%)

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
            Y++RF LR      + F     K L    + H+    L+    +R  +E G   W+EW+ 
Sbjct  32   YQMRFNLR------EGFPMLTTKKLHFKSIAHELLWFLKGDTNVRYLQENGVRIWNEWAD  85

Query  309  E------AMGTPWTESRSPPAE--NEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            E        G+ W   R    E  +++S  ++ + TN +   ++     +A ++   D  
Sbjct  86   ENGELGPVYGSQWRSWRGADGETIDQISRLIEDIKTNPNSRRLI----VSAWNVGEIDKM  141

Query  361  SVP----LPTFLVAGGSLA  375
            ++P    L  F V+ G L+
Sbjct  142  ALPPCHCLFQFYVSDGKLS  160


> sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 
GN=Neo1 PE=1 SV=1
Length=1377

 Score = 34.3 bits (77),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 46/105 (44%), Gaps = 4/105 (4%)

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHC  277
            P N+++    RN + + + WQ P S   +     +++RYR A R    T  +V   Q   
Sbjct  606  PQNLSLEV--RNSKSIVIHWQPPSSATQNGQITGYKIRYRKASRKSDVTETVVTGTQLSQ  663

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSP  321
            +I     G  +  ++ A    G G  ++W S E   +   ESR P
Sbjct  664  LIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDESRVP  708


> sp|Q62813|LSAMP_RAT Limbic system-associated membrane protein 
OS=Rattus norvegicus OX=10116 GN=Lsamp PE=1 SV=1
Length=338

 Score = 33.9 bits (76),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (43%), Gaps = 19/126 (15%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-----------GMGRRLLL  83
            +T   GD+  L C  V  + N+ V W+ R     +   +W+            +   L +
Sbjct  41   ITVRQGDTAILRC--VVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRI  98

Query  84   RSVQLHDSGNYSCYRAGR---PAGTVHLLVDVPPEEPQLSC-FRKSPLSNV--VCEWGPR  137
            + V ++D G+Y+C    +       V+L+V VPP+   +S     +  SNV  VC    R
Sbjct  99   QKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGR  158

Query  138  STPSLT  143
              P +T
Sbjct  159  PEPVIT  164


> sp|B4KPU0|PTK7_DROMO Tyrosine-protein kinase-like otk OS=Drosophila 
mojavensis OX=7230 GN=otk PE=3 SV=1
Length=1045

 Score = 34.3 bits (77),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY  97
            +  D+   +C    P  +    W+      G + SR   +G  L + SVQ  D+G+Y C 
Sbjct  40   VENDAADFSCEATGPSGDLHYEWLHNGQQIG-YDSRVLQIGSNLRIESVQREDAGDYVCI  98

Query  98   RAGRPAG  104
             A   +G
Sbjct  99   AASAASG  105


> sp|Q96RL6|SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo 
sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
Length=698

 Score = 33.9 bits (76),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (48%), Gaps = 7/80 (9%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY-  97
            G  + L C   + +  AT+ WVL+ +  + SHP  W      L LR V+  DSG Y+C  
Sbjct  280  GQFLRLLC-AADSQPPATLSWVLQDRVLSSSHP--WGPRTLGLELRGVRAGDSGRYTCRA  336

Query  98   --RAGRPAGTVHLLVDVPPE  115
              R G     + L V  PPE
Sbjct  337  ENRLGSQQQALDLSVQYPPE  356


> sp|Q13449|LSAMP_HUMAN Limbic system-associated membrane protein 
OS=Homo sapiens OX=9606 GN=LSAMP PE=1 SV=2
Length=338

 Score = 33.5 bits (75),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (43%), Gaps = 19/126 (15%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-----------GMGRRLLL  83
            +T   GD+  L C  V  + N+ V W+ R     +   +W+            +   L +
Sbjct  41   ITVRQGDTAILRC--VVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRI  98

Query  84   RSVQLHDSGNYSCYRAGR---PAGTVHLLVDVPPEEPQLSC-FRKSPLSNV--VCEWGPR  137
            + V ++D G+Y+C    +       V+L+V VPP+   +S     +  SNV  VC    R
Sbjct  99   QKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGR  158

Query  138  STPSLT  143
              P +T
Sbjct  159  PEPVIT  164


> sp|P97798|NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 
PE=1 SV=1
Length=1493

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 46/105 (44%), Gaps = 4/105 (4%)

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHC  277
            P N+++    RN + + + WQ P S   +     +++RYR A R    T  +V   Q   
Sbjct  668  PQNLSLEV--RNSKSIVIHWQPPSSTTQNGQITGYKIRYRKASRKSDVTETLVTGTQLSQ  725

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSP  321
            +I     G  +  ++ A    G G  ++W S E   +   E+R P
Sbjct  726  LIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDETRVP  770


> sp|Q9EQS9|IGDC4_MOUSE Immunoglobulin superfamily DCC subclass 
member 4 OS=Mus musculus OX=10090 GN=Igdcc4 PE=2 SV=1
Length=1252

 Score = 33.9 bits (76),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 62/273 (23%), Positives = 108/273 (40%), Gaps = 20/273 (7%)

Query  76   GMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQL-SCFRKSPL--SN  129
            G G  L++  + L D+G Y C     AG       L V V    P   +    +PL  S+
Sbjct  384  GGGGSLVITQIGLQDAGYYQCVAENSAGTACAAAPLAVVVREGLPSAPTRVTATPLSSSS  443

Query  130  VVCEWGPRSTPSLTTKAVL-LVRKFQNSPAEDFQEPCQYSQESQKFSCQL--AVPEGDSS  186
            V+  W     P L ++ ++     +Q +   D  E  Q++  +     Q+    P  D  
Sbjct  444  VLVAW---ERPELHSEQIIGFSLHYQKARGVDNVE-YQFAVNNDTTELQVRDLEPNTDYE  499

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
            FY+V+    S +G+  S+T +      L   P A   +T  + NP  + V W    S  S
Sbjct  500  FYVVAY---SQLGA--SRTSSPALVHTLDDVPSAAPQLTLSSPNPSDIRVAWLPLPSSLS  554

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
            +   L++++ Y   +     +  V   +    ++       + V++ A    G G  S+W
Sbjct  555  NGQVLKYKIEYGLGKEDQVFSTEVPGNETQLTLNSLQPNKVYRVRISAGTGAGYGVPSQW  614

Query  307  SPEAMGTPWTESRSP--PAENEVSTPMQALTTN  337
                      +S  P  PAE +V   M++L  +
Sbjct  615  MQHRTPGVHNQSHVPFAPAELKVRAKMESLVVS  647


> sp|H0VDZ8|FCGR4_CAVPO Low affinity immunoglobulin gamma Fc region 
receptor IV OS=Cavia porcellus OX=10141 GN=Fcgr4 PE=3 SV=2
Length=254

 Score = 33.1 bits (74),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 38/159 (24%), Positives = 63/159 (40%), Gaps = 11/159 (7%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY  97
            L  D+VTLTC G  P +N    W       G+H           L+  +++ +SG Y C 
Sbjct  38   LTDDNVTLTCQGAYPPENNNTRWF----HNGTHIV--GSQAPSYLISGIKVENSGKYQCQ  91

Query  98   RAGRP-AGTVHLLVDVPPEEPQLS--CFRKSPLSNVVCE-WGPRSTPSLTTKAVLLVRKF  153
                P + +V L V       Q S   F+K     + C  W  +    +T       +KF
Sbjct  92   TDLSPLSDSVQLQVHADWLVLQTSKWVFQKGESIRLRCHSWKNKRLYKVTYLQNGKPKKF  151

Query  154  QNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
             ++ +E F  P      +  + C+  +   + S  IV++
Sbjct  152  FHNNSE-FHIPEATVNHTGSYYCRGLIGHNNKSSGIVAI  189


> sp|Q86VR7|VS10L_HUMAN V-set and immunoglobulin domain-containing 
protein 10-like OS=Homo sapiens OX=9606 GN=VSIG10L PE=2 
SV=2
Length=867

 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 40/88 (45%), Gaps = 12/88 (14%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA  99
            G +VTL C        A + W L  PA  + P+     G RLLL +V    +G Y+C  A
Sbjct  421  GSNVTLRCAAAS-RPPADITWSLADPAEAAVPA-----GSRLLLPAVGPGHAGTYACLAA  474

Query  100  G-----RPAGTVHLLV-DVPPEEPQLSC  121
                  R    ++L V D+PP  PQ S 
Sbjct  475  NPRTGRRRRSLLNLTVADLPPGAPQCSV  502


> sp|P16882|GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=10090 
GN=Ghr PE=1 SV=1
Length=650

 Score = 33.5 bits (75),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 44/214 (21%), Positives = 89/214 (42%), Gaps = 33/214 (15%)

Query  116  EPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
            +P+ +  R   L    C W     P L T  ++ L    + S  +  +   +++QE ++ 
Sbjct  50   KPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKE-  108

Query  175  SCQLAVPEGDSSFYIVS--------MCVASSVGSKFSKTQTFQGCGILQPDPPA------  220
             C   V  G +S Y  S         C+  +        + F    I+QPDPP       
Sbjct  109  -CPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTL  167

Query  221  -NITVTAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTT----WMVKDL  273
             NI++T +  +   + V+WQ P + +    +  L +E++Y+      +      W+    
Sbjct  168  LNISLTGIRGD---IQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLT---  221

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
              +C ++       H V++R+++   + ++SE+S
Sbjct  222  --YCPVYSLRMDKEHEVRVRSRQRSFE-KYSEFS  252


> sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus OX=10090 GN=Obscn 
PE=1 SV=3
Length=8886

 Score = 33.5 bits (75),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query  28    QEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-GMGRRLLLRSV  86
             ++ AR  + +  G+S TL+C   + +   T     +K ++ S     A G  RRL+++  
Sbjct  1234  EQQARSEVKAEAGNSATLSCEVAQAQTEVTWFKDGKKLSSSSKVRMEASGCSRRLVVQQA  1293

Query  87    QLHDSGNYSCYRAGRPAGTVHLLVDVP  113
                D+G YSC   G+   + HL V  P
Sbjct  1294  GKADAGEYSCEAGGQKL-SFHLDVTEP  1319


> sp|O75015|FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region 
receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
Length=233

 Score = 32.7 bits (73),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 9/60 (15%)

Query  38  LPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
           L  DSVTL C G   PEDN+T  W   +    S  S +        + +  ++DSG Y C
Sbjct  38  LEKDSVTLKCQGAYSPEDNST-QWFHNESLISSQASSY-------FIDAATVNDSGEYRC  89


> sp|D3YXG0|HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 
PE=1 SV=1
Length=5634

 Score = 33.5 bits (75),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 37/78 (47%), Gaps = 6/78 (8%)

Query  42    SVTLTCPGVEPEDNATVHWVLR-KPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYSCY--  97
             +VTL CPG      A +HW    KP     P+   +  G+ L LR+ +  D G Y C   
Sbjct  1469  NVTLQCPGTGVPFPA-IHWFKDGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQCTVS  1527

Query  98    -RAGRPAGTVHLLVDVPP  114
               AG+ A  + L V VPP
Sbjct  1528  NAAGKQAKDIKLTVYVPP  1545


> sp|Q9JHX3|IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus 
OX=10090 GN=Il21r PE=2 SV=1
Length=529

 Score = 33.1 bits (74),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 69/146 (47%), Gaps = 18/146 (12%)

Query  174  FSCQLAVPEGDSS-FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR  232
            ++C + + +  S   +IV+  V    G+   +  +F     ++P PP N+TV    R   
Sbjct  79   YTCHMRLSQFLSDEVFIVN--VTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGR---  133

Query  233  WLSVTWQDPHSWNSSFY---RLRFELRYRAERS----KTFTTWMVKDLQHHCVIHDAW-S  284
               ++W   +   S++    +L++EL+YR  R     +  T  +  D ++  ++ + +  
Sbjct  134  -YDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHK  192

Query  285  GLRHVVQLRAQEEFG---QGEWSEWS  307
               + +Q+RA  + G   +G WSEWS
Sbjct  193  DSSYQLQVRAAPQPGTSFRGTWSEWS  218


> sp|P04943|KV6A9_MOUSE Ig kappa chain V-VI region NQ6-8.3.1 OS=Mus 
musculus OX=10090 PE=2 SV=1
Length=107

 Score = 31.2 bits (69),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 34/80 (43%), Gaps = 19/80 (24%)

Query  34  VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-------------AGSHPSRWAGMGR-  79
           ++++ PG  VT+TC        + +HW  +K               A   P+R++G G  
Sbjct  10  IMSASPGQKVTMTCSA--SSSVSYMHWYQQKSGTSPKRWIYDTSKLASGXPARFSGSGSA  67

Query  80  ---RLLLRSVQLHDSGNYSC  96
               L + S+Q  D+  Y C
Sbjct  68  TSYSLTITSMQAEDAATYYC  87


> sp|A0A0C4DH26|KVD41_HUMAN Probable non-functional immunoglobulin 
kappa variable 6D-41 OS=Homo sapiens OX=9606 GN=IGKV6D-41 
PE=5 SV=1
Length=115

 Score = 31.6 bits (70),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (43%), Gaps = 18/84 (21%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKP-------------AAGSHPSRWAGMGR--  79
            L+  PG+ VT+TC   E   N  ++W  +KP             +    PSR++G G   
Sbjct  31   LSVTPGEKVTITCQASEGIGN-YLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGT  89

Query  80   --RLLLRSVQLHDSGNYSCYRAGR  101
                 + S++  D+  Y C +  +
Sbjct  90   DFTFTISSLEAEDAATYYCQQGNK  113


> sp|A6UB24|TYSY_SINMW Thymidylate synthase OS=Sinorhizobium medicae 
(strain WSM419) OX=366394 GN=thyA PE=3 SV=1
Length=264

 Score = 32.7 bits (73),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 58/139 (42%), Gaps = 22/139 (16%)

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
            Y++RF+L      S+ F     K L    +IH+    L+    +   +E G   W EW+ 
Sbjct  32   YQMRFDL------SQGFPVLTTKKLHLRSIIHELLWFLKGDTNIAYLKEHGVRIWDEWAD  85

Query  309  E------AMGTPWTESRSPPAE--NEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            E        G  W    +P     ++++T ++ L TN +      R   +A +  + D  
Sbjct  86   ENGDLGPVYGYQWRSWPTPDGGHIDQIATLVEGLKTNPNSR----RHIVSAWNPALVDDM  141

Query  361  SVP----LPTFLVAGGSLA  375
            ++P    L  F VA G L+
Sbjct  142  ALPPCHCLFQFYVADGKLS  160


> sp|Q5VWK5|IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens 
OX=9606 GN=IL23R PE=1 SV=3
Length=629

 Score = 32.7 bits (73),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 44/203 (22%), Positives = 83/203 (41%), Gaps = 26/203 (13%)

Query  113  PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            PP+ P +++C       N+ C W       + TK V+ V+  +       +E  QY   S
Sbjct  124  PPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET------EEEQQYLTSS  177

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
                   ++  G    Y+V +  A+++G + SK        I+ P      +   ++R  
Sbjct  178  YINISTDSLQGGKK--YLVWVQAANALGMEESKQLQIHLDDIVIP------SAAVISRAE  229

Query  232  RWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS-----  284
               +   +    W+S  +  ++  E+RY+A  ++   TW VK+   +             
Sbjct  230  TINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQ---TWNVKEFDTNFTYVQQSEFYLEP  286

Query  285  GLRHVVQLRAQEEFGQGEWSEWS  307
             +++V Q+R QE  G+  W  WS
Sbjct  287  NIKYVFQVRCQET-GKRYWQPWS  308


> sp|O09127|EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus 
OX=10090 GN=Epha8 PE=1 SV=2
Length=1004

 Score = 33.1 bits (74),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/81 (25%), Positives = 37/81 (46%), Gaps = 2/81 (2%)

Query  234  LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
            +S+ WQ+P   N     L +E++Y  +  +  +   +K +     +     G R+V Q+R
Sbjct  455  VSLLWQEPEQPNGII--LEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVR  512

Query  294  AQEEFGQGEWSEWSPEAMGTP  314
            A+   G G +S+      G P
Sbjct  513  ARTSAGCGRFSQAMEVETGKP  533


> sp|P29322|EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens 
OX=9606 GN=EPHA8 PE=1 SV=2
Length=1005

 Score = 32.7 bits (73),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 20/81 (25%), Positives = 37/81 (46%), Gaps = 2/81 (2%)

Query  234  LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
            +S+ WQ+P   N     L +E++Y  +  +  +   +K +     +     G R+V Q+R
Sbjct  456  VSLLWQEPEQPNGII--LEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVR  513

Query  294  AQEEFGQGEWSEWSPEAMGTP  314
            A+   G G +S+      G P
Sbjct  514  ARTSAGCGRFSQAMEVETGKP  534


> sp|Q60ZN5|SDK_CAEBR Protein sidekick homolog OS=Caenorhabditis 
briggsae OX=6238 GN=rig-4 PE=3 SV=1
Length=2322

 Score = 32.7 bits (73),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query  215  QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            QP   A   V A AR+P  + V WQ P     S   L + +RYR     +  TW  K+L 
Sbjct  752  QPPSAAPRNVAASARSPHSVMVQWQQPKEEQDSGDFLGYVVRYRLAGYSSL-TWNEKNLT  810

Query  275  ----HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                 + ++ +  +   + +Q+ A  + G G +SE
Sbjct  811  TKDARNTLVDELITWREYEIQVAAYNKRGLGVFSE  845


> sp|Q6WRH9|IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus 
norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
Length=2597

 Score = 32.7 bits (73),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 43/94 (46%), Gaps = 9/94 (10%)

Query  26    PAQEVARGV--LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR-----WAGMG  78
             PA+ + R V  +T   G +V L C  VE     TV W+L      S  ++     W    
Sbjct  1718  PARILDRHVKEITVHFGSTVELKC-RVEGMPRPTVSWILANQTVVSETAKGSRKVWVTPD  1776

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV  112
               L++ ++ L+D G Y C  A  P+G   LLV +
Sbjct  1777  GTLIIYNLSLYDRGFYKCV-ASNPSGQDSLLVKI  1809


> sp|P22182|FGFR1_XENLA Fibroblast growth factor receptor 1 OS=Xenopus 
laevis OX=8355 GN=fgfr1 PE=1 SV=1
Length=812

 Score = 32.7 bits (73),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query  1    MLAVGCALLAAL-LAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            +L  G  L AAL +A P + L     P  +      ++ PGD +TL C     ED  +++
Sbjct  7    LLLWGVLLGAALSVARPPSTLPDEVAPKTKTEVEPYSAQPGDRITLQCR--LREDVQSIN  64

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV  112
            WV +     S  +R    G  + + +    D+G Y+C   G P+ T  +L  V
Sbjct  65   WV-KNGVQLSETNRTRITGEEIQISNAGPEDNGVYACVTNG-PSRTYTVLCSV  115


> sp|B3MKS0|IHOG_DROAN Interference hedgehog OS=Drosophila ananassae 
OX=7217 GN=iHog PE=3 SV=1
Length=880

 Score = 32.7 bits (73),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 2/97 (2%)

Query  21   APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRR  80
            AP   P Q  ++ V T++ G ++ L CPGV       V W         +  R   +   
Sbjct  250  APYLLPGQPGSQTV-TAIEGGTLLLLCPGVGSPPPTAV-WSSPDIVGAVNNKRTRVLAHA  307

Query  81   LLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEP  117
            L + +VQ+ DSG Y CY        +   + V  E+P
Sbjct  308  LEISNVQIGDSGTYICYLDNGVRPPLEHFIQVKVEQP  344



Lambda      K        H        a         alpha
   0.317    0.132    0.417    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 46399659452
Results from round 2


Query= sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo
sapiens OX=9606 GN=IL6R PE=1 SV=1

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=H...   628    0.0   
  sp|O18796|IL6RA_PIG Interleukin-6 receptor subunit alpha OS=Sus...   578    0.0   
  sp|P22273|IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rat...   536    0.0   
  sp|P22272|IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=M...   510    1e-176
  sp|Q5RF19|I11RA_PONAB Interleukin-11 receptor subunit alpha OS=...   367    4e-121
  sp|Q14626|I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=...   366    1e-120
  sp|Q64385|I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 O...   366    2e-120
  sp|P70225|I11RB_MOUSE Interleukin-11 receptor subunit alpha-2 O...   360    4e-118
  sp|Q99MF4|I11RA_RAT Interleukin-11 receptor subunit alpha OS=Ra...   348    1e-113
  sp|P46282|IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus...   326    2e-106
  sp|Q866G3|IL12B_BUBBU Interleukin-12 subunit beta OS=Bubalus bu...   325    4e-106
  sp|O02744|IL12B_FELCA Interleukin-12 subunit beta OS=Felis catu...   324    9e-106
  sp|Q2PE76|IL12B_BUBCA Interleukin-12 subunit beta OS=Bubalus ca...   324    2e-105
  sp|P68220|IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries...   322    8e-105
  sp|P68221|IL12B_CAPHI Interleukin-12 subunit beta OS=Capra hirc...   322    8e-105
  sp|Q9XSQ5|IL12B_HORSE Interleukin-12 subunit beta OS=Equus caba...   320    2e-104
  sp|Q28268|IL12B_CANLF Interleukin-12 subunit beta OS=Canis lupu...   320    3e-104
  sp|Q28234|IL12B_CEREL Interleukin-12 subunit beta OS=Cervus ela...   320    3e-104
  sp|P46658|IL12B_CERAT Interleukin-12 subunit beta OS=Cercocebus...   317    7e-103
  sp|Q28938|IL12B_PIG Interleukin-12 subunit beta OS=Sus scrofa O...   316    1e-102
  sp|P29460|IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapie...   314    6e-102
  sp|P48095|IL12B_MACMU Interleukin-12 subunit beta OS=Macaca mul...   312    4e-101
  sp|Q865Y3|IL12B_PAPAN Interleukin-12 subunit beta OS=Papio anub...   310    2e-100
  sp|Q865W9|IL12B_LAMGL Interleukin-12 subunit beta OS=Lama glama...   306    1e-98 
  sp|Q91ZK7|IL12B_SIGHI Interleukin-12 subunit beta OS=Sigmodon h...   301    1e-96 
  sp|Q924V5|IL12B_CAVPO Interleukin-12 subunit beta OS=Cavia porc...   295    3e-94 
  sp|Q8CJE6|IL12B_MESAU Interleukin-12 subunit beta OS=Mesocricet...   293    1e-93 
  sp|Q61729|IL12B_MARMO Interleukin-12 subunit beta OS=Marmota mo...   290    1e-92 
  sp|P51641|CNTFR_CHICK Ciliary neurotrophic factor receptor subu...   262    3e-81 
  sp|O88507|CNTFR_MOUSE Ciliary neurotrophic factor receptor subu...   256    1e-78 
  sp|Q71DR4|CNTFR_CANLF Ciliary neurotrophic factor receptor subu...   256    1e-78 
  sp|P26992|CNTFR_HUMAN Ciliary neurotrophic factor receptor subu...   254    4e-78 
  sp|Q08406|CNTFR_RAT Ciliary neurotrophic factor receptor subuni...   253    1e-77 
  sp|O75462|CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo s...   246    2e-74 
  sp|Q9JM58|CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus mu...   246    2e-74 
  sp|Q9BEG2|I12R2_BOVIN Interleukin-12 receptor subunit beta-2 OS...   247    5e-71 
  sp|Q91094|PRLR_MELGA Prolactin receptor OS=Meleagris gallopavo ...   241    4e-69 
  sp|Q04594|PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=903...   238    3e-68 
  sp|P14787|PRLR_RABIT Prolactin receptor OS=Oryctolagus cuniculu...   234    8e-68 
  sp|Q6JTA8|PRLR_PIG Prolactin receptor OS=Sus scrofa OX=9823 GN=...   232    4e-67 
  sp|Q90374|PRLR_COLLI Prolactin receptor OS=Columba livia OX=893...   233    4e-66 
  sp|Q99665|I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS...   232    7e-66 
  sp|O46561|PRLR_SHEEP Prolactin receptor OS=Ovis aries OX=9940 G...   227    8e-66 
  sp|Q28172|PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 G...   225    6e-65 
  sp|P05710|PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=1...   225    9e-65 
  sp|Q28235|PRLR_CEREL Prolactin receptor OS=Cervus elaphus OX=98...   224    2e-64 
  sp|Q8MJS1|I12R2_PIG Interleukin-12 receptor subunit beta-2 OS=S...   228    2e-64 
  sp|P16471|PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606...   219    2e-62 
  sp|Q08501|PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=1009...   217    8e-62 
  sp|P97378|I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS...   215    9e-60 
  sp|Q00560|IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mu...   206    1e-56 
  sp|P40189|IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Ho...   201    3e-55 
  sp|P40190|IL6RB_RAT Interleukin-6 receptor subunit beta OS=Ratt...   195    6e-53 
  sp|Q91513|PRLR_ORENI Prolactin receptor OS=Oreochromis niloticu...   190    1e-51 
  sp|Q14213|IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapie...   155    2e-42 
  sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like...   100    4e-21 
  sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like...  99.5    1e-20 
  sp|E1C8P7|DSCL1_CHICK Down syndrome cell adhesion molecule-like...  93.3    1e-18 

Sequences not found previously or not previously below threshold:

  sp|P43432|IL12B_MOUSE Interleukin-12 subunit beta OS=Mus muscul...   259    2e-80
  sp|Q8NI17|IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=...   114    6e-26
  sp|Q9TU69|GHR_CANLF Growth hormone receptor OS=Canis lupus fami...   113    1e-25
  sp|O35228|IL27B_MOUSE Interleukin-27 subunit beta OS=Mus muscul...   107    2e-25
  sp|P16310|GHR_RAT Growth hormone receptor OS=Rattus norvegicus ...   112    3e-25
  sp|P19941|GHR_RABIT Growth hormone receptor OS=Oryctolagus cuni...   110    2e-24
  sp|Q95JF2|GHR_AILME Growth hormone receptor OS=Ailuropoda melan...   110    2e-24
  sp|P19756|GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823...   109    3e-24
  sp|P16882|GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=...   109    4e-24
  sp|P48356|LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 G...   108    1e-23
  sp|Q90375|GHR_COLLI Growth hormone receptor OS=Columba livia OX...   107    1e-23
  sp|Q02092|GHR_CHICK Growth hormone receptor OS=Gallus gallus OX...   107    2e-23
  sp|Q62959|LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=1011...   106    4e-23
  sp|P40223|CSF3R_MOUSE Granulocyte colony-stimulating factor rec...   105    8e-23
  sp|Q95ML5|GHR_SAIBB Growth hormone receptor OS=Saimiri bolivien...   103    2e-22
  sp|Q8K5B1|IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=...   102    5e-22
  sp|P79108|GHR_BOSIN Growth hormone receptor OS=Bos indicus OX=9...   102    6e-22
  sp|O46600|GHR_BOVIN Growth hormone receptor OS=Bos taurus OX=99...   102    9e-22
  sp|Q9JI97|GHR_CAVPO Growth hormone receptor OS=Cavia porcellus ...   100    3e-21
  sp|Q5VWK5|IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens O...   100    3e-21
  sp|Q99062|CSF3R_HUMAN Granulocyte colony-stimulating factor rec...   100    5e-21
  sp|P10912|GHR_HUMAN Growth hormone receptor OS=Homo sapiens OX=...  99.5    6e-21
  sp|Q9XSZ1|GHR_PAPAN Growth hormone receptor OS=Papio anubis OX=...  98.7    1e-20
  sp|Q28575|GHR_SHEEP Growth hormone receptor OS=Ovis aries OX=99...  98.7    1e-20
  sp|O02671|LEPR_PIG Leptin receptor OS=Sus scrofa OX=9823 GN=LEP...  97.6    3e-20
  sp|P48357|LEPR_HUMAN Leptin receptor OS=Homo sapiens OX=9606 GN...  96.4    9e-20
  sp|P79194|GHR_MACMU Growth hormone receptor OS=Macaca mulatta O...  93.7    5e-19
  sp|Q9MYL0|LEPR_MACMU Leptin receptor OS=Macaca mulatta OX=9544 ...  92.6    2e-18
  sp|Q8K4B4|IL23R_MOUSE Interleukin-23 receptor OS=Mus musculus O...  91.4    3e-18
  sp|O70458|OSMR_MOUSE Oncostatin-M-specific receptor subunit bet...  90.6    7e-18
  sp|F1NY98|DSCAM_CHICK Down syndrome cell adhesion molecule homo...  86.0    2e-16
  sp|Q7ZW34|CNTN5_DANRE Contactin-5 OS=Danio rerio OX=7955 GN=cnt...  82.5    3e-15
  sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=H...  82.5    3e-15
  sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolo...  82.5    3e-15
  sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homo...  82.2    4e-15
  sp|P42702|LIFR_HUMAN Leukemia inhibitory factor receptor OS=Hom...  81.4    6e-15
  sp|Q65Z14|OSMR_RAT Oncostatin-M-specific receptor subunit beta ...  81.0    8e-15
  sp|Q95LF0|I13R2_CANLF Interleukin-13 receptor subunit alpha-2 O...  78.7    2e-14
  sp|Q5XNR9|LIFR_CANLF Leukemia inhibitory factor receptor OS=Can...  79.9    2e-14
  sp|P42703|LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus...  79.9    2e-14
  sp|O70535|LIFR_RAT Leukemia inhibitory factor receptor OS=Rattu...  76.8    2e-13
  sp|Q14627|I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 O...  74.5    3e-13
  sp|P34902|IL2RG_MOUSE Cytokine receptor common subunit gamma OS...  73.7    7e-13
  sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=...  73.3    3e-12
  sp|O15394|NCAM2_HUMAN Neural cell adhesion molecule 2 OS=Homo s...  72.5    3e-12
  sp|O09030|I13R1_MOUSE Interleukin-13 receptor subunit alpha-1 O...  71.0    7e-12
  sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like ...  71.8    7e-12
  sp|Q95118|IL2RG_BOVIN Cytokine receptor common subunit gamma OS...  70.6    7e-12
  sp|O35136|NCAM2_MOUSE Neural cell adhesion molecule 2 OS=Mus mu...  71.4    7e-12
  sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1...  71.8    8e-12
  sp|Q3UH53|SDK1_MOUSE Protein sidekick-1 OS=Mus musculus OX=1009...  71.8    8e-12
  sp|Q90W79|CNTN5_CHICK Contactin-5 OS=Gallus gallus OX=9031 GN=C...  71.0    1e-11
  sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegic...  71.0    1e-11
  sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens ...  70.6    1e-11
  sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus ...  70.6    1e-11
  sp|P78552|I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 O...  69.5    2e-11
  sp|Q2EY14|PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=pr...  70.2    2e-11
  sp|Q9EQS9|IGDC4_MOUSE Immunoglobulin superfamily DCC subclass m...  70.2    2e-11
  sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus OX=903...  69.8    3e-11
  sp|P30530|UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Hom...  69.5    3e-11
  sp|O00533|NCHL1_HUMAN Neural cell adhesion molecule L1-like pro...  69.5    3e-11
  sp|O97394|SDK_DROME Protein sidekick OS=Drosophila melanogaster...  69.8    3e-11
  sp|P40321|IL2RG_CANLF Cytokine receptor common subunit gamma OS...  68.3    3e-11
  sp|P31785|IL2RG_HUMAN Cytokine receptor common subunit gamma OS...  68.3    4e-11
  sp|Q9MYZ9|EPOR_PIG Erythropoietin receptor OS=Sus scrofa OX=982...  68.7    4e-11
  sp|P11627|L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus m...  69.1    5e-11
  sp|O09127|EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus ...  69.1    5e-11
  sp|Q967D7|TUTL_DROME Protein turtle OS=Drosophila melanogaster ...  69.1    6e-11
  sp|Q9R044|NPHN_RAT Nephrin OS=Rattus norvegicus OX=10116 GN=Nph...  68.7    7e-11
  sp|Q2KL21|EPOR_CANLF Erythropoietin receptor OS=Canis lupus fam...  67.9    7e-11
  sp|Q6WG24|IL4RA_HORSE Interleukin-4 receptor subunit alpha OS=E...  67.5    1e-10
  sp|P13596|NCAM1_RAT Neural cell adhesion molecule 1 OS=Rattus n...  67.5    1e-10
  sp|Q07303|EPOR_RAT Erythropoietin receptor OS=Rattus norvegicus...  66.8    2e-10
  sp|P70232|NCHL1_MOUSE Neural cell adhesion molecule L1-like pro...  67.1    2e-10
  sp|P40238|TPOR_HUMAN Thrombopoietin receptor OS=Homo sapiens OX...  66.4    2e-10
  sp|P31836|NCAM1_BOVIN Neural cell adhesion molecule 1 OS=Bos ta...  66.4    3e-10
  sp|P16871|IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=H...  65.6    3e-10
  sp|O60500|NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 P...  66.4    3e-10
  sp|Q8VHK6|I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=...  65.2    4e-10
  sp|P16170|NCA11_XENLA Neural cell adhesion molecule 1-A OS=Xeno...  66.0    4e-10
  sp|Q2VWP7|PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG...  66.0    5e-10
  sp|Q38IC7|IL7RA_MACFA Interleukin-7 receptor subunit alpha OS=M...  64.8    6e-10
  sp|P13590|NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus...  65.2    6e-10
  sp|P14753|EPOR_MOUSE Erythropoietin receptor OS=Mus musculus OX...  64.8    7e-10
  sp|Q2EY15|PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prt...  64.8    9e-10
  sp|Q9HCK4|ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens OX=9...  64.8    1e-09
  sp|Q90344|EPHB2_COTJA Ephrin type-B receptor 2 OS=Coturnix japo...  64.8    1e-09
  sp|O94779|CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CN...  64.4    1e-09
  sp|P55146|TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=R...  64.4    1e-09
  sp|P13591|NCAM1_HUMAN Neural cell adhesion molecule 1 OS=Homo s...  64.4    1e-09
  sp|P29322|EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens ...  64.1    1e-09
  sp|Q06418|TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS...  64.1    1e-09
  sp|Q15375|EPHA7_HUMAN Ephrin type-A receptor 7 OS=Homo sapiens ...  64.1    2e-09
  sp|P97686|NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus n...  64.1    2e-09
  sp|Q01344|IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=H...  63.3    2e-09
  sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=...  64.1    2e-09
  sp|Q08351|TPOR_MOUSE Thrombopoietin receptor OS=Mus musculus OX...  63.7    2e-09
  sp|P97528|CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 G...  63.7    2e-09
  sp|Q00993|UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus...  63.7    2e-09
  sp|Q7TPD3|ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=1...  63.7    2e-09
  sp|Q9QZS7|NPHN_MOUSE Nephrin OS=Mus musculus OX=10090 GN=Nphs1 ...  63.7    2e-09
  sp|P54759|EPHA7_RAT Ephrin type-A receptor 7 OS=Rattus norvegic...  63.3    3e-09
  sp|A5HJM1|IL7RA_CALJA Interleukin-7 receptor subunit alpha OS=C...  62.5    3e-09
  sp|P35331|NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus...  63.3    3e-09
  sp|P29318|EPHA3_CHICK Ephrin type-A receptor 3 OS=Gallus gallus...  62.9    4e-09
  sp|P13595|NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus mu...  62.9    4e-09
  sp|P28693|EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus...  62.9    4e-09
  sp|Q8TDY8|IGDC4_HUMAN Immunoglobulin superfamily DCC subclass m...  62.9    4e-09
  sp|O88786|I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 O...  61.7    4e-09
  sp|Q61772|EPHA7_MOUSE Ephrin type-A receptor 7 OS=Mus musculus ...  62.5    5e-09
  sp|Q810U3|NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=N...  62.9    5e-09
  sp|Q90610|NEO1_CHICK Neogenin (Fragment) OS=Gallus gallus OX=90...  62.9    5e-09
  sp|O42422|EPHA7_CHICK Ephrin type-A receptor 7 OS=Gallus gallus...  62.5    5e-09
  sp|Q810U4|NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus mu...  62.5    5e-09
  sp|P68500|CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=C...  62.1    6e-09
  sp|P97527|CNTN5_RAT Contactin-5 OS=Rattus norvegicus OX=10116 G...  62.1    6e-09
  sp|Q2EY13|PRTGB_DANRE Protogenin B (Fragment) OS=Danio rerio OX...  62.1    6e-09
  sp|Q69Z26|CNTN4_MOUSE Contactin-4 OS=Mus musculus OX=10090 GN=C...  62.1    6e-09
  sp|P97685|NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 G...  62.1    7e-09
  sp|Q2VWP9|PRTG_RAT Protogenin OS=Rattus norvegicus OX=10116 GN=...  61.7    9e-09
  sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=...  61.7    9e-09
  sp|Q8BYI9|TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr...  61.7    1e-08
  sp|Q92823|NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo s...  61.7    1e-08
  sp|Q62845|CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 G...  61.4    1e-08
  sp|P36335|NCA12_XENLA Neural cell adhesion molecule 1-B OS=Xeno...  61.4    1e-08
  sp|Q9N3X8|SDK_CAEEL Protein sidekick homolog OS=Caenorhabditis ...  61.4    1e-08
  sp|Q589G5|PRTG_CHICK Protogenin OS=Gallus gallus OX=9031 GN=PRT...  61.0    2e-08
  sp|P54757|EPHA5_RAT Ephrin type-A receptor 5 OS=Rattus norvegic...  60.6    2e-08
  sp|P54763|EPHB2_MOUSE Ephrin type-B receptor 2 OS=Mus musculus ...  60.6    2e-08
  sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatas...  61.0    2e-08
  sp|P29323|EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens ...  60.6    2e-08
  sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatas...  60.6    2e-08
  sp|Q99650|OSMR_HUMAN Oncostatin-M-specific receptor subunit bet...  60.6    2e-08
  sp|P16872|IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=M...  59.8    2e-08
  sp|H2A0L7|FND1_PINMG Fibronectin type III domain-containing pro...  60.2    2e-08
  sp|P54755|EPHA5_CHICK Ephrin type-A receptor 5 OS=Gallus gallus...  60.2    2e-08
  sp|Q8IWV2|CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CN...  60.2    2e-08
  sp|Q5VTT5|MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYO...  60.6    2e-08
  sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatas...  60.2    3e-08
  sp|Q92752|TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR ...  60.2    3e-08
  sp|Q60ZN5|SDK_CAEBR Protein sidekick homolog OS=Caenorhabditis ...  60.2    3e-08
  sp|P55144|TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS...  59.8    3e-08
  sp|Q92859|NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 P...  59.8    4e-08


> sp|P08887|IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL6R PE=1 SV=1
Length=468

 Score =  628 bits (1619),  Expect = 0.0, Method: Composition-based stats.
 Identities = 468/468 (100%), Positives = 468/468 (100%), Gaps = 0/468 (0%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
Sbjct  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
Sbjct  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
Sbjct  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
Sbjct  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
            PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
Sbjct  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
Sbjct  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
            SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
Sbjct  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420

Query  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
            TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Sbjct  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468


> sp|O18796|IL6RA_PIG Interleukin-6 receptor subunit alpha OS=Sus 
scrofa OX=9823 GN=IL6R PE=2 SV=2
Length=467

 Score =  578 bits (1489),  Expect = 0.0, Method: Composition-based stats.
 Identities = 369/468 (79%), Positives = 407/468 (87%), Gaps = 1/468 (0%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGCALL ALLAAPG ALAPR C   EVA+ VLTSLPG SVTLTCPG EP DNAT+HW
Sbjct  1    MLAVGCALLTALLAAPGMALAPRGCSKLEVAQDVLTSLPGASVTLTCPGGEPGDNATIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            VLR    GS   R AG+GRRLLL+SVQL DSGNYSCY+ G PAG+V LLVD PPEEPQLS
Sbjct  61   VLRNQVTGSPDGRPAGVGRRLLLKSVQLSDSGNYSCYQDGVPAGSVRLLVDAPPEEPQLS  120

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            CFRKSPLSNV CEW PRS PS TTKAVLLVRKFQNSP EDFQEPCQYS E+Q+F CQLAV
Sbjct  121  CFRKSPLSNVGCEWRPRSPPSPTTKAVLLVRKFQNSPVEDFQEPCQYSLEAQRFFCQLAV  180

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            PEGD+SF+IV++CVA+S GS+ S  QTF+G GILQPDPP NITV+AV RNPRWLSVTWQD
Sbjct  181  PEGDNSFHIVTLCVANSAGSQSSTPQTFEGYGILQPDPPVNITVSAVDRNPRWLSVTWQD  240

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
            P SWNS FYRL+FELRYRAERSKTFTTWMVK+LQHHC+IHDAWSG+RHVVQLRAQEEFG 
Sbjct  241  PPSWNSYFYRLQFELRYRAERSKTFTTWMVKELQHHCIIHDAWSGMRHVVQLRAQEEFGH  300

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            G WSEWS E  G PWTESRS PAE E+    QA TTN+DD++I  ++SANATSLPVQDS+
Sbjct  301  GLWSEWSQEVTGIPWTESRSSPAETELPLSTQAPTTNEDDEDISSKESANATSLPVQDSA  360

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
            SVPLPTFLVAGGSLAFGTLLCI I+LRFKKT +L+ALKEGKT+MHPPYSLGQLVPERP+ 
Sbjct  361  SVPLPTFLVAGGSLAFGTLLCIGIILRFKKTGQLQALKEGKTNMHPPYSLGQLVPERPKS  420

Query  421  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
            TPVLVPLISPPVSP+SLG DNTS ++RP+AR P+SPYD+SN DYFFPR
Sbjct  421  TPVLVPLISPPVSPNSLG-DNTSRNSRPEARGPQSPYDVSNRDYFFPR  467


> sp|P22273|IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rattus 
norvegicus OX=10116 GN=Il6r PE=2 SV=2
Length=462

 Score =  536 bits (1381),  Expect = 0.0, Method: Composition-based stats.
 Identities = 258/472 (55%), Positives = 320/472 (68%), Gaps = 14/472 (3%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            MLAVGC LL ALLAAP  AL    C A EVA G +TSLPG +VTL CPG E   NAT+HW
Sbjct  1    MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            V     +GS    W   G  L+LR+VQ++D+G+Y C+      GTV LLVDVPPEEP+LS
Sbjct  61   VY----SGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLS  116

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAE-DFQEPCQYSQESQKFSCQLA  179
            CFRK+PL N  CEW P STPS TTKAV+  +K   +  + DFQ PCQYSQ+ + FSC++ 
Sbjct  117  CFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVE  176

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
            + EGD  ++IVS+CVA+SVGS+ S    FQ   ++QPDPPAN+ V+A+   PRWL V+WQ
Sbjct  177  ILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQ  236

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
            DP SW+ S+Y L+FELRYR   SK FT W ++  QH CVIHDA  G++HVVQ+R +EEF 
Sbjct  237  DPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFD  296

Query  300  QGEWSEWSPEAMGTPW-TESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL--PV  356
             G+WS+WSPE  GTPW  E R+ PA      P Q    + D+    +  S  ATS+  PV
Sbjct  297  IGQWSKWSPEVTGTPWLAEPRTTPA-GIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPV  355

Query  357  QDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPE  416
            Q SS +PLPTFLVAGGSLAFG LLC+ I+LR KK WK +A KE KT+  PPY LG L   
Sbjct  356  QGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPL---  412

Query  417  RPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
              +PT +LVPL++P  S +S G+DNT SH+    RDP+ P D SN DY FPR
Sbjct  413  --KPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR  462


> sp|P22272|IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il6ra PE=1 SV=2
Length=460

 Score =  510 bits (1314),  Expect = 1e-176, Method: Composition-based stats.
 Identities = 249/473 (53%), Positives = 308/473 (65%), Gaps = 18/473 (4%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            ML VGC LL ALLAAP  AL    C A EVA G +TSLPG +VTL CPG E   N T+HW
Sbjct  1    MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHW  60

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS  120
            V     +GS    W   G  L+LR VQL D+G+Y C       GTV LLVDVPPEEP+LS
Sbjct  61   VY----SGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLS  116

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAE-DFQEPCQYSQESQKFSCQLA  179
            CFRK+PL N +CEW P STPS TTKAVL  +K   +  + DFQ PCQYSQ+ + FSCQ+ 
Sbjct  117  CFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVE  176

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
            + EGD  ++IVS+CVA+SVGSK S  + F    ++QPDPPAN+ V+A+   PRWL V+WQ
Sbjct  177  ILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQ  236

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
             P +W+ S+Y L+F+LRYR   SK FT  ++   Q+ CVIHDA  G++HVVQ+R +EE  
Sbjct  237  HPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELD  296

Query  300  QGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL--PVQ  357
             G+WSEWSPE  GTPW           +  P Q    +  +    +  S  ATS+  PVQ
Sbjct  297  LGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQ  356

Query  358  DSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSM--HPPYSLGQLVP  415
            +SSS+ LPTFLVAGGSLAFG LLC+ I+LR K+ WK  A KE KT+    PPYSLG L  
Sbjct  357  ESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPL--  414

Query  416  ERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR  468
               +PT +LVPL+    +P S GSDNT +H+    RD +SPYD SN DY FPR
Sbjct  415  ---KPTFLLVPLL----TPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR  460


> sp|Q5RF19|I11RA_PONAB Interleukin-11 receptor subunit alpha OS=Pongo 
abelii OX=9601 GN=IL11RA PE=2 SV=1
Length=422

 Score =  367 bits (942),  Expect = 4e-121, Method: Composition-based stats.
 Identities = 124/432 (29%), Positives = 174/432 (40%), Gaps = 28/432 (6%)

Query  2    LAVGCALLAALLAAPGAALAP--RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L+ +L A   AL      CP      GV    PG SV L CPGV   D   V 
Sbjct  1    MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-AGRPAGTVHLLVDVPPEEPQ  118
            W              +G+G  L+L      D G Y C    G   GTV L +  PP  P 
Sbjct  59   WFRDGEPKLLQ-GPDSGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPPARPV  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ-------EPCQYSQES  171
            +SC       N  C W P     L T+ +   RK     A+  +        PC      
Sbjct  118  VSCQAADY-ENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCP-QDPL  175

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
                C +   E   S Y +++   + +G   ++        IL+PDPP  + V +V   P
Sbjct  176  GAARCVVHGAEFW-SQYRINVTEVNPLG-ASTRLLDVSLQSILRPDPPQGLRVESVPGYP  233

Query  232  RWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
            R L  +W  P SW     + L+F L+YR  +   ++T  V+      VI DA +GL H V
Sbjct  234  RRLRASWTYPASWPRQPHFLLKFRLQYRPAQHPAWST--VEPAGLEEVITDAVAGLPHAV  291

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTE--SRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
            ++ A++    G WS WSPEA GTP T    +  PA  ++    Q     + D     R S
Sbjct  292  RVSARDFLDAGTWSTWSPEAWGTPSTGTVPKEIPAWGQLH--TQPEVEPQVDSPAPPRPS  349

Query  349  ANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPY  408
                   +    SV     LV+ G L+F  L+  A+ L     W LR  + GK     P 
Sbjct  350  LQPHPRLLDHRDSVEQVAVLVSLGILSFLGLVAGALALGL---W-LRLRRGGKDGSPKPG  405

Query  409  SLGQLVPERPRP  420
             L  ++P    P
Sbjct  406  FLASVIPVDRHP  417


> sp|Q14626|I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL11RA PE=1 SV=2
Length=422

 Score =  366 bits (938),  Expect = 1e-120, Method: Composition-based stats.
 Identities = 124/432 (29%), Positives = 174/432 (40%), Gaps = 28/432 (6%)

Query  2    LAVGCALLAALLAAPGAALAP--RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L+ +L A   AL      CP      GV    PG SV L CPGV   D   V 
Sbjct  1    MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGD--PVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-AGRPAGTVHLLVDVPPEEPQ  118
            W              +G+G  L+L      D G Y C    G   GTV L +  PP  P 
Sbjct  59   WFRDGEPKLLQ-GPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPV  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ-------EPCQYSQES  171
            +SC       N  C W P     L T+ +   RK     A+  +        PC      
Sbjct  118  VSCQAADY-ENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCP-QDPL  175

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
                C +   E   S Y +++   + +G   ++        IL+PDPP  + V +V   P
Sbjct  176  GAARCVVHGAEFW-SQYRINVTEVNPLG-ASTRLLDVSLQSILRPDPPQGLRVESVPGYP  233

Query  232  RWLSVTWQDPHSWN-SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
            R L  +W  P SW     + L+F L+YR  +   ++T  V+      VI DA +GL H V
Sbjct  234  RRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWST--VEPAGLEEVITDAVAGLPHAV  291

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTE--SRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
            ++ A++    G WS WSPEA GTP T    +  PA  ++    Q     + D     R S
Sbjct  292  RVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLH--TQPEVEPQVDSPAPPRPS  349

Query  349  ANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPY  408
                   +    SV     L + G L+F  L+  A+ L     W LR  + GK     P 
Sbjct  350  LQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGL---W-LRLRRGGKDGSPKPG  405

Query  409  SLGQLVPERPRP  420
             L  ++P   RP
Sbjct  406  FLASVIPVDRRP  417


> sp|Q64385|I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 
OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
Length=432

 Score =  366 bits (938),  Expect = 2e-120, Method: Composition-based stats.
 Identities = 124/435 (29%), Positives = 183/435 (42%), Gaps = 32/435 (7%)

Query  2    LAVGCALLAALLAAPGAALAPRR--CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L  +L A   AL      CP      GV    PG  V L CPGV       V 
Sbjct  1    MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSA--GTPVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-AGRPAGTVHLLVDVPPEEPQ  118
            W  R   +       +G+G RL+L  V   D G Y C    G   G V L +  PP  P+
Sbjct  59   W-FRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPE  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PCQYSQES  171
            +SC +     N  C W P     L T+ +   RK     AE  +E       PC      
Sbjct  118  VSC-QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCP-QDPL  175

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
            +   C +   E  S  Y +++   + +G+        +   IL+PDPP  + V +V   P
Sbjct  176  EASRCVVHGAEFWSE-YRINVTEVNPLGASTCL-LDVRLQSILRPDPPQGLRVESVPGYP  233

Query  232  RWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
            R L  +W  P SW     + L+F L+YR  +   ++T  V+ +    VI DA +GL H V
Sbjct  234  RRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWST--VEPIGLEEVITDAVAGLPHAV  291

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
            ++ A++    G WS WSPEA GTP T     P ++E+  P  +    +  + ++ ++ + 
Sbjct  292  RVSARDFLDAGTWSAWSPEAWGTPSTG----PLQDEI--PDWSQGHGQQLEAVVAQEDSP  345

Query  351  ATSLPVQDSSSVPL----PTFLVAG-GSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMH  405
            A + P       PL    P   VA   SL   + L +A+       W LR  + GK    
Sbjct  346  APARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLW-LRLRRSGKDGPQ  404

Query  406  PPYSLGQLVPERPRP  420
             P  L  ++P    P
Sbjct  405  KPGLLAPMIPVEKLP  419


> sp|P70225|I11RB_MOUSE Interleukin-11 receptor subunit alpha-2 
OS=Mus musculus OX=10090 GN=Il11ra2 PE=2 SV=4
Length=432

 Score =  360 bits (923),  Expect = 4e-118, Method: Composition-based stats.
 Identities = 121/435 (28%), Positives = 178/435 (41%), Gaps = 32/435 (7%)

Query  2    LAVGCALLAALLAAPGAALAPRR--CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++  C+ L  +L A   AL      CP      GV    PG  V L CPGV       V 
Sbjct  1    MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSA--GTPVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-AGRPAGTVHLLVDVPPEEPQ  118
            W  R   +       +G+G RL+L  V   D G Y C    G   G V L +  PP  P+
Sbjct  59   W-FRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPE  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PCQYSQES  171
            +SC +     N  C W P     L T+ +   RK     AE  +E       PC      
Sbjct  118  VSC-QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCP-QDPL  175

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
            +   C +   E  S  Y +++   + +G+        +   IL+PDPP  + V +V   P
Sbjct  176  EASRCVVHGAEFWSE-YRINVTEVNPLGASTCL-LDVRLQSILRPDPPQGLRVESVPGYP  233

Query  232  RWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
            R L  +W  P SW     + L+F L+YR  +   ++T  V+ +    VI D  +GL H V
Sbjct  234  RRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWST--VEPIGLEEVITDTVAGLPHAV  291

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
            ++ A++    G WS WSPEA GTP T         +   P  +    +  + ++ ++ + 
Sbjct  292  RVSARDFLDAGTWSAWSPEAWGTPST------GLLQDEIPDWSQGHGQQLEAVVAQEDSL  345

Query  351  ATSLPVQDSSSVPL----PTFLVAG-GSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMH  405
            A + P       PL    P   VA   SL   + L +A+       W LR  + GK    
Sbjct  346  APARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLW-LRLRRSGKEGPQ  404

Query  406  PPYSLGQLVPERPRP  420
             P  L  ++P    P
Sbjct  405  KPGLLAPMIPVEKLP  419


> sp|Q99MF4|I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus 
norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
Length=431

 Score =  348 bits (893),  Expect = 1e-113, Method: Composition-based stats.
 Identities = 117/431 (27%), Positives = 171/431 (40%), Gaps = 25/431 (6%)

Query  2    LAVGCALLAALLAAPGAALAPRR--CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVH  59
            ++   + L  +L A   AL      CP      GV    PG  V L CPGV       V 
Sbjct  1    MSSSRSGLTRVLVAVATALVSSSTPCPQAWGPPGVQYGQPGRPVMLCCPGVNA--GTPVS  58

Query  60   WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-AGRPAGTVHLLVDVPPEEPQ  118
            W  R   +       +G+G RL+L  V   D G Y C    G   G V L +  PP  P+
Sbjct  59   W-FRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPE  117

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE-------PCQYSQES  171
            +SC +     N  C W P     L T+ +   RK     AE  +E       PC      
Sbjct  118  VSC-QAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCP-QDPL  175

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
            +   C +   E  S  Y +++   + +G+        +   IL+PDPP  + V +V   P
Sbjct  176  EASRCVVHGAEFWSE-YRINVTEVNPLGASTCL-LDVRLQRILRPDPPQGLRVESVPGYP  233

Query  232  RWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
            R L  +W  P SW     + L+F L+YR  +   ++T  V+ +    +I DA +GL H V
Sbjct  234  RRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWST--VEPIGLEELITDAVAGLPHAV  291

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTES-RSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
            ++ A++    G WS WSPEA GTP T   R    +       +     ++D       S 
Sbjct  292  RVSARDFLDAGTWSAWSPEAWGTPSTGPLRDEVPDGSRGHEQKLEAAAQEDSPAPPSPSL  351

Query  350  NATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYS  409
                 P+     +     L    SL   + L +A+       W LR  + GK     P  
Sbjct  352  QPDPRPLDHRDPLEQVAVL---ASLGIFSFLGLAVGALALGLW-LRLRRSGKDGPQKPGF  407

Query  410  LGQLVPERPRP  420
            L  ++P    P
Sbjct  408  LAPMIPGDKLP  418


> sp|P46282|IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus 
OX=9913 GN=IL12B PE=2 SV=1
Length=327

 Score =  326 bits (835),  Expect = 2e-106, Method: Composition-based stats.
 Identities = 72/333 (22%), Positives = 131/333 (39%), Gaps = 56/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V        PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
                  L C  K    +  C W                G      +T  A LL  +  + 
Sbjct  123  PKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAALLSAEKVSL  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
                 +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++P
Sbjct  183  E---HREYNKYTVECQEGS---ACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKP  236

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +   
Sbjct  237  DPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSA  295

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                  DA       V+++A++ +    WSEW+
Sbjct  296  KVTCHKDAN------VRVQARDRYYSSFWSEWA  322


> sp|Q866G3|IL12B_BUBBU Interleukin-12 subunit beta OS=Bubalus 
bubalis OX=89462 GN=IL12B PE=2 SV=1
Length=327

 Score =  325 bits (833),  Expect = 4e-106, Method: Composition-based stats.
 Identities = 70/334 (21%), Positives = 132/334 (40%), Gaps = 58/334 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V        PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIVAIWELEKNVYIVELDWYPDAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP---------------  157
                  L C  K    +  C W      +++T     V+  + S                
Sbjct  123  PKAKSFLKCEAKDYSGHFTCWW----LTAISTDLKFSVKSSRGSADPRGVTCGAASLSAE  178

Query  158  --AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
              + D +E  +Y+ E Q+ S     P  + S  I  +  A       + T +F    I++
Sbjct  179  KVSVDHREYNKYTVECQEGS---TCPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +  
Sbjct  236  PDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTS  294

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                   DA       V+++A++ +    WSEW+
Sbjct  295  AKVTCHKDAN------VRVQARDRYYSSFWSEWA  322


> sp|O02744|IL12B_FELCA Interleukin-12 subunit beta OS=Felis catus 
OX=9685 GN=IL12B PE=2 SV=1
Length=329

 Score =  324 bits (831),  Expect = 9e-106, Method: Composition-based stats.
 Identities = 71/334 (21%), Positives = 130/334 (39%), Gaps = 54/334 (16%)

Query  8    LLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA  67
            L   LLA P  A+         V        PG+ V LTC   E +D   + W       
Sbjct  11   LSLVLLAPPLMAIWELEKNVYVVELDWHPDAPGEMVVLTCNTPEEDD---ITWT------  61

Query  68   GSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEP  117
                S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  E+ 
Sbjct  62   SDQSSEVLGSGKTLTIQVKEFADAGQYTCHKGGEVLSHSFLLIHKKEDGIWSTDILREQK  121

Query  118  Q------LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQN  155
            +      L C  K+      C W                G      +T  A  L  +   
Sbjct  122  ESKNKIFLKCEAKNYSGRFTCWWLTAISTDLKFTVKSSRGSSDPQEVTCGAATLSAEKVR  181

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                D++   +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++
Sbjct  182  VDNRDYK---KYTVECQEGS---ACPAAEESLPIEVVVDAIHKLKYENYTSSFFIRDIIK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + + ++     +  D 
Sbjct  236  PDPPKNLQLKPL-KNSRHVEVSWEYPDTWSTPHSYFSLTFGVQVQGKNNREKKDRLSVDK  294

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                V+    +     ++++A++ +    WS W+
Sbjct  295  TSAKVVCHKDAK----IRVQARDRYYSSSWSNWA  324


> sp|Q2PE76|IL12B_BUBCA Interleukin-12 subunit beta OS=Bubalus 
carabanensis OX=346063 GN=IL12B PE=2 SV=1
Length=327

 Score =  324 bits (829),  Expect = 2e-105, Method: Composition-based stats.
 Identities = 70/334 (21%), Positives = 132/334 (40%), Gaps = 58/334 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V        PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIVAIWELEKNVYIVELDWYPDAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP---------------  157
                  L C  K    +  C W      +++T     V+  + S                
Sbjct  123  PKAKSFLKCEAKDYSGHFTCWW----LTAISTDLKFSVKSSRGSSDPRGVTCGAASLSAE  178

Query  158  --AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
              + D +E  +Y+ E Q+ S     P  + S  I  +  A       + T +F    I++
Sbjct  179  KVSVDHREYNKYTVECQEGS---TCPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +  
Sbjct  236  PDPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTS  294

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                   DA       V+++A++ +    WSEW+
Sbjct  295  AKVTCHKDAN------VRVQARDRYYSSFWSEWA  322


> sp|P68220|IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries 
OX=9940 GN=IL12B PE=1 SV=1
Length=327

 Score =  322 bits (824),  Expect = 8e-105, Method: Composition-based stats.
 Identities = 69/334 (21%), Positives = 133/334 (40%), Gaps = 58/334 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V      + PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP---------------  157
                  L C  K    +  C W      +++T     V+  + S                
Sbjct  123  PKAKSFLKCEAKDYSGHFTCSW----LTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAE  178

Query  158  --AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
              + D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++
Sbjct  179  KVSMDHREYNKYTVECQEGS---ACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +  +  
Sbjct  236  PDPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTS  294

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                   DA       ++++A++ +    WSEW+
Sbjct  295  AKVTCHKDAN------IRVQARDRYYSSFWSEWA  322


> sp|P68221|IL12B_CAPHI Interleukin-12 subunit beta OS=Capra hircus 
OX=9925 GN=IL12B PE=2 SV=1
Length=327

 Score =  322 bits (824),  Expect = 8e-105, Method: Composition-based stats.
 Identities = 69/334 (21%), Positives = 133/334 (40%), Gaps = 58/334 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V      + PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP---------------  157
                  L C  K    +  C W      +++T     V+  + S                
Sbjct  123  PKAKSFLKCEAKDYSGHFTCSW----LTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAE  178

Query  158  --AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
              + D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++
Sbjct  179  KVSMDHREYNKYTVECQEGS---ACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIK  235

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +  +  
Sbjct  236  PDPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTS  294

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                   DA       ++++A++ +    WSEW+
Sbjct  295  AKVTCHKDAN------IRVQARDRYYSSFWSEWA  322


> sp|Q9XSQ5|IL12B_HORSE Interleukin-12 subunit beta OS=Equus caballus 
OX=9796 GN=IL12B PE=2 SV=1
Length=329

 Score =  320 bits (821),  Expect = 2e-104, Method: Composition-based stats.
 Identities = 72/333 (22%), Positives = 129/333 (39%), Gaps = 54/333 (16%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V        PG+ V LTC   E E    + W        
Sbjct  12   SLVLLASPLMAIWELEKDVYVVELDWYPDAPGEMVVLTCNTPEEEG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
            +  +   G G+ L ++  +  D+G Y+C++ G      HLL+          D+  ++ +
Sbjct  63   AQSNEVLGSGKTLTIQVKEFGDAGWYTCHKGGEVLSHSHLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
                  L C  K+      C W                G      +T  A  L  +  + 
Sbjct  123  SKNKTFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAATLSAERVSV  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T  F    I++P
Sbjct  183  ---DDREYKKYTVECQEGS---ACPAAEESLPIEIVVDAVHKLKYENYTSGFFIRDIIKP  236

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  K     +  D  
Sbjct  237  DPPKNLQLKPL-KNSRQVEVSWEYPETWSTPHSYFSLTFSIQVQGKNKKERKDRLFMDET  295

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               V           ++++A++ +    WSEW+
Sbjct  296  SATVTCHKDG----QIRVQARDRYYSSSWSEWA  324


> sp|Q28268|IL12B_CANLF Interleukin-12 subunit beta OS=Canis lupus 
familiaris OX=9615 GN=IL12B PE=2 SV=1
Length=329

 Score =  320 bits (821),  Expect = 3e-104, Method: Composition-based stats.
 Identities = 68/333 (20%), Positives = 131/333 (39%), Gaps = 54/333 (16%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+    +         V        PG+ V LTC   E +D   + W        
Sbjct  12   SLVLLASSLMTIWELEKDVYVVELDWHPDAPGEMVVLTCHTPEEDD---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
            +  S   G G+ L ++  +  D+G Y+C++ G+      LL+          D+  E+ +
Sbjct  63   AQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGKVLSRSLLLIHKKEDGIWSTDILKEQKE  122

Query  119  ------LSCFRKSPLSNVVCEWGP----------------RSTPSLTTKAVLLVRKFQNS  156
                  L C  K+      C W                       +T  AV L  +    
Sbjct  123  SKNKIFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSAERVRV  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               D++   +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++P
Sbjct  183  DNRDYK---KYTVECQEGS---ACPSAEESLPIEVVVDAIHKLKYENYTSSFFIRDIIKP  236

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + + ++     +  D  
Sbjct  237  DPPTNLQLKPL-KNSRHVEVSWEYPDTWSTPHSYFSLTFCVQAQGKNNREKKDRLCVDKT  295

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               V+    +     ++++A++ +    WS+W+
Sbjct  296  SAKVVCHKDAK----IRVQARDRYYSSSWSDWA  324


> sp|Q28234|IL12B_CEREL Interleukin-12 subunit beta OS=Cervus elaphus 
OX=9860 GN=IL12B PE=2 SV=1
Length=327

 Score =  320 bits (820),  Expect = 3e-104, Method: Composition-based stats.
 Identities = 69/333 (21%), Positives = 128/333 (38%), Gaps = 56/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LL +P  A+         V        PG++V L C   E +    + W        
Sbjct  12   SLVLLTSPIVAIWELEKNVYVVELDWYPDAPGETVVLRCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEPQ  118
               S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  ++ +
Sbjct  63   DQSSEVLGSGKTLTVQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
                  L C  K    +  C W                G      +T  A  L  +    
Sbjct  123  PKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAASLSTEKVIV  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               D +E  +Y+ E Q+ S   A P  + S  I  +  A       + T +F    I++P
Sbjct  183  ---DHREYKKYTVECQEGS---ACPAAEESLPIEVVVEAVHKLKYENYTSSFFIRDIIKP  236

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +    +M +   
Sbjct  237  DPPKNLQLRPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSA  295

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                  DA       ++++A++ +    WSEW+
Sbjct  296  KVTCHKDA------SIRVQARDRYYNSFWSEWA  322


> sp|P46658|IL12B_CERAT Interleukin-12 subunit beta OS=Cercocebus 
atys OX=9531 GN=IL12B PE=2 SV=1
Length=328

 Score =  317 bits (812),  Expect = 7e-103, Method: Composition-based stats.
 Identities = 69/333 (21%), Positives = 127/333 (38%), Gaps = 55/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+   +     V        PG+ V LTC   E +    + W L      
Sbjct  12   SLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG---ITWTL------  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLL----------VDVPPEEPQ  118
                   G G+ L ++  +  D+G Y+C++ G       LL           D+  ++ +
Sbjct  63   DQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLPHKKEDGIWSTDILKDQKE  122

Query  119  ------LSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
                  L C  K+    + C W                G  +   +T  A  L  +    
Sbjct  123  PKNETFLRCEAKNYSGRITCWWLSTISTDLTFSIISSRGSSNPQGVTCGAATLSAERVRG  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
              +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++P
Sbjct  183  DNKEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKP  235

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D  
Sbjct  236  DPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKT  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               VI    +       ++AQ+ +    W+EW+
Sbjct  295  SATVICRKNA----SFSVQAQDRYYSSSWNEWT  323


> sp|Q28938|IL12B_PIG Interleukin-12 subunit beta OS=Sus scrofa 
OX=9823 GN=IL12B PE=2 SV=1
Length=324

 Score =  316 bits (810),  Expect = 1e-102, Method: Composition-based stats.
 Identities = 68/329 (21%), Positives = 125/329 (38%), Gaps = 51/329 (16%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+         V      + PG+ V LTC   E +    + W        
Sbjct  12   SLVWLASPIVAIWELEKNVYVVELDWYPNAPGEMVVLTCNTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV----------------  112
               S   G G+ L +   +  D+G Y+C + G       LL+                  
Sbjct  63   DQSSEVLGTGKTLTIHVKEFGDAGQYTCRKGGAVLSQSLLLLHKKEDGIWSTDILKDQKE  122

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP------------AED  160
            P  +  L C  K+      C W      +++T     V+  + S             +ED
Sbjct  123  PKNKSFLKCEAKNYSGRFTCWW----LTAISTDLKFSVKSSRGSTDPRGVTCGTATLSED  178

Query  161  FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
              E  +Y  E Q+ S   A P  + S  I  +  A       + T +F    I++PDPP 
Sbjct  179  LGEYKKYRVECQEGS---ACPAAEESLPIEVVLEAVHKLKYENYTSSFFIRDIIKPDPPK  235

Query  221  NITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+ +  + +N R + ++W+ P +W++  S++ L F ++ + +  +     +  D     V
Sbjct  236  NLQLNPL-KNSRHVEISWEYPDTWSTPHSYFSLMFGVQVQGKNKREKKDKLFTDQISAKV  294

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                 +     ++++A++ +    WSEW+
Sbjct  295  TCHKDA----NIRVQARDRYYSSSWSEWA  319


> sp|P29460|IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens 
OX=9606 GN=IL12B PE=1 SV=1
Length=328

 Score =  314 bits (805),  Expect = 6e-102, Method: Composition-based stats.
 Identities = 73/333 (22%), Positives = 127/333 (38%), Gaps = 55/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+   +     V        PG+ V LTC   E +    + W L      
Sbjct  12   SLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG---ITWTL------  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--  112
               S   G G+ L ++  +  D+G Y+C++ G                  +  +L D   
Sbjct  63   DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE  122

Query  113  PPEEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
            P  +  L C  K+      C W                G      +T  A  L  +    
Sbjct  123  PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRG  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
              +++    +YS E Q+ S   A P  + S  I  M  A       + T +F    I++P
Sbjct  183  DNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKP  235

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D  
Sbjct  236  DPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKT  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               VI    +     + +RAQ+ +    WSEW+
Sbjct  295  SATVICRKNA----SISVRAQDRYYSSSWSEWA  323


> sp|P48095|IL12B_MACMU Interleukin-12 subunit beta OS=Macaca mulatta 
OX=9544 GN=IL12B PE=2 SV=1
Length=328

 Score =  312 bits (800),  Expect = 4e-101, Method: Composition-based stats.
 Identities = 71/333 (21%), Positives = 126/333 (38%), Gaps = 55/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+   +     V        PG+ V LTC   E +    + W L      
Sbjct  12   SLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG---ITWTL------  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--  112
                   G G+ L ++  +  D+G Y+C++ G                  +  +L D   
Sbjct  63   DQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKE  122

Query  113  PPEEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
            P  +  L C  K+      C W                G  +   +T  AV L  +    
Sbjct  123  PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRG  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
              +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++P
Sbjct  183  DNKEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKP  235

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D  
Sbjct  236  DPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKT  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               VI    +       ++AQ+ +    WSEW+
Sbjct  295  SATVICRKNA----SFSVQAQDRYYSSSWSEWA  323


> sp|Q865Y3|IL12B_PAPAN Interleukin-12 subunit beta OS=Papio anubis 
OX=9555 GN=IL12B PE=2 SV=1
Length=328

 Score =  310 bits (795),  Expect = 2e-100, Method: Composition-based stats.
 Identities = 71/333 (21%), Positives = 125/333 (38%), Gaps = 55/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+   +     V        PG+ V LTC   E +    + W L      
Sbjct  12   SLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG---ITWTL------  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVDV--  112
                   G G+ L ++  +  D+G Y+C++ G                  +  +L D   
Sbjct  63   DQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKE  122

Query  113  PPEEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNS  156
            P  +  L C  K+      C W                G  +   +T  AV L  +    
Sbjct  123  PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRG  182

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
              +++    +YS E Q+ S   A P  +    I  M  A       + T +F    I++P
Sbjct  183  DNKEY----EYSVECQEDS---ACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKP  235

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +  + +N R   V+W+ P +W++  S++ L F ++ + +  +     +  D  
Sbjct  236  DPPKNLQLKPL-KNSRQAEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKT  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               VI    +       ++AQ+ +    WSEW+
Sbjct  295  SATVICRKNA----SFSVQAQDRYYSSSWSEWA  323


> sp|Q865W9|IL12B_LAMGL Interleukin-12 subunit beta OS=Lama glama 
OX=9844 GN=IL12B PE=2 SV=1
Length=330

 Score =  306 bits (784),  Expect = 1e-98, Method: Composition-based stats.
 Identities = 68/334 (20%), Positives = 127/334 (38%), Gaps = 55/334 (16%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
               LLA+P  A+         V        PG++V LTC   E +    + W        
Sbjct  12   SLVLLASPIMAIWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPA---------------GTVHLLVDV-  112
             H S   G G+ L ++  +  D+G Y+C++ G                   T  L  D  
Sbjct  63   DHSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGVWSTDILKKDQK  122

Query  113  -PPEEPQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQN  155
             P  +  L C  K+   +  C W                G      +T  A  L  +   
Sbjct  123  EPKSKTFLKCEAKNYSGHFTCWWLTAVSTDLKFSVKSSRGSSDPRGVTCGAATLSAERVG  182

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                  ++  +Y+ E Q+ S   + P  + S  I  +  A       + + +F    I++
Sbjct  183  VE---HRDSWKYTVECQEGS---SCPAAEESLPIELVVEAVHKLKYENYSSSFFIRDIIR  236

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDL  273
            PDPP N+ +  + +N R + V+W+ P +W++  S++ L F ++ + +  +     +  D 
Sbjct  237  PDPPKNLQLKPL-KNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQGKHKREKKDKLFVDQ  295

Query  274  QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                V     +     ++++A++ +    WSEW+
Sbjct  296  TSAKVTCPKDA----SIRVQARDRYYSSSWSEWA  325


> sp|Q91ZK7|IL12B_SIGHI Interleukin-12 subunit beta OS=Sigmodon 
hispidus OX=42415 GN=IL12B PE=2 SV=1
Length=327

 Score =  301 bits (770),  Expect = 1e-96, Method: Composition-based stats.
 Identities = 68/332 (20%), Positives = 122/332 (37%), Gaps = 56/332 (17%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
              LL +P  A+         V        PG+ V LTC   E +D   + W         
Sbjct  13   MVLLVSPLMAIWELEKDVYVVEVDWSPGAPGERVVLTCDTSEEDD---IIWT------SD  63

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV----------------P  113
              S   G G+ L+++  +  D+G Y+C++ G       LL+                  P
Sbjct  64   QSSEVVGSGKTLIVQVKEFSDAGQYTCHKGGETLSHSRLLLHKKEDGIWSTDILKDQKDP  123

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSL----------------TTKAVLLVRKFQNSP  157
              +  L C   +      C W    +  L                T  A  L  +     
Sbjct  124  KNKTFLKCEAANYSGRFTCWWLTAVSTDLKFSLKSSSSSSDSRSVTCGAASLSTEKVTVD  183

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
              D+    +YS   Q+    +  P  + +  I  +  A       + +  F    I++PD
Sbjct  184  QRDYN---KYSVACQE---DITCPTAEETLPIELVMEAQHKYKYENYSTGFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PP N+ +  +      + V+W+ P SW++  S++ L+F ++   ++ K   + +V   + 
Sbjct  238  PPKNLQLKPLK--SSQVEVSWEYPDSWSTPHSYFSLKFFVQVYRKKEKKGESLLVD--KP  293

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               I  +  G    V++RAQ+ +    WSEW+
Sbjct  294  SAKIRCSKGG---EVRVRAQDHYYNSSWSEWA  322


> sp|Q924V5|IL12B_CAVPO Interleukin-12 subunit beta OS=Cavia porcellus 
OX=10141 GN=IL12B PE=2 SV=1
Length=332

 Score =  295 bits (754),  Expect = 3e-94, Method: Composition-based stats.
 Identities = 76/333 (23%), Positives = 130/333 (39%), Gaps = 55/333 (17%)

Query  8    LLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA  67
            L   LLA+P  A+   +     V     T  PG++V LTC   E +    + W       
Sbjct  11   LSLVLLASPLLAMWELKKDVYVVELDWHTDAPGETVVLTCNTAEEDG---ITWT------  61

Query  68   GSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV----------DVPPEEP  117
                S   G G+ L ++  +  D+G Y+C++ G       LL+          D+  E+ 
Sbjct  62   SDRKSDILGSGKTLTIQVKEFEDAGGYTCHKGGEVLSRSQLLLHKKEDEIWSTDILKEQK  121

Query  118  ------QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-------------A  158
                   L C  +S      C W      +  T     V+  + S              +
Sbjct  122  GSNGKTFLKCEARSYSGRFTCWW----LTAFGTDVKFSVKGSRGSSDPSGVTCGEAERVS  177

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
             D QE  +YS E Q+ S   A P  + S  I  +  A       + T +F    I++PDP
Sbjct  178  GDNQEY-KYSVECQEDS---ACPTAEESLPIEVVVDAIHKFKYENYTSSFYIRDIIKPDP  233

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERS--KTFTTWMVKDLQ  274
            P N+ +   + N + + V+W+ P +W++  S++ L F ++   +    +     +  D  
Sbjct  234  PKNLQLKP-SVNSQQVEVSWEYPDTWSTPHSYFSLTFLVQTHGKNKNRREKKYELFTDKT  292

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               V     S     V++RA++ +    WSEW+
Sbjct  293  SATVSCHKISK----VEVRARDRYYSSSWSEWA  321


> sp|Q8CJE6|IL12B_MESAU Interleukin-12 subunit beta OS=Mesocricetus 
auratus OX=10036 GN=IL12B PE=2 SV=1
Length=327

 Score =  293 bits (750),  Expect = 1e-93, Method: Composition-based stats.
 Identities = 64/331 (19%), Positives = 117/331 (35%), Gaps = 56/331 (17%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
              LLA+P  A+         V         G+ V LTC   E +D   + W         
Sbjct  13   VVLLASPLMAIWELEKDVYVVEVDWSPDAAGERVVLTCDTSEEDD---IIWT------SD  63

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV----------------P  113
              S   G G+ L ++  +  ++G Y+C++ G+      LL+                  P
Sbjct  64   KNSEAVGSGKTLTIQVKEFSNAGQYTCHKGGKTLSHSRLLLHKKENGIWSTDILKDQKDP  123

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSL----------------TTKAVLLVRKFQNSP  157
              +  L C   +      C W    +  L                T  A  L  +     
Sbjct  124  KNKTFLKCEAANYSGRFTCWWLTAISTDLKFNVKSSSSSSDSRAVTCGAASLSAEKVTVD  183

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             +D+Q   +YS   Q+    +  P  + +  I  +  A       + +  F    I++PD
Sbjct  184  RKDYQ---KYSVACQE---DITCPTAEETLPIGLVMEAQHKYKYENYSTGFFIRDIIKPD  237

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            PP N+ +  +      + ++W+ P SW++  S++ L+F ++   +R +   +  V     
Sbjct  238  PPKNLQLKPLRG--SQMELSWEYPDSWSTPHSYFSLKFHVQVHRKRERKDESQFVDKTSA  295

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
                          V++RAQ+ +    WS W
Sbjct  296  TIRCS-----KGAEVRVRAQDHYYNSSWSRW  321


> sp|Q61729|IL12B_MARMO Interleukin-12 subunit beta OS=Marmota 
monax OX=9995 GN=IL12B PE=2 SV=1
Length=327

 Score =  290 bits (743),  Expect = 1e-92, Method: Composition-based stats.
 Identities = 70/333 (21%), Positives = 130/333 (39%), Gaps = 56/333 (17%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
                LA+P  A+         V        PG+ V LTC   E +    + W        
Sbjct  12   SLVWLASPLLAIWELEKNVYVVELDWHPDTPGEKVVLTCDTPEEDG---ITWT------S  62

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVD-----------VPPEEP  117
               S   G G+ L +   +  D+G+Y+C R G     + LL+            +  +EP
Sbjct  63   EQSSEVLGSGKTLTILVKEFEDAGHYTCRRGGEVLSQMLLLLHKNEDGIWSTDILKKKEP  122

Query  118  Q----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP----------------  157
            +    ++C  K+      C W      +++T     V+  + S                 
Sbjct  123  ENKNLVTCEAKNYSGRFTCWW----LTAISTDVNFSVKSHRGSSDPQGVTCGEATLSAER  178

Query  158  -AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               + +E  +YS + Q+ +   A P  + +  I  +  A       +   +F    I++P
Sbjct  179  VKIEQREYKKYSVQCQEDN---ACPTAEETLPITVVVDAVHKLKYENYISSFFIRDIIKP  235

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            DPP N+ +   ++ P+ + VTW+ P SW++  S++ L F ++ + ++ K   T  V    
Sbjct  236  DPPKNLKMKP-SKTPQQVEVTWEYPDSWSTPHSYFSLTFSVQVQGKKKKRSNTLHVDKTS  294

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
               V      G +  V ++A++ +    WSEW+
Sbjct  295  ---VTVTCQKGAK--VSVQARDRYYNSSWSEWA  322


> sp|P51641|CNTFR_CHICK Ciliary neurotrophic factor receptor subunit 
alpha OS=Gallus gallus OX=9031 GN=CNTFR PE=2 SV=1
Length=362

 Score =  262 bits (670),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 131/293 (45%), Gaps = 26/293 (9%)

Query  34   VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGN  93
            +     G  VT+ C  ++ +  A V W     A G+        G  L+L++V L  SG 
Sbjct  31   IQYERVGADVTMKCGSMDWD--AAVTWT----ANGTDIDDSHLNGSYLILKNVDLTQSGQ  84

Query  94   YSCYRA--GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTKAVL  148
            YSCY           +L V VPP+EP L C   +      C W    P   P+    +V+
Sbjct  85   YSCYEGSSWHLKYQTYLRVGVPPKEPVLMCRSNNYPKGFYCSWHLPSPTYIPNSFNISVI  144

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSKTQT  207
               +      + F +            C +   +  S+  Y V++ V +++G   S T T
Sbjct  145  HGTREMVCEKDIFPK----------NRCHIRYLQLFSTVKYKVTLTVTNALGKN-STTLT  193

Query  208  FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFT  266
            F    I++PDPP ++    V  NPR L V+WQ+P SW +   + L+F LRYR      + 
Sbjct  194  FDEFAIVKPDPPESVVAKPVPNNPRRLEVSWQNPSSWPDPESFPLKFFLRYRPLILDQWQ  253

Query  267  TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
               + D   H  I DA++G  +++Q+ A++    G WS+WS     TPWTE  
Sbjct  254  HVELSDGTSH-TITDAYAGKEYIIQVAAKDN-DIGTWSDWSVAVHATPWTEEP  304


> sp|P43432|IL12B_MOUSE Interleukin-12 subunit beta OS=Mus musculus 
OX=10090 GN=Il12b PE=1 SV=1
Length=335

 Score =  259 bits (661),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 62/336 (18%), Positives = 117/336 (35%), Gaps = 59/336 (18%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
              LL +P  A+         V        PG++V LTC   E +D   + W         
Sbjct  13   IVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDD---ITWT------SD  63

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV-------------PPEE  116
                  G G+ L +   +  D+G Y+C++ G      HLL+                  +
Sbjct  64   QRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNK  123

Query  117  PQLSCFRKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAED  160
              L C   +      C W                    + ++T     L  +       D
Sbjct  124  TFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRD  183

Query  161  FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
            ++   +YS   Q+    +  P  + +  I     A       + + +F    I++PDPP 
Sbjct  184  YE---KYSVSCQE---DVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPK  237

Query  221  NITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+ +  +      + V+W+ P SW++  S++ L+F +R + ++ K   T    + +    
Sbjct  238  NLQMKPLKN--SQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAF-  294

Query  279  IHDAWSGLRHVVQ-------LRAQEEFGQGEWSEWS  307
                       VQ       ++AQ+ +     S+W+
Sbjct  295  ---LVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWA  327


> sp|O88507|CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit 
alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
Length=372

 Score =  256 bits (653),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 90/296 (30%), Positives = 131/296 (44%), Gaps = 26/296 (9%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHD  90
            A  V     G  VTL C     +  A V W       G+  +     G +L+LRS++L  
Sbjct  30   APHVQYERLGADVTLPCGTASWD--AAVTW----RVNGTDLAPDLLNGSQLILRSLELGH  83

Query  91   SGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTK  145
            SG Y+C+   +      V L V +PP EP LSC   +      C W    P   P+    
Sbjct  84   SGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNV  143

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSK  204
             VL   K      +           + K  C +      S+  Y VS+ V++++G   + 
Sbjct  144  TVLHGSKIMVCEKD----------PALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTA  193

Query  205  TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSK  263
              TF    I++PDPP N+    V  NPR L VTWQ P +W +   + L+F LRYR     
Sbjct  194  -ITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILD  252

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
             +    + D   H  I DA++G  +++Q+ A++    G WS+WS  A  TPWTE  
Sbjct  253  QWQHVELSDGTAH-TITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAAHATPWTEEP  306


> sp|Q71DR4|CNTFR_CANLF Ciliary neurotrophic factor receptor subunit 
alpha OS=Canis lupus familiaris OX=9615 GN=CNTFR PE=2 
SV=1
Length=372

 Score =  256 bits (653),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 88/296 (30%), Positives = 130/296 (44%), Gaps = 26/296 (9%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHD  90
            A  V     G  VTL C     +  A V W       G+  +     G +L+L  ++L  
Sbjct  30   APHVQYERLGSDVTLPCGTANWD--AAVTW----RVNGTDLALDLLNGSQLVLHGLELGH  83

Query  91   SGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTK  145
            SG Y+C+   +      V L V +PP EP LSC   +      C W    P   P+    
Sbjct  84   SGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNV  143

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSK  204
             VL   K      +           + K  C +      S+  Y VS+ V++++G   + 
Sbjct  144  TVLHGSKIMVCEKD----------PALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATA  193

Query  205  TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSK  263
              TF    I++PDPP N+    V  NPR L VTWQ P +W +   + L+F LRYR     
Sbjct  194  -ITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILD  252

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
             +    + D   H  I DA++G  +++Q+ A++ +  G WS+WS  A  TPWTE  
Sbjct  253  QWQHVELSDGTTH-TITDAYAGKEYIIQVAAKD-YEIGTWSDWSVAAHATPWTEEP  306


> sp|P26992|CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit 
alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
Length=372

 Score =  254 bits (649),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 88/296 (30%), Positives = 129/296 (44%), Gaps = 26/296 (9%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHD  90
            A  V     G  VTL C     +  A V W       G+  +     G +L+L  ++L  
Sbjct  30   APHVQYERLGSDVTLPCGTANWD--AAVTW----RVNGTDLAPDLLNGSQLVLHGLELGH  83

Query  91   SGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTK  145
            SG Y+C+   +      V L V +PP EP LSC   +      C W    P   P+    
Sbjct  84   SGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNV  143

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSK  204
             VL   K      +           + K  C +      S+  Y VS+ V++++G   + 
Sbjct  144  TVLHGSKIMVCEKD----------PALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATA  193

Query  205  TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSK  263
              TF    I++PDPP N+    V  NPR L VTWQ P +W +   + L+F LRYR     
Sbjct  194  -ITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILD  252

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
             +    + D   H  I DA++G  +++Q+ A++    G WS+WS  A  TPWTE  
Sbjct  253  QWQHVELSDGTAH-TITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAAHATPWTEEP  306


> sp|Q08406|CNTFR_RAT Ciliary neurotrophic factor receptor subunit 
alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
Length=372

 Score =  253 bits (646),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 89/296 (30%), Positives = 131/296 (44%), Gaps = 26/296 (9%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHD  90
            A  V     G  VTL C     +  A V W       G+  +     G +L+LRS++L  
Sbjct  30   APHVQYERLGTDVTLPCGTASWD--AAVTW----RVNGTDLAPDLLNGSQLILRSLELGH  83

Query  91   SGNYSCYR--AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTK  145
            SG Y+C+   +      V L V +PP EP LSC   +      C W    P   P+    
Sbjct  84   SGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLSAPTYIPNTFNV  143

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSK  204
             VL   K      +           + K  C +      S+  Y VS+ V++++G   + 
Sbjct  144  TVLHGSKMMVCEKD----------PALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTA  193

Query  205  TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSK  263
              TF    I++PDPP N+    V  NPR L VTWQ P +W +   + L+F LRYR     
Sbjct  194  -ITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILD  252

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
             +    + +   H  I DA++G  +++Q+ A++    G WS+WS  A  TPWTE  
Sbjct  253  QWQHVELSNGTAH-TITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAAHATPWTEEP  306


> sp|O75462|CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo 
sapiens OX=9606 GN=CRLF1 PE=1 SV=1
Length=422

 Score =  246 bits (628),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 85/401 (21%), Positives = 131/401 (33%), Gaps = 50/401 (12%)

Query  28   QEVARGVLTSLPGDSVTLTC------PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRL  81
              ++    T L G S+  TC      PG   E    ++W L         SR        
Sbjct  41   AVISPQDPTLLIGSSLLATCSVHGDPPGATAEG---LYWTLNGRRLPPELSRVLNASTLA  97

Query  82   L----LRSVQLHDSGNYSCY-RAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWG  135
            L    L   +     N  C+ R G       L V +PPE+P  +SC+ K+ + ++ C W 
Sbjct  98   LALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKN-MKDLTCRWT  156

Query  136  PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
            P +           ++       +D    C+        SC +       + Y + +   
Sbjct  157  PGAHGETFLHTNYSLKYKLRWYGQD--NTCEEYHTVGPHSCHIPKDLALFTPYEIWVEAT  214

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
            + +GS  S   T     ++  DPP ++ V+ V      LSV W  P +     ++ ++++
Sbjct  215  NRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQI  274

Query  256  RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE-----WSEWS-PE  309
            RYR E S  +        Q  C +     G  + VQ+R       G      WSEWS P 
Sbjct  275  RYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPT  334

Query  310  AMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLV  369
            A  TP +E   P                                 P        L  FL 
Sbjct  335  AASTPRSERPGPGG----------------------GACEPRGGEPSSGPVRRELKQFLG  372

Query  370  AGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSL  410
                 A+    C  +  R    W+    K  KT       L
Sbjct  373  WLKKHAY----CSNLSFRLYDQWRAWMQKSHKTRNQDEGIL  409


> sp|Q9JM58|CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus 
musculus OX=10090 GN=Crlf1 PE=1 SV=1
Length=425

 Score =  246 bits (628),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 87/401 (22%), Positives = 134/401 (33%), Gaps = 50/401 (12%)

Query  28   QEVARGVLTSLPGDSVTLTC------PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRL  81
              ++    T L G S+  TC      PG   E    ++W L      S  SR        
Sbjct  44   AVISPQDPTLLIGSSLQATCSIHGDTPGATAEG---LYWTLNGRRLPSELSRLLNTSTLA  100

Query  82   L----LRSVQLHDSGNYSCY-RAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWG  135
            L    L   +     N  C+ R G       L V +PPE+P  +SC+ ++ + ++ C W 
Sbjct  101  LALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRN-MKDLTCRWT  159

Query  136  PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
            P +           ++       +D    C+        SC +       + Y + +   
Sbjct  160  PGAHGETFLHTNYSLKYKLRWYGQD--NTCEEYHTVGPHSCHIPKDLALFTPYEIWVEAT  217

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
            + +GS  S   T     ++  DPP ++ V+ V      LSV W  P +     ++ ++++
Sbjct  218  NRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQI  277

Query  256  RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE-----WSEWS-PE  309
            RYR E S  +        Q  C +     G  + VQ+R       G      WSEWS P 
Sbjct  278  RYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPT  337

Query  310  AMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLV  369
            A  TP +E   P     V  P                        P        L  FL 
Sbjct  338  AASTPRSERPGP--GGGVCEPRGGE--------------------PSSGPVRRELKQFLG  375

Query  370  AGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSL  410
                 A+    C  +  R    W+    K  KT       L
Sbjct  376  WLKKHAY----CSNLSFRLYDQWRAWMQKSHKTRNQDEGIL  412


> sp|Q9BEG2|I12R2_BOVIN Interleukin-12 receptor subunit beta-2 
OS=Bos taurus OX=9913 GN=IL12RB2 PE=2 SV=1
Length=861

 Score =  247 bits (629),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 79/378 (21%), Positives = 135/378 (36%), Gaps = 58/378 (15%)

Query  5    GCALLAALLAAPGAALAPRRCPAQEVARGVLTSLP------GDSVTLTCPGVEPEDNATV  58
            GC+L           L   +       RG +T  P      G +V ++C           
Sbjct  7    GCSLALIF----IIMLLLVKAKIDVCKRGDVTVQPSHVISLGSAVNISCS----------  52

Query  59   HWVLRKPAAGS-HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVH----------  107
                 KP  G    S +  +      R + +    + S    G P GT            
Sbjct  53   ----LKPKQGCLPSSSFNKLILYKFDRRIYVQHGHSLSSQVKGLPLGTTLFVCKLACSSS  108

Query  108  ---------LLVDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP  157
                     + V V PE+P+ LSC +K     V C W       L T   L +   +N  
Sbjct  109  DEIRICGAEISVGVVPEQPRNLSCIQKGERGTVTCTWHRGRDTHLYTAYTLQLNGPKNL-  167

Query  158  AEDFQEPCQY-SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               +Q+ C     +       L  PE   S Y V +   +S+GS  S   +F    I++P
Sbjct  168  --TWQKQCNDHYCDHLDLGINLT-PESLESSYTVKVTAINSLGSASSFPFSFTLLDIVRP  224

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
             PP +I +  V  +    ++ W+D          L   LRYR   S+++    V + +  
Sbjct  225  LPPWDIRIKFVNASVDRCTLLWRD------EGLVLLNRLRYRPINSRSWNMVNVTNAKGR  278

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
              + D      +  Q+ ++    +G WS+WS E++ T  T    P     V    Q +  
Sbjct  279  HDLLDLKPFTEYEFQISSKLHLYKGSWSDWS-ESLRTQ-TPEEEPIGMLNVWYMRQHIDY  336

Query  337  NKDDDNILFRDSANATSL  354
            N+   ++ +++ + + + 
Sbjct  337  NRQQISLFWKNLSLSEAR  354


> sp|Q91094|PRLR_MELGA Prolactin receptor OS=Meleagris gallopavo 
OX=9103 GN=PRLR PE=2 SV=1
Length=831

 Score =  241 bits (614),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 98/242 (40%), Gaps = 15/242 (6%)

Query  74   WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV-PPEEPQLSCFRKSPLSNVVC  132
                G R +++   + D G +S + + R    + +   + PPE+P ++  R        C
Sbjct  193  RLNAGMRYVVQVRCMLDPGEWSEWSSER---RILISGGLSPPEKPTITKCRSPEKETFTC  249

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVS  191
             W P       T   LL  K      E+    C   + +   SC          + Y ++
Sbjct  250  WWKPGLDGGHPTNYTLLYSK----EGEEQVYECPDYRTAGPNSCYFDKKHTSFWTVYNIT  305

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSS  247
            +   + +GS  S         I+QPDPPAN+T+       R  +L +TW  P      S 
Sbjct  306  VKATNEMGSNSSDPHYVDVTYIVQPDPPANVTLELKKPINRKPYLMLTWSPPPLADVRSG  365

Query  248  FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            +  L +ELR + E  + + T  V   Q    +     G +++VQ+  + +   G WSEWS
Sbjct  366  WLTLDYELRLKPEEGEEWETVFVGQ-QTQYKMFSLNPGKKYIVQIHCKPDH-HGSWSEWS  423

Query  308  PE  309
             E
Sbjct  424  SE  425


 Score =  215 bits (548),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 61/211 (29%), Positives = 90/211 (43%), Gaps = 10/211 (5%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
            P  TV L     P +P++   R        C W P S   L T   L   K     +E+ 
Sbjct  16   PLTTVGLTSQSFPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTLFYSK----DSEEK  71

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
               C   + S   SC       +S + Y +++   + +GS  S  Q      I+QP  P 
Sbjct  72   IYECPDYRTSGPNSCYFNRNYTNSWTTYNITVTATNEIGSNSSDPQYVDVTSIVQPGSPV  131

Query  221  NITVT-AVARNPRWLSVTWQDPHSWNSSFYRL-RFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+T+      N  +L   W  P   ++S   L  +ELR + E  + + T  V  +Q  C 
Sbjct  132  NLTLETQRYANIMYLWAKWSPPLLADASSNHLYHYELRLKPEEKEEWETVPVG-VQTQCK  190

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            I+   +G+R+VVQ+R       GEWSEWS E
Sbjct  191  INRLNAGMRYVVQVRCM--LDPGEWSEWSSE  219


> sp|Q04594|PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 
GN=PRLR PE=2 SV=1
Length=831

 Score =  238 bits (608),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 57/242 (24%), Positives = 94/242 (39%), Gaps = 15/242 (6%)

Query  74   WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVD-VPPEEPQLSCFRKSPLSNVVC  132
                G R +++     D G +S + + R    + +     PPE+P +   R        C
Sbjct  193  RLNAGMRYVVQVRCTLDPGEWSEWSSER---HILIPSGQSPPEKPTIIKCRSPEKETFTC  249

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVS  191
             W P       T   LL  K      E+    C   + +   SC          + Y ++
Sbjct  250  WWKPGLDGGHPTNYTLLYSK----EGEEQVYECPDYRTAGPNSCYFDKKHTSFWTIYNIT  305

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSS  247
            +   + +GS  S         I+QPDPP N+T+       R  +L +TW  P      S 
Sbjct  306  VRATNEMGSNSSDPHYVDVTYIVQPDPPVNVTLELKKPINRKPYLVLTWSPPPLADVRSG  365

Query  248  FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            +  L +ELR + E  + + T  V   Q    +     G ++++Q+  + +   G WSEWS
Sbjct  366  WLTLEYELRLKPEEGEEWETIFVGQ-QTQYKMFSLNPGKKYIIQIHCKPDH-HGSWSEWS  423

Query  308  PE  309
             E
Sbjct  424  SE  425


 Score =  211 bits (536),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 59/213 (28%), Positives = 89/213 (42%), Gaps = 10/213 (5%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
            P  TV L     P +P++   R        C W P S   L T   L   K     +E+ 
Sbjct  16   PLTTVGLAGQSFPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTLFYSK----DSEEE  71

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
               C   + S   SC          + + +++   + +GS  S  Q      I+QP  P 
Sbjct  72   IYECPDYRTSGPNSCYFNKNHTSPWTTFNITVTATNEIGSNSSDPQYVDVTSIVQPGSPV  131

Query  221  NITVTAV-ARNPRWLSVTWQDPHSWNSSFYRL-RFELRYRAERSKTFTTWMVKDLQHHCV  278
            N+T+    + N  +L   W  P   ++S   L  +ELR + E  + + T  V  +Q  C 
Sbjct  132  NLTLETKRSANIMYLWAKWSPPLLADASSNHLYHYELRIKPEEKEEWETISVG-VQTQCK  190

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
            I+   +G+R+VVQ+R       GEWSEWS E  
Sbjct  191  INRLNAGMRYVVQVRCT--LDPGEWSEWSSERH  221


> sp|P14787|PRLR_RABIT Prolactin receptor OS=Oryctolagus cuniculus 
OX=9986 GN=PRLR PE=1 SV=1
Length=616

 Score =  234 bits (596),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 51/206 (25%), Positives = 83/206 (40%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP +P +   R        C W P +   L T   L   K      E     C   + 
Sbjct  25   QSPPGKPFIFKCRSPEKETFTCWWRPGADGGLPTNYTLTYHK----EGETITHECPDYKT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                SC  +       + YI+++   + +GS  S  +      I++PDPP N+T+     
Sbjct  81   GGPNSCYFSKKHTSIWTIYIITVNATNQMGSSVSDPRYVDVTYIVEPDPPVNLTLEVKHP  140

Query  230  NPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              R  +L V W  P      S +  L++E+R + E++  + T      Q    I   + G
Sbjct  141  EDRKPYLWVKWLPPTLVDVRSGWLTLQYEIRLKPEKAAEWETHFAGQ-QTQFKILSLYPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WS WSPE+ 
Sbjct  200  QKYLVQVRCKP--DHGFWSVWSPESS  223


> sp|Q6JTA8|PRLR_PIG Prolactin receptor OS=Sus scrofa OX=9823 GN=PRLR 
PE=2 SV=2
Length=625

 Score =  232 bits (591),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 51/206 (25%), Positives = 85/206 (41%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP +P++   R        C W P +   L T   L   K      E F   C   + 
Sbjct  25   QSPPGKPEIFKCRSPEKETFTCWWKPGADGGLPTNYTLTYHK----EGETFTHECPDYKT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                SC          + YI+++   + +GS  S  +      I++PDPP N+T+     
Sbjct  81   GGPNSCYFNKKHTSIWTIYIITVNATNQMGSSSSDPRYVDVTYIVEPDPPVNLTLELKKP  140

Query  230  NPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              +  +L + W  P      S +  L++E+R + E++  + T      Q    I   + G
Sbjct  141  EDQKPYLWIKWLPPTLVDVRSGWLTLQYEIRLQPEKTAEWETHFAGQ-QTQFKILSLYPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WSEWSPE+ 
Sbjct  200  QKYLVQVRCKP--DHGFWSEWSPESS  223


> sp|Q90374|PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 
GN=PRLR PE=2 SV=1
Length=830

 Score =  233 bits (593),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 98/242 (40%), Gaps = 15/242 (6%)

Query  74   WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVD-VPPEEPQLSCFRKSPLSNVVC  132
                G + +++   + D G +S + + R    +H+     PPE+P +   R        C
Sbjct  194  RLQAGVKYVVQVRCVLDIGEWSEWSSER---HIHIPNGESPPEKPTIIKCRSPEKETFTC  250

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVS  191
             W P S     T   LL  K      E+    C   + +   SC          + Y ++
Sbjct  251  WWKPGSDGGHPTNYTLLYSK----EGEERVYECPDYKTAGPNSCYFDKKHTSFWTIYNIT  306

Query  192  MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSS  247
            +   + +GS  S         I+Q DPP N+T+       R  +L +TW  P      S 
Sbjct  307  VKATNEIGSNVSDPLYVDVTYIVQTDPPVNVTLELKKTVNRKPYLVLTWSPPPLADVRSG  366

Query  248  FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            +  L +ELR + E ++ + T  V   Q H  +     G +++VQ+  + +   G WSEWS
Sbjct  367  WLTLDYELRLKPEEAEEWETIFVGQ-QTHYKMFSLNPGKKYIVQIHCKPDH-HGSWSEWS  424

Query  308  PE  309
             E
Sbjct  425  LE  426


 Score =  194 bits (493),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 56/224 (25%), Positives = 89/224 (40%), Gaps = 12/224 (5%)

Query  101  RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAED  160
                 V L     P +P++   R        C W P S   L T   L   K     +E+
Sbjct  15   FALTAVGLTGQSYPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNYTLFYSK----DSEE  70

Query  161  FQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP  219
                C     S   SC       +  + Y +++   + +GS  S  Q      I+QPD P
Sbjct  71   KIYECPDYGMSGPNSCYFDKNHTNPWTTYNITVMAMNEIGSNSSDPQYVDVTSIVQPDAP  130

Query  220  ANITVTAV-ARNPRWLSVTWQDPHSWNSSFYR--LRFELRYRAERSKTFTTWMVKDLQHH  276
             N+++    + +  +L   W  P   + +      R+ELR + E  + + T  V  +Q  
Sbjct  131  VNLSLETKTSASTTYLLAKWSPPPLADVTSNSHVYRYELRLKPEEKEEWETVSVG-VQTQ  189

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM-GTPWTESR  319
              ++   +G+++VVQ+R       GEWSEWS E     P  ES 
Sbjct  190  YKVNRLQAGVKYVVQVRCV--LDIGEWSEWSSERHIHIPNGESP  231


> sp|Q99665|I12R2_HUMAN Interleukin-12 receptor subunit beta-2 
OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
Length=862

 Score =  232 bits (591),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 72/339 (21%), Positives = 125/339 (37%), Gaps = 48/339 (14%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS-HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
            L G +V +TC                KP  G  H SR   +      R +  H   + + 
Sbjct  42   LLGSTVNITCS--------------LKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNS  87

Query  97   YRAGRPAGTVH-------------------LLVDVPPEEPQ-LSCFRKSPLSNVVCEWGP  136
               G P GT                     + V V PE+PQ LSC +K     V C W  
Sbjct  88   QVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWER  147

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQY-SQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                 L T+  L +   +N     +Q+ C+    +   F   L  PE   S +   +   
Sbjct  148  GRDTHLYTEYTLQLSGPKNL---TWQKQCKDIYCDYLDFGINLT-PESPESNFTAKVTAV  203

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
            +S+GS  S   TF    I++P PP +I +     +    ++ W+D          L   L
Sbjct  204  NSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRD------EGLVLLNRL  257

Query  256  RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
            RYR   S+ +    V   +    + D      +  Q+ ++    +G WS+WS E++    
Sbjct  258  RYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWS-ESLRAQ-  315

Query  316  TESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
            T    P    +V    + +  ++   ++ +++ + + + 
Sbjct  316  TPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEAR  354


> sp|O46561|PRLR_SHEEP Prolactin receptor OS=Ovis aries OX=9940 
GN=PRLR PE=2 SV=1
Length=581

 Score =  227 bits (579),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 86/206 (42%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PPE+P+L   R        C W P +   L T   L  RK      E     C   + 
Sbjct  25   QSPPEKPKLIKCRSPGKETFTCWWEPGADGGLPTNYTLTYRK----EGETLIHECPDYKT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                SC  +         Y++++   + +G   S         I++P+PP N+T+     
Sbjct  81   GGPNSCYFSKKYTSIWKMYVITVSAINQMGISSSDPLYVDVTYIVEPEPPVNLTLELKHP  140

Query  230  NPR--WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              R  +L + W  P      S ++ +++E+R + E++  + T     L     I + + G
Sbjct  141  EDRKPYLWIKWSPPTLTDVKSGWFSIQYEIRLKPEKATDWETHFAPKL-TQLKIFNLYPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WSEWSPE+ 
Sbjct  200  QKYLVQIRCKP--DHGYWSEWSPESF  223


> sp|Q28172|PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 
GN=PRLR PE=1 SV=1
Length=581

 Score =  225 bits (573),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 86/206 (42%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PPE+P+L   R        C W P +   L T   L   K      E     C   + 
Sbjct  25   QSPPEKPKLVKCRSPGKETFTCWWEPGADGGLPTNYTLTYHK----EGETLIHECPDYKT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                SC  +         Y++++   + +G   S         I++P+PPAN+T+     
Sbjct  81   GGPNSCYFSKKHTSIWKMYVITVNAINQMGISSSDPLYVHVTYIVEPEPPANLTLELKHP  140

Query  230  NPR--WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              R  +L + W  P      S ++ +++E+R + E++  + T      Q    I + + G
Sbjct  141  EDRKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDWETHFTLK-QTQLKIFNLYPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WSEWSPE+ 
Sbjct  200  QKYLVQIRCKP--DHGYWSEWSPESS  223


> sp|P05710|PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 
GN=Prlr PE=1 SV=2
Length=610

 Score =  225 bits (574),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 48/215 (22%), Positives = 82/215 (38%), Gaps = 12/215 (6%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
                  L    PP +P++   R        C W P +   L T   L   K      E  
Sbjct  11   VLNISLLKGQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKT  66

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
               C   + S   SC  +         YI+++   + +GS  S         I++P+PP 
Sbjct  67   TYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPR  126

Query  221  NIT--VTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            N+T  V  +     +L V W  P      + ++ + +E+R + E ++ +        Q  
Sbjct  127  NLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHF-TGHQTQ  185

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
              + D + G +++VQ R +     G WS WS E+ 
Sbjct  186  FKVFDLYPGQKYLVQTRCKP--DHGYWSRWSQESS  218


> sp|Q28235|PRLR_CEREL Prolactin receptor OS=Cervus elaphus OX=9860 
GN=PRLR PE=2 SV=1
Length=581

 Score =  224 bits (570),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 47/206 (23%), Positives = 82/206 (40%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP +P++   R        C W P S   L T   L   K      E     C   + 
Sbjct  25   QSPPGKPKIIKCRSPGKETFTCWWEPGSDGGLPTNYTLTYHK----EGETLIHECPDYKT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                +C  +         Y++++   + +G   S         I++P+PPAN+T+     
Sbjct  81   GGPNTCYFSKKHTSIWKIYVITVNAINQMGVSSSDPLYVDVTYIVEPEPPANLTLELKHP  140

Query  230  NPR--WLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              R  +L + W  P      S ++ +++E+R + E +  +        Q    I   + G
Sbjct  141  EDRKPYLWIKWFPPTLTDVKSGWFMIQYEIRLKPETAADWEIHFAAK-QTQLKIFSLYPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WSEWSPE+ 
Sbjct  200  QKYLVQVRCKP--DHGYWSEWSPESS  223


> sp|Q8MJS1|I12R2_PIG Interleukin-12 receptor subunit beta-2 OS=Sus 
scrofa OX=9823 GN=IL12RB2 PE=2 SV=1
Length=861

 Score =  228 bits (581),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 69/337 (20%), Positives = 123/337 (36%), Gaps = 48/337 (14%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGS-HPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            G +V ++C                KP  G    S    +      R +      + S   
Sbjct  44   GSAVNISCS--------------LKPRQGCLQVSSLNKLILYRFHRRIHFQRGHSLSSQV  89

Query  99   AGRPAGTVH-------------------LLVDVPPEEPQ-LSCFRKSPLSNVVCEWGPRS  138
             G P GT                     + V V PE+PQ +SC +K     V C W    
Sbjct  90   TGLPLGTTLFVCKLACSSKEEIRICGAEISVGVVPEQPQNVSCMQKGERGTVACSWDRGR  149

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPC-QYSQESQKFSCQLAVPEGDSSFYIVSMCVASS  197
               L T   L +   +N     +Q+ C  Y  +S      L  PE   S Y   +   +S
Sbjct  150  DTHLYTAYTLQLNGPKNL---TWQKQCSDYYCDSLDLGINLP-PESPESSYTAQVTAINS  205

Query  198  VGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
            +G+  S   TF    +++P PP +I +  V  +    ++ W+D          L   LRY
Sbjct  206  LGTASSLPSTFTFLDVVRPLPPWDIRIKCVNASVSTCTLQWRD------EGLVLLNRLRY  259

Query  258  RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
            R   S+++      + +    + D      +  Q+ ++    +G WS+WS E++ T  T 
Sbjct  260  RPVYSRSWNMVNATNAKGRHDLVDLKPFTEYEFQISSKPHLQKGRWSDWS-ESLRTQ-TP  317

Query  318  SRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
             + P    +V    Q +   +   ++ +++ + + + 
Sbjct  318  EKEPTGMLDVWYMKQHIDYKRQQISLFWKNLSLSEAR  354


> sp|P16471|PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 
GN=PRLR PE=1 SV=1
Length=622

 Score =  219 bits (558),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 47/206 (23%), Positives = 75/206 (36%), Gaps = 12/206 (6%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
             +PP +P++   R        C W P +   L T   L   +      E     C     
Sbjct  25   QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYIT  80

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                SC            YI+ +   + +GS FS         I+QPDPP  + V     
Sbjct  81   GGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQP  140

Query  230  NPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              R  +L + W  P      + ++ L +E+R + E++  +        Q    I     G
Sbjct  141  EDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQ-QTEFKILSLHPG  199

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAM  311
             +++VQ+R +     G WS WSP   
Sbjct  200  QKYLVQVRCKP--DHGYWSAWSPATF  223


> sp|Q08501|PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 
GN=Prlr PE=1 SV=1
Length=608

 Score =  217 bits (553),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 48/213 (23%), Positives = 80/213 (38%), Gaps = 12/213 (6%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
                  L    PP +P++   R        C W P S   L T   L   K      E  
Sbjct  11   VLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSK----EGEKN  66

Query  162  QEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
               C   + S   SC  +         YI+++   + +GS  S         I++P+PP 
Sbjct  67   TYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPR  126

Query  221  NIT--VTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            N+T  V  +     +L V W  P      + ++ + +E+R ++E +  +        Q  
Sbjct  127  NLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHF-TGHQTQ  185

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              + D + G +++VQ R +     G WS W  E
Sbjct  186  FKVFDLYPGQKYLVQTRCKP--DHGYWSRWGQE  216


> sp|P97378|I12R2_MOUSE Interleukin-12 receptor subunit beta-2 
OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
Length=874

 Score =  215 bits (546),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 51/257 (20%), Positives = 97/257 (38%), Gaps = 15/257 (6%)

Query  102  PAGTVHLLVDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAED  160
            P   V + V V PE PQ +SC ++     V C W       L T   L +    N     
Sbjct  125  PVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNLTC--  182

Query  161  FQEPCQYSQESQKFSCQLAV---PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             Q+ C            L +   P+   S +IV +   + +G+  S   TF    I+ P 
Sbjct  183  -QKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIPL  241

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            PP +I +  +  +    ++ W+D          +  +LRY+   S ++      + +   
Sbjct  242  PPWDIRINFLNASGSRGTLQWEDEGQ------VVLNQLRYQPLNSTSWNMVNATNAKGKY  295

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
             + D      +  Q+ ++     G WS WS E++ T  T    P    ++    Q +  +
Sbjct  296  DLRDLRPFTEYEFQISSKLHLSGGSWSNWS-ESLRT-RTPEEEPVGILDIWYMKQDIDYD  353

Query  338  KDDDNILFRDSANATSL  354
            +   ++ ++    + + 
Sbjct  354  RQQISLFWKSLNPSEAR  370


> sp|Q00560|IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus 
musculus OX=10090 GN=Il6st PE=1 SV=2
Length=917

 Score =  206 bits (523),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 52/249 (21%), Positives = 99/249 (40%), Gaps = 18/249 (7%)

Query  103  AGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
               V +L   PP++P  L+C       N++C+W P     L T   L         +E  
Sbjct  115  VYGVTMLSGFPPDKPTNLTCIVNEG-KNMLCQWDPGRETYLETNYTL--------KSEWA  165

Query  162  QEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPAN  221
             E     Q     SC ++          V +   +++G   S++  F     ++P PP N
Sbjct  166  TEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYN  225

Query  222  ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCV  278
            ++VT        L ++W    S       L+ +++YR + + T+    ++D    +    
Sbjct  226  LSVTNSEELSSILKLSWV--SSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFT  283

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL-TTN  337
            + D      +V ++R+ ++ G+G WS+WS EA GT + +  S P                
Sbjct  284  VQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSRPP--SFWYKTNPSHGQE  341

Query  338  KDDDNILFR  346
                 ++++
Sbjct  342  YRSVRLIWK  350


> sp|P40189|IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo 
sapiens OX=9606 GN=IL6ST PE=1 SV=2
Length=918

 Score =  201 bits (512),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 51/237 (22%), Positives = 96/237 (41%), Gaps = 18/237 (8%)

Query  93   NYSCY-----RAGRPAGTVHLLVDVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
              +C      +  +    + ++  +PPE+P+ LSC        + CEW       L T  
Sbjct  100  QLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKK-MRCEWDGGRETHLETNF  158

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ  206
             L            F + C+  ++    SC +           V +   +++G   S   
Sbjct  159  TL----KSEWATHKFAD-CKAKRD-TPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHI  212

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
             F     ++P+PP N++V         L +TW +P     S   L++ ++YR + + T++
Sbjct  213  NFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWS  270

Query  267  TWMVKD---LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
                +D    +    + D      +V ++R  +E G+G WS+WS EA G  + +  S
Sbjct  271  QIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPS  327


> sp|P40190|IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus 
norvegicus OX=10116 GN=Il6st PE=1 SV=1
Length=918

 Score =  195 bits (496),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 69/335 (21%), Positives = 119/335 (36%), Gaps = 32/335 (10%)

Query  7    ALLAALLAAPGAALAPRRCPAQEVARGV-LTSLP----GDSVTLTCPGVE------PEDN  55
            AL   L+ A    L            G      P    G + T TC   E        + 
Sbjct  3    ALRIWLMQALLIFLTTESIGQLVEPCGYIYPEFPVVQRGSNFTATCVLKEKCLQVYSVNA  62

Query  56   ATVHWVLRKPAAGSHPSRWAG-MGRRLLLRSVQLHDSGNYSCY-----RAGRPAGTVHLL  109
              + W     A               +    V   +    +C      +  +    + +L
Sbjct  63   TYIVWKTNHVAVPKEQVTVINRTASSVTFTDVVFQNV-QLTCNILSFGQIEQNVYGITIL  121

Query  110  VDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYS  168
               PP+ P  LSC       N++C+  P     L T   L          E F + C+  
Sbjct  122  SGYPPDIPTNLSCIVNEG-KNMLCQLDPGRETYLETNYTL----KSEWATEKFPD-CRTK  175

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
                  SC +           V +   +++G+  S+   F     ++P PP N++VT   
Sbjct  176  H--GTSSCMMGYTPIYFVNIEVWVEAENALGNVSSEPINFDPVDKVKPSPPHNLSVTNSE  233

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSG  285
                 L + W +  S   S  RL+ +++YR + + T+    ++D    +    + D    
Sbjct  234  ELSSILKLAWVN--SGLDSILRLKSDIQYRTKDASTWIQVPLEDTVSPRTSFTVQDLKPF  291

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
              +V ++R+ +E G+G WS+WS EA GT + +  S
Sbjct  292  TEYVFRIRSIKENGKGYWSDWSEEASGTTYEDRPS  326


> sp|Q91513|PRLR_ORENI Prolactin receptor OS=Oreochromis niloticus 
OX=8128 GN=prlr PE=2 SV=1
Length=630

 Score =  190 bits (481),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 79/204 (39%), Gaps = 12/204 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             P +P     R        C W P S   L T   L  RK       D    C     + 
Sbjct  28   LPGKPTEIKCRSPEKETFTCWWKPGSDGGLPTTYALYYRK----EGSDVVHECPDYHTAG  83

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
            K SC            Y +++   +++G  +S  Q      I+QP PP  + VT V ++ 
Sbjct  84   KNSCFFNKNNTLIWVSYNITVVATNALGKTYSDPQDIDVVYIVQPHPPEKLEVT-VMKDQ  142

Query  232  RW--LSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
             W  L V+W+ P   ++   +  L +ELR + E  ++         Q    I    SG  
Sbjct  143  GWPFLRVSWEPPRKADTRSGWITLIYELRVKLEDEESEWENHAAGQQKMFNIFSLRSGGT  202

Query  288  HVVQLRAQEEFGQGEWSEWSPEAM  311
            +++Q+R +     G WSEWS  + 
Sbjct  203  YLIQVRCKP--DHGFWSEWSSTSY  224


> sp|Q14213|IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens 
OX=9606 GN=EBI3 PE=1 SV=2
Length=229

 Score =  155 bits (392),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 80/199 (40%), Gaps = 7/199 (4%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P++ C        V C W     P+ T+    +        A     PC   Q     SC
Sbjct  31   PRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPC-LQQTPTSTSC  89

Query  177  QLA-VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
             +  V     + Y++++      GS  S    F    I++PDPP  + ++ +A   R L 
Sbjct  90   TITDVQLFSMAPYVLNVTAVHPWGSSSSF-VPFITEHIIKPDPPEGVRLSPLAE--RQLQ  146

Query  236  VTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA  294
            V W+ P SW     + L++ +RY+ + +  F      +     ++       R+ VQ+ A
Sbjct  147  VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEA-TSFILRAVRPRARYYVQVAA  205

Query  295  QEEFGQGEWSEWSPEAMGT  313
            Q+    GE S+WS  A  T
Sbjct  206  QDLTDYGELSDWSLPATAT  224


> sp|Q8NI17|IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL31RA PE=1 SV=1
Length=732

 Score =  114 bits (286),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/266 (18%), Positives = 90/266 (34%), Gaps = 18/266 (7%)

Query  97   YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS  156
            +            +   P +P+          N+ C W P    S  T+  +   K   +
Sbjct  5    WALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETS-YTQYTV---KRTYA  60

Query  157  PAEDFQEPCQYSQESQKF--SCQLAVPE-GDSSFYIVSMCVASSVGSKFSKTQTFQGCGI  213
              E   + C  +  + +   SC   +P       Y + +   +  G   S    ++   I
Sbjct  61   FGEKH-DNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENI  119

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL  273
             + +PP    V  V    R + + W  P     S   L++ LR+R   S ++        
Sbjct  120  AKTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSS-DLKYTLRFRTVNSTSWMEVNFAKN  178

Query  274  QH----HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
            +        +        +V+ LR   +  +  WS+WS E MG    E+   P   E+  
Sbjct  179  RKDKNQTYNLTGLQPFTEYVIALRCAVKESK-FWSDWSQEKMGMTEEEA---PCGLELWR  234

Query  330  PMQA-LTTNKDDDNILFRDSANATSL  354
             ++      +    +L++ +  A  L
Sbjct  235  VLKPAEADGRRPVRLLWKKARGAPVL  260


> sp|Q9TU69|GHR_CANLF Growth hormone receptor OS=Canis lupus familiaris 
OX=9615 GN=GHR PE=2 SV=1
Length=638

 Score =  113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 40/205 (20%), Positives = 76/205 (37%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
            E+P+ +  R   L    C W       L     + +   + S  E  QE   C     + 
Sbjct  49   EKPKFTKCRSPELETFSCHWTDGVRHGLKNAGSVQLFYIRRSTQEWTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +      G+     + F    I+QPDPP        NI++
Sbjct  109  ENSCYFNSSYTSIWIPYCIKLTSN--GGTV--DQKCFSVEEIVQPDPPIGLNWTLLNISL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L++EL+Y+      +   M         ++  
Sbjct  165  TGIHAD---IQVRWEPPPNADVQKGWIVLKYELQYKEVNESQWKM-MDPVSATSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R+++      GE+SE
Sbjct  221  RLDKEYEVRVRSRQRNSEKYGEFSE  245


> sp|O35228|IL27B_MOUSE Interleukin-27 subunit beta OS=Mus musculus 
OX=10090 GN=Ebi3 PE=1 SV=1
Length=228

 Score =  107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/215 (21%), Positives = 83/215 (39%), Gaps = 10/215 (5%)

Query  97   YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS  156
            + +  P  T   LV +   +P++ C        V C W P   P+ T     +       
Sbjct  12   WASRSPGYTETALVAL--SQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGV  69

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSS-FYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
              +   +PC   +  Q   C +      S+  Y++++      G+  S    F    I++
Sbjct  70   ATQQQSQPC-LQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSL-LAFVAERIIK  127

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSW-NSSFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            PDPP  + +       + L V W  P SW     + L++ LRYR   +  F      +  
Sbjct  128  PDPPEGVRLRTAG---QRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEAT  184

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
                + ++    ++ +Q+ AQ+    G+ S+WS  
Sbjct  185  T-FTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLP  218


> sp|P16310|GHR_RAT Growth hormone receptor OS=Rattus norvegicus 
OX=10116 GN=Ghr PE=1 SV=1
Length=638

 Score =  112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 36/203 (18%), Positives = 70/203 (34%), Gaps = 15/203 (7%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
             +P+ +  R   L    C W      +L     + +   +    E   E   C     + 
Sbjct  49   GKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT----AV  227
              SC            Y + +     +       + F    I+QPDPP  +  T    ++
Sbjct  109  ANSCYFNSSYTSIWIPYCIKLTTNGDLL----DEKCFTVDEIVQPDPPIGLNWTLLNISL  164

Query  228  ARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
                  + V+WQ P S +    +  L +E++Y+      + T M         ++     
Sbjct  165  PGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKT-MSPIWSTSVPLYSLRLD  223

Query  286  LRHVVQLRAQEEFGQGEWSEWSP  308
              H V++R+++   +   SE+S 
Sbjct  224  KEHEVRVRSRQRSFEKY-SEFSE  245


> sp|P19941|GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus 
OX=9986 GN=GHR PE=1 SV=1
Length=638

 Score =  110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 38/205 (19%), Positives = 77/205 (38%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
             +P+ +  R   L    C W       L +   + +   + +  E  QE   C     + 
Sbjct  49   GKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +   ++ G      + F    I+QPDPP        N+++
Sbjct  109  ENSCYFNSSYTSIWIPYCIKLT--NNGGMV--DQKCFSVEEIVQPDPPIGLNWTLLNVSL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGIHAD---IQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKM-MDPVLSTSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R+++      GE+SE
Sbjct  221  RLDKEYEVRVRSRQRSSEKYGEFSE  245


> sp|Q95JF2|GHR_AILME Growth hormone receptor OS=Ailuropoda melanoleuca 
OX=9646 GN=GHR PE=2 SV=1
Length=638

 Score =  110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 39/207 (19%), Positives = 73/207 (35%), Gaps = 22/207 (11%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQE  170
            P  +PQ +  R   L    C W       +     + +   + S  E   E   C     
Sbjct  47   PSGKPQFTKCRSPELETFSCHWTEGVHHGVKNPGSIQLFYIRRSTQEWTPEWKECPDYVS  106

Query  171  SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANI  222
            + + SC            Y + +             + F    I+QPDPP        NI
Sbjct  107  AGENSCYFNSSYTSIWIPYCIKLTSNGD----TVDQKCFSVEEIVQPDPPIGLNWTLLNI  162

Query  223  TVTAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH  280
            ++T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++
Sbjct  163  SLTGIHAD---IQVRWEPPPNADVQKGWIVLEYELQYKEVNESQWKM-MDPVLSTSVPVY  218

Query  281  DAWSGLRHVVQLRAQEEFG--QGEWSE  305
                   + V++R+++      GE+SE
Sbjct  219  SLRLDKEYEVRVRSRQRNSEKYGEFSE  245


> sp|P19756|GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 
GN=GHR PE=1 SV=1
Length=638

 Score =  109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 40/205 (20%), Positives = 76/205 (37%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
             +P+ +  R   L    C W       L +   + +   + S  E  QE   C     + 
Sbjct  49   GKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +      G+     + F    I+QPDPP        NI++
Sbjct  109  ENSCYFNSSYTSIWIPYCIKLTSN--GGTV--DQKCFSVEEIVQPDPPIGLNWTLLNISL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGIHAD---IQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKM-MDPVLSTSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R+++      GE+SE
Sbjct  221  RLDKEYEVRVRSRQRNSEKYGEFSE  245


> sp|P16882|GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=10090 
GN=Ghr PE=1 SV=1
Length=650

 Score =  109 bits (271),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 71/211 (34%), Gaps = 23/211 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ----------EP  164
             +P+ +  R   L    C W     P L T   + +   +                  + 
Sbjct  49   GKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKE  108

Query  165  CQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
            C     + K SC            Y + +     +       + F    I+QPDPP  + 
Sbjct  109  CPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLL----DQKCFTVDEIVQPDPPIGLN  164

Query  224  VTAVA----RNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
             T +          + V+WQ P + +    +  L +E++Y+      +       L + C
Sbjct  165  WTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTY-C  223

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
             ++       H V++R+++   +   SE+S 
Sbjct  224  PVYSLRMDKEHEVRVRSRQRSFEKY-SEFSE  253


> sp|P48356|LEPR_MOUSE Leptin receptor OS=Mus musculus OX=10090 
GN=Lepr PE=1 SV=1
Length=1162

 Score =  108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 57/255 (22%), Positives = 96/255 (38%), Gaps = 32/255 (13%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
             +SC     L+ + C W P +  SL   + + +R  + S        C  S      S  
Sbjct  431  NISCETDGYLTKMTCRWSPSTIQSL-VGSTVQLRYHRRS------LYCPDSPSIHPTSEP  483

Query  178  LAV-------------PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV  224
                            P    S Y + + +  S+GS  S         +++P PP+N+  
Sbjct  484  KNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVKA  543

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQH---HCVIH  280
              +  N   L V+W+ P         L+F++RY     +  + T  V D +      ++ 
Sbjct  544  E-ITVNTGLLKVSWEKP--VFPE-NNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVS  599

Query  281  DAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD-  339
            D  +   +VVQ+R +   G G WS WS  A  T   + + P    E    M    T K+ 
Sbjct  600  DLCA--VYVVQVRCRRLDGLGYWSNWSSPAY-TLVMDVKVPMRGPEFWRKMDGDVTKKER  656

Query  340  DDNILFRDSANATSL  354
            +  +L++      SL
Sbjct  657  NVTLLWKPLTKNDSL  671


 Score = 76.0 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/215 (19%), Positives = 76/215 (35%), Gaps = 18/215 (8%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAV----LLVRKFQNSPAEDFQEPCQYSQESQKF  174
            + C+ K  L+  +C   P    +          LL    +              Q  Q  
Sbjct  129  IECWMKGDLTLFICHMEP-LPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDSFQTVQCN  187

Query  175  ------SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-TFQGCGILQPDPPANITVTAV  227
                   C + VP    ++ ++     +S G  F     + Q   +++PDPP  + +   
Sbjct  188  CSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPLGLHMEVT  247

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              +   L ++W    S   + + L+++++Y  E S               ++     G  
Sbjct  248  --DDGNLKISW---DSQTMAPFPLQYQVKY-LENSTIVREAAEIVSATSLLVDSVLPGSS  301

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
            + VQ+R++   G G WS+WS   + T       PP
Sbjct  302  YEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPP  336


> sp|Q90375|GHR_COLLI Growth hormone receptor OS=Columba livia 
OX=8932 GN=GHR PE=2 SV=1
Length=611

 Score =  107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 35/198 (18%), Positives = 73/198 (37%), Gaps = 16/198 (8%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            PQ+S  R   L    C W   +  +L+    + +   + +  +   + C     + + SC
Sbjct  29   PQISKCRSPELETFSCYWTDGNFYNLSAPGTIQLLYMKRNDEDW--KECPDYITAGENSC  86

Query  177  QLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
                        Y V +     V       + F    I+ PDPP ++  T +  +   + 
Sbjct  87   YFNTSYTSIWIPYCVKLVNKDEVF----DEKCFSVDEIVLPDPPVHLNWTLLNTSQTGIH  142

Query  236  ----VTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                V W  P + +    +  L +EL+Y+      +       L     ++    G  + 
Sbjct  143  GDIQVRWDPPPTADVQKGWITLEYELQYKEVNETKWKELEP-RLSTMVPLYSLKIGRDYE  201

Query  290  VQLRAQEEFGQ--GEWSE  305
            +++R+++   +  GE+SE
Sbjct  202  IRVRSRQRTSEKFGEFSE  219


> sp|Q02092|GHR_CHICK Growth hormone receptor OS=Gallus gallus 
OX=9031 GN=GHR PE=1 SV=1
Length=608

 Score =  107 bits (266),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 37/198 (19%), Positives = 72/198 (36%), Gaps = 19/198 (10%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            PQ+S  R   L    C W       +TT   + +   + S  +   + C     + + SC
Sbjct  29   PQISKCRSPELETFSCYWT---DGKVTTSGTIQLLYMKRSDEDW--KECPDYITAGENSC  83

Query  177  QLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
                        Y V +     V       + F    I+ PDPP ++  T +  +   + 
Sbjct  84   YFNTSYTSIWIPYCVKLANKDEVF----DEKCFSVDEIVLPDPPVHLNWTLLNTSQTGIH  139

Query  236  ----VTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                V W  P + +    +  L +EL+Y+      +       L     ++    G  + 
Sbjct  140  GDIQVRWDPPPTADVQKGWITLEYELQYKEVNETKWKELEP-RLSTVVPLYSLKMGRDYE  198

Query  290  VQLRAQEEFGQ--GEWSE  305
            +++R+++   +  GE+SE
Sbjct  199  IRVRSRQRTSEKFGEFSE  216


> sp|Q62959|LEPR_RAT Leptin receptor OS=Rattus norvegicus OX=10116 
GN=Lepr PE=1 SV=1
Length=1162

 Score =  106 bits (265),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 92/242 (38%), Gaps = 20/242 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYS-------QE  170
             +SC     L+ + C W P +  SL    V L    ++    D       S       Q 
Sbjct  431  NISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDNPSIRPTSELKNCVLQT  490

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
               + C    P    S Y + + +  S+GS  S         +++P PP+N+    +  N
Sbjct  491  DGFYECVFQ-PIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVKAE-ITIN  548

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCV---IHDAWSGL  286
               L V+W+ P         L+F++RY     +  + T  V D +       + D  +  
Sbjct  549  TGLLKVSWEKP--VFPE-NNLQFQIRYGLNGKEIQWKTHEVFDAKSKSASLPVSDLCA--  603

Query  287  RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVS-TPMQALTTNKDDDNILF  345
             +VVQ+R +   G G WS WS  A  T   + + P    E        +T  + +  +L+
Sbjct  604  VYVVQVRCRRLDGLGYWSNWSSPAY-TLVMDVKVPMRGPEFWRIMDGDITKKERNVTLLW  662

Query  346  RD  347
            + 
Sbjct  663  KP  664


 Score = 77.2 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/215 (19%), Positives = 76/215 (35%), Gaps = 18/215 (8%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAV----LLVRKFQNSPAEDFQEPCQYSQESQKF  174
            + C+ K  L+  +C   P    +          LL    +              Q  Q  
Sbjct  129  IECWMKGDLTLFICHMEP-LLKNPFKNYDSKVHLLYDLPEVIDDLPLPPLKDSFQTVQCN  187

Query  175  ------SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-TFQGCGILQPDPPANITVTAV  227
                   C + VP    ++ ++     +S G  F     + Q   +++PDPP  + +   
Sbjct  188  CSVRECECHVPVPRAKVNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPLGLRMEVT  247

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              +   L ++W    S   + + L+++++Y  E S               ++     G  
Sbjct  248  --DDGNLKISW---DSQTKAPFPLQYQVKY-LENSTIVREAAEIVSDTSLLVDSVLPGSS  301

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
            + VQ+R++   G G WS+WS   + T       PP
Sbjct  302  YEVQVRSKRLDGSGVWSDWSLPQLFTTQDVMYFPP  336


> sp|P40223|CSF3R_MOUSE Granulocyte colony-stimulating factor receptor 
OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
Length=837

 Score =  105 bits (262),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 60/366 (16%), Positives = 116/366 (32%), Gaps = 31/366 (8%)

Query  5    GCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTC----PGVEPEDNATVHW  60
             C L    L       +   C   E++  V+    GD V  +C       + +  A + W
Sbjct  6    ACTLTGVTLIFLLLPRSLESCGHIEISPPVV--RLGDPVLASCTISPNCSKLDQQAKILW  63

Query  61   VLRK----PAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGR----PAGTVHLLVDV  112
             L+     P    H          + L  +    +    C               L    
Sbjct  64   RLQDEPIQPGDRQHHLPDGTQESLITLPHLNYTQA-FLFCLVPWEDSVQLLDQAELHAGY  122

Query  113  PPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            PP  P  LSC      +++VC+W P     L T  +L       +  +   +        
Sbjct  123  PPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILK-SFRSRADCQYQGDTIPDCVAK  181

Query  172  QK-FSCQLAVPEGDSSFYI-VSMCVASSVGSKFSKTQTFQGCGILQPDPP--ANITVTA-  226
            ++  +C +         Y+ + +   + +GS  S         +++ +PP    + +   
Sbjct  182  KRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGPD  241

Query  227  -VARNPRWLSVTWQDPHSWNSSFYRLRFE-LRYRAE-RSKTFTTWMVKDLQH-HCVIHDA  282
             V+  P  L ++W+    W  S Y  +   LRY+ + +   +T             +   
Sbjct  242  VVSHQPGCLWLSWKP---WKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGL  298

Query  283  WSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDN  342
                 + +Q+R       G WS WSP     P    ++P    +     + L        
Sbjct  299  HQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM--KAPTIRLDTWCQKKQLDPGTVSVQ  356

Query  343  ILFRDS  348
            + ++ +
Sbjct  357  LFWKPT  362


> sp|Q95ML5|GHR_SAIBB Growth hormone receptor OS=Saimiri boliviensis 
boliviensis OX=39432 GN=GHR PE=2 SV=1
Length=632

 Score =  103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 73/205 (36%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKA--VLLVRKFQNSPAEDFQEPCQYSQESQ  172
            +EP+ +  R   L    C W       L +     L   +          + C     + 
Sbjct  49   KEPKFTKCRSPELETFSCRWTDAVHHGLKSPGPIQLFYTRRNTQEGTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +      G+     + F    I+QPDPP        NI++
Sbjct  109  ENSCYFNSSFTSIWIPYCIKLTSN--GGTV--DEKCFSVDQIVQPDPPIALNWTLLNISL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T V  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGVHAD---IQVRWEAPPNADIQKGWMVLEYELQYKEVNETQWKM-MDPILSTSVPLYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R+++      GE+SE
Sbjct  221  RVDKEYEVRVRSRQRKSENYGEFSE  245


> sp|Q8K5B1|IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il31ra PE=1 SV=3
Length=716

 Score =  102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 86/246 (35%), Gaps = 17/246 (7%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
            + V P +P+          N+ C W P    + T+  V L   +  S   D      YS 
Sbjct  17   LAVLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNATEASYSF  76

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                 SC +           V +   +  G   S    +    I + +PP  ++V  +  
Sbjct  77   ---PRSCAMPPDICS-----VEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSVNPICN  128

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
              R   + W+      +  + L   LR+R   S  +T    ++ +  C +    +   +V
Sbjct  129  --RMFQIQWKPRE--KTRGFPLVCMLRFRTVNSSHWTEVNFENCKQVCNLTGLQAFTEYV  184

Query  290  VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD-DDNILFRDS  348
            + LR +       WS+WS E       E    P   ++   ++    N D    +L++ +
Sbjct  185  LALRFR-FNDSRYWSKWSKEETRVTMEE---VPHVLDLWRILEPADMNGDRKVRLLWKKA  240

Query  349  ANATSL  354
              A  L
Sbjct  241  RGAPVL  246


> sp|P79108|GHR_BOSIN Growth hormone receptor OS=Bos indicus OX=9915 
GN=GHR PE=2 SV=1
Length=634

 Score =  102 bits (254),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 67/198 (34%), Gaps = 16/198 (8%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P+ +  R   L    C W   +  SL +   + +   +    E   + C     + + SC
Sbjct  51   PKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEW--KECPDYVSAGENSC  108

Query  177  QLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
                      + Y + +     +       + F    I+QPDPP  +  T +  +   + 
Sbjct  109  YFNSSYTSVWTPYCIKLTSNGGI----VDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIH  164

Query  236  ----VTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                V W+ P        +  L +EL Y+      +       +     ++       + 
Sbjct  165  ADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMV-TSVPMYSLRLDKEYE  223

Query  290  VQLRAQEEF--GQGEWSE  305
            V++R ++      G++SE
Sbjct  224  VRVRTRQRNTEKYGKFSE  241


> sp|O46600|GHR_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 
GN=GHR PE=2 SV=2
Length=634

 Score =  102 bits (253),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 67/198 (34%), Gaps = 16/198 (8%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P+ +  R   L    C W   +  SL +   + +   +    E   + C     + + SC
Sbjct  51   PKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEW--KECPDYVSAGENSC  108

Query  177  QLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
                      + Y + +     +       + F    I+QPDPP  +  T +  +   + 
Sbjct  109  YFNSSYTSVWTPYCIKLTSNGGI----VDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIH  164

Query  236  ----VTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                V W+ P        +  L +EL Y+      +       +     ++       + 
Sbjct  165  ADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMV-TSVPMYSLRLDKEYE  223

Query  290  VQLRAQEEF--GQGEWSE  305
            V++R ++      G++SE
Sbjct  224  VRVRTRQRNTEKYGKFSE  241


> sp|Q9JI97|GHR_CAVPO Growth hormone receptor OS=Cavia porcellus 
OX=10141 GN=GHR PE=2 SV=1
Length=628

 Score =  100 bits (248),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 35/200 (18%), Positives = 66/200 (33%), Gaps = 16/200 (8%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLL--VRKFQNSPAEDFQEPCQYSQESQKF  174
            P+ +  R   L    C W       L +   +     K  +       + C     + + 
Sbjct  51   PKFTKCRSPELETFSCHWTDEGHHGLKSTGFIQMFYTKRNSQEQNQEWKECPDYVSAGEN  110

Query  175  SCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
            SC            Y V +      G      + F    I+QPDPP  +  T +  +   
Sbjct  111  SCYFNSSYTSIWKPYCVKLTSN--GGKV--DEKCFYVEEIVQPDPPTGLNWTLMNTSATA  166

Query  234  ----LSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
                + V W+ P S +    +  L +EL+ +      +   M         ++       
Sbjct  167  IYGDIQVRWKPPRSADVKKGWIMLDYELQIKQTNETQWKM-MDPVTSTSVPLYSLRLDKE  225

Query  288  HVVQLRAQEEFG--QGEWSE  305
            + V++R++ +     GE+SE
Sbjct  226  YEVRIRSRLQNSDKYGEFSE  245


> sp|Q5VWK5|IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens 
OX=9606 GN=IL23R PE=1 SV=3
Length=629

 Score =  100 bits (248),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 50/298 (17%), Positives = 95/298 (32%), Gaps = 24/298 (8%)

Query  29   EVARGVLTSLPGDSVTLTCPGVEPE-DNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQ  87
             V    +  + G ++++ C           +H+           +R      RL  ++  
Sbjct  35   WVEPATIFKM-GMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFL  93

Query  88   LHDSGNYS---C--YRAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPS  141
               +  Y    C  +          +    PP+ P +++C       N+ C W       
Sbjct  94   EPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTY  153

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
            + TK V+ V+  +    E+ Q            S Q          Y+V +  A+++G +
Sbjct  154  IDTKYVVHVKSLET--EEEQQYLTSSYINISTDSLQGGKK------YLVWVQAANALGME  205

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
             SK        I+ P          +        + W    +       +  E+RY+A  
Sbjct  206  ESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEK----VSCEMRYKATT  261

Query  262  SKTFTTWMVKDLQH--HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE-AMGTPWT  316
            ++T+                      +++V Q+R Q E G+  W  WS      TP T
Sbjct  262  NQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQ-ETGKRYWQPWSSLFFHKTPET  318


> sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like 
protein 1 homolog OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 
SV=2
Length=2053

 Score =  100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/265 (20%), Positives = 95/265 (36%), Gaps = 27/265 (10%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS----RWAGMGRRLLLRSVQLHDSGNYSC  96
               V L C  V  +    V W      +    S    R       LLLR+V+  DSG Y+C
Sbjct  1305  KDVRLPCNSVG-DPAPAVKWTKDSEDSAIPVSLDGHRLIHTNGTLLLRAVKAEDSGYYTC  1363

Query  97    Y---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     V+LLV VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1364  TATNTGGFDTIIVNLLVQVPPDQPRLT-VSKTSASSITLTWIPGDNGGSSIRGFVLQYSV  1422

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS    + F    + S +     C         ++Y V +   +SVGS           
Sbjct  1423  DNSEEWKDVFISSSERSFKLDSLKC--------GTWYKVKLAAKNSVGSGRISEIIEAKT  1474

Query  212   GILQPDPPANITV-TAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWM  269
                +P    +  + T +      L++       WN+    +    L YR + +  +    
Sbjct  1475  HGREPSFSKDQHLFTHINSTHARLNLQ-----GWNNGGCPITAIVLEYRPKGTWAWQGVR  1529

Query  270   VKDLQHHCVIHDAWSGLRHVVQLRA  294
               +      + +      + +++RA
Sbjct  1530  A-NSSTEVFLTELREATWYELRMRA  1553


 Score = 63.3 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 88/257 (34%), Gaps = 20/257 (8%)

Query  79    RRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
               L L+     DS  +SC+     G   G + L V  PP+ P+L   R+    ++   W 
Sbjct  850   STLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELE-IREVKARSMNLRWT  908

Query  136   PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
              R   + +      +     S + DF +    +         +      +S Y + M   
Sbjct  909   QRFDGN-SIITGFDIEYKNKSDSWDF-KQSTRNISPTINQANIVDLH-PASVYSIRMYSF  965

Query  196   SSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
             + +G      +         PD PP ++T+  V    + + VTW+ P     +     ++
Sbjct  966   NKIGRSEPSKELTISTEEAAPDGPPMDVTLQPV--TSQSIQVTWKAPKKELQNGVIRGYQ  1023

Query  255   LRYRAERSKTFT------TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
             + YR E S                      + +     ++ V ++A    G G  S  S 
Sbjct  1024  IGYR-ENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGP-S--SS  1079

Query  309   EAMGTPWTESRSPPAEN  325
             E   T   +  S P EN
Sbjct  1080  EINATTLEDVPSQPPEN  1096


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 48/127 (38%), Gaps = 10/127 (8%)

Query  179   AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTW  238
             AV   DS +Y  +    ++ G     T        + PD P    +T    +   +++TW
Sbjct  1352  AVKAEDSGYY--TCTATNTGGF---DTIIVNLLVQVPPDQP---RLTVSKTSASSITLTW  1403

Query  239   QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
                 +  SS     F L+Y  + S+ +    +   +    +     G  + V+L A+   
Sbjct  1404  IPGDNGGSSIRG--FVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSV  1461

Query  299   GQGEWSE  305
             G G  SE
Sbjct  1462  GSGRISE  1468


 Score = 42.9 bits (99),  Expect = 0.007, Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 80/270 (30%), Gaps = 27/270 (10%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLT-----SLPGDSVTLTCPGVEPEDNATVHWVLR  63
            L ++L  P  +++     A +V   +       +  G  + + C     +    + W   
Sbjct  574  LCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKD  633

Query  64   KPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNYSCYRAGRPAGTVH---LLVDVPPE--  115
                 S              L + SV L  +GNY+C  +   A       L+V VPP   
Sbjct  634  GQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFV  693

Query  116  -EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
             +P            + C            K +    K   +P +    P     +    
Sbjct  694  VQPNNQDGIYGKAGVLNCS----VDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPN  749

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSKFSK--TQTFQGCGILQPDPPANITVTAVARN--  230
            S  L     +          ++ VG+  SK    T +   ++   P   I +    +   
Sbjct  750  SSLLIRHVLEEDIGYYLCQASNGVGTDISKAMFLTVKIPAMITSHPNTTIAIKGHPKELN  809

Query  231  -----PRWLSVTWQDPHSWNSSFYRLRFEL  255
                  R + + W+   +       +R+ +
Sbjct  810  CTARGERPIIIRWEKGDTVIDPDRVMRYAI  839


> sp|Q99062|CSF3R_HUMAN Granulocyte colony-stimulating factor receptor 
OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
Length=836

 Score =  100 bits (248),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 53/327 (16%), Positives = 102/327 (31%), Gaps = 26/327 (8%)

Query  40   GDSVTLTC----PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRR---LLLRSVQLHDSG  92
            GD +T +C         +    + W L          +    G +   + L  +    + 
Sbjct  39   GDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAF  98

Query  93   NYSCYRAG---RPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVL  148
               C   G   +    V L    PP  P  LSC      S+++C+W P     L T   L
Sbjct  99   LSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTL  158

Query  149  -LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
               +   N   +         ++ Q   C             + +   +++G+  S    
Sbjct  159  KSFKSRGNCQTQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLC  218

Query  208  FQGCGILQPDPPANITVTAV----ARNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAER-  261
                 +++ +PP   T+             L + W+    W        + ELR++ +R 
Sbjct  219  LDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEP---WQPGLHINQKCELRHKPQRG  275

Query  262  SKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
              ++       L+     +        + +Q+R       G WS+WSP       T  R+
Sbjct  276  EASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSP--SLELRTTERA  333

Query  321  PPAENEVSTPMQALTTNKDDDNILFRD  347
            P    +     Q     +    + ++ 
Sbjct  334  PTVRLDTWW-RQRQLDPRT-VQLFWKP  358


 Score = 43.6 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 61/227 (27%), Gaps = 32/227 (14%)

Query  34   VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-----GMGRRLLLRSVQL  88
                 PG  +   C            W L  P                    L +R ++ 
Sbjct  253  WEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRW  312

Query  89   HDSGNYSCYRAGRPAGTV----HLLVDVPPEEPQLSCFRKSPLSNVVCEWGP---RSTPS  141
               G++S +       T      + +D    + QL          V   W P        
Sbjct  313  PLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQL------DPRTVQLFWKPVPLEEDSG  366

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
                 V+  R                   + + SC   +P        V++   +S G+ 
Sbjct  367  RIQGYVVSWR-PSGQAGAILPL-----CNTTELSCTFHLPSEAQE---VALVAYNSAGTS  417

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
                  F          PA   + A+AR+P  L V W+ P+ W   +
Sbjct  418  RPTPVVFSESR-----GPALTRLHAMARDPHSLWVGWEPPNPWPQGY  459


> sp|P10912|GHR_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 
GN=GHR PE=1 SV=1
Length=638

 Score = 99.5 bits (246),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 74/205 (36%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
            +EP+ +  R        C W             + +   + +  E  QE   C     + 
Sbjct  49   KEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +      G+     + F    I+QPDPP        N+++
Sbjct  109  ENSCYFNSSFTSIWIPYCIKLTSN--GGTV--DEKCFSVDEIVQPDPPIALNWTLLNVSL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGIHAD---IQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKM-MDPILTTSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R+++      GE+SE
Sbjct  221  KVDKEYEVRVRSKQRNSGNYGEFSE  245


> sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like 
protein 1 OS=Homo sapiens OX=9606 GN=DSCAML1 PE=1 SV=2
Length=2053

 Score = 99.5 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/265 (20%), Positives = 95/265 (36%), Gaps = 27/265 (10%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS----RWAGMGRRLLLRSVQLHDSGNYSC  96
               V L C  V  +    V W      +    S    R       LLLR+V+  DSG Y+C
Sbjct  1305  KDVRLPCNSVG-DPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTC  1363

Query  97    Y---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     V+LLV VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1364  TATNTGGFDTIIVNLLVQVPPDQPRLT-VSKTSASSITLTWIPGDNGGSSIRGFVLQYSV  1422

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS    + F    + S +     C         ++Y V +   +SVGS           
Sbjct  1423  DNSEEWKDVFISSSERSFKLDSLKC--------GTWYKVKLAAKNSVGSGRISEIIEAKT  1474

Query  212   GILQPDPPANITV-TAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWM  269
                +P    +  + T +      L++       WN+    +    L YR + +  +    
Sbjct  1475  HGREPSFSKDQHLFTHINSTHARLNLQ-----GWNNGGCPITAIVLEYRPKGTWAWQGLR  1529

Query  270   VKDLQHHCVIHDAWSGLRHVVQLRA  294
               +      + +      + +++RA
Sbjct  1530  A-NSSGEVFLTELREATWYELRMRA  1553


 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 88/257 (34%), Gaps = 20/257 (8%)

Query  79    RRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
               L L+     DS  +SC+     G   G + L V  PP+ P+L   R+    ++   W 
Sbjct  850   STLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELE-IREVKARSMNLRWT  908

Query  136   PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
              R   + +      +     S + DF +    +         +      +S Y + M   
Sbjct  909   QRFDGN-SIITGFDIEYKNKSDSWDF-KQSTRNISPTINQANIVDLH-PASVYSIRMYSF  965

Query  196   SSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
             + +G      +         PD PP ++T+  V    + + VTW+ P     +     ++
Sbjct  966   NKIGRSEPSKELTISTEEAAPDGPPMDVTLQPV--TSQSIQVTWKAPKKELQNGVIRGYQ  1023

Query  255   LRYRAERSKTFT------TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
             + YR E S                      + +     ++ V ++A    G G  S  S 
Sbjct  1024  IGYR-ENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGP-S--SS  1079

Query  309   EAMGTPWTESRSPPAEN  325
             E   T   +  S P EN
Sbjct  1080  EINATTLEDVPSQPPEN  1096


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 48/127 (38%), Gaps = 10/127 (8%)

Query  179   AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTW  238
             AV   DS +Y  +    ++ G     T        + PD P    +T    +   +++TW
Sbjct  1352  AVKAEDSGYY--TCTATNTGGF---DTIIVNLLVQVPPDQP---RLTVSKTSASSITLTW  1403

Query  239   QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
                 +  SS     F L+Y  + S+ +    +   +    +     G  + V+L A+   
Sbjct  1404  IPGDNGGSSIRG--FVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSV  1461

Query  299   GQGEWSE  305
             G G  SE
Sbjct  1462  GSGRISE  1468


 Score = 43.6 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 42/270 (16%), Positives = 80/270 (30%), Gaps = 27/270 (10%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLT-----SLPGDSVTLTCPGVEPEDNATVHWVLR  63
            L ++L  P  +++     A +V   +       +  G  + + C     +    + W   
Sbjct  574  LCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKD  633

Query  64   KPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNYSCYRAGRPAGTVH---LLVDVPPE--  115
                 S              L + SV L  +GNY+C  +   A       L+V VPP   
Sbjct  634  GQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFV  693

Query  116  -EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
             +P            + C            K +    K   +P +    P     +    
Sbjct  694  VQPNNQDGIYGKAGVLNCS----VDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPN  749

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVT-------  225
            S  L     +          ++ VG+    S   T +   ++   P   I +        
Sbjct  750  SSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELN  809

Query  226  AVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              AR  R + + W+   +       +R+ +
Sbjct  810  CTARGERPIIIRWEKGDTVIDPDRVMRYAI  839


 Score = 39.0 bits (89),  Expect = 0.10, Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 56/178 (31%), Gaps = 31/178 (17%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---  96
            G +V L C          + W+       +  SRW      L +  ++  DSG Y C   
Sbjct  240  GHTVELPC-TASGYPIPAIRWLKDGRPLPAD-SRWTKRITGLTISDLRTEDSGTYICEVT  297

Query  97   ------YRAGRPAGTVHLLVDVPPEEPQ--------LSCFRKSPLSNVVCEWGPRSTPSL  142
                     G       L V + P++ +        LSC            W   +   L
Sbjct  298  NTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPE-FTIRWYRNTELVL  356

Query  143  T---------TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS  191
                      +   LL+   Q S +  +Q  C  ++++Q       +   D +  IVS
Sbjct  357  PDEAISIRGLSNETLLITSAQKSHSGAYQ--CFATRKAQTAQDFAIIALEDGTPRIVS  412


> sp|Q9XSZ1|GHR_PAPAN Growth hormone receptor OS=Papio anubis OX=9555 
GN=GHR PE=2 SV=1
Length=638

 Score = 98.7 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 36/205 (18%), Positives = 72/205 (35%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE--PCQYSQESQ  172
            +EP+ +  R        C W         +   + +   + +  E  QE   C     + 
Sbjct  49   KEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQEWTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +             + F    I+QPDPP        N+++
Sbjct  109  ENSCYFNSSFTSVWIPYCIKLTSNGD----TVDGKCFSVDEIVQPDPPIALNWTLLNVSL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGIHAD---IQVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKM-MDPILSTSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V++R++       GE+SE
Sbjct  221  KVDKEYEVRVRSKRRNSGNYGEFSE  245


> sp|Q28575|GHR_SHEEP Growth hormone receptor OS=Ovis aries OX=9940 
GN=GHR PE=2 SV=1
Length=634

 Score = 98.7 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 33/197 (17%), Positives = 67/197 (34%), Gaps = 16/197 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
            + +  R   L    C W   +  SL +   + +   +    E   + C     + + SC 
Sbjct  52   KFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEW--KECPDYVSAGENSCY  109

Query  178  LAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS-  235
                     + Y + +     +       + F    I+QPDPP  +  T +  +   +  
Sbjct  110  FNSSYTSVWTPYCIKLTSNGGI----VDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHA  165

Query  236  ---VTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
               V W+ P        +  L +EL Y+      +   M   L     ++       + V
Sbjct  166  DILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKM-MDPLLVTSVPMYSLRLDKEYEV  224

Query  291  QLRAQEEF--GQGEWSE  305
            ++R ++      G++SE
Sbjct  225  RVRTRQRNTEKYGKFSE  241


> sp|O02671|LEPR_PIG Leptin receptor OS=Sus scrofa OX=9823 GN=LEPR 
PE=2 SV=3
Length=1165

 Score = 97.6 bits (241),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 91/242 (38%), Gaps = 20/242 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS-----PAEDFQEPCQYSQESQ  172
             +SC     L+ + C W   +  SL   + L +R  ++S                  + Q
Sbjct  433  NISCETDGYLTKMTCRWSTNAIQSL-VGSTLQLRYHRSSLYCSDVPSVHPISEPKDCQLQ  491

Query  173  KFSCQLAV--PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
            +      +  P    S Y + + +   +GS  S         +++P PP+++    +   
Sbjct  492  RDGFYECIFQPIFLLSGYTMWIRINHPLGSLDSPPTCVIPDSVVKPLPPSSVKAE-ITAK  550

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQ---HHCVIHDAWSGL  286
               L ++W+ P         L+F++RY     +  +  + V D +       + D  +  
Sbjct  551  IGLLKISWEKP--VFPE-NNLQFQIRYGLSGKEVQWKIYEVYDTKLKSTSLPVPDLCA--  605

Query  287  RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVS-TPMQALTTNKDDDNILF  345
             + VQ+R +   G G WS WS  A  T  T+ + P    E      +  T  + +  +L+
Sbjct  606  VYAVQVRCKRLDGLGYWSNWSTPAY-TVVTDVKVPIRGPEFWRIINEDATKKERNITLLW  664

Query  346  RD  347
            + 
Sbjct  665  KP  666


 Score = 80.6 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/221 (19%), Positives = 77/221 (35%), Gaps = 26/221 (12%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR-----------KFQNSPAEDFQEPCQ  166
             + C+ K  L   +C +      +      L V                     FQ    
Sbjct  128  NIQCWMKEDLKLFIC-YMESLFKNPFKNYDLKVHLLYVLLEVLEGSPLLPQKGSFQSVQC  186

Query  167  YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-TFQGCGILQPDPPANITVT  225
                 +   C + V     ++ ++     +S G+ F     + Q   +++PDPP  + + 
Sbjct  187  NCSARECCECHVPVSAAKLNYTLLMYLKITSGGAVFHSPLMSVQPINVVKPDPPLGLHME  246

Query  226  AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ----HHCVIHD  281
                +   L ++W  P         + F+L+Y+ + S+  TT M +  +       ++  
Sbjct  247  IT--DTGNLKISWSSPT-------LVPFQLQYQVKYSENSTTNMREADEIVSDTSLLVDS  297

Query  282  AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
               G  + VQ+R +   G G WS+WS     T       PP
Sbjct  298  VLPGSSYEVQVRGKRLDGPGIWSDWSTPFTFTTQDVIYFPP  338


> sp|P48357|LEPR_HUMAN Leptin receptor OS=Homo sapiens OX=9606 
GN=LEPR PE=1 SV=2
Length=1165

 Score = 96.4 bits (238),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 50/241 (21%), Positives = 92/241 (38%), Gaps = 18/241 (7%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ------EPCQYSQES  171
             +SC     L+ + C W   +  SL    + L     +    D        EP     +S
Sbjct  433  NISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQS  492

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              F   +  P    S Y + + +  S+GS  S         +++P PP+++    +  N 
Sbjct  493  DGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAE-ITINI  551

Query  232  RWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCV---IHDAWSGLR  287
              L ++W+ P         L+F++RY     +  +  + V D +   V   + D  +   
Sbjct  552  GLLKISWEKP--VFPE-NNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCA--V  606

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT-TNKDDDNILFR  346
            + VQ+R +   G G WS WS  A  T   + + P    E    +   T   + +  +L++
Sbjct  607  YAVQVRCKRLDGLGYWSNWSNPAY-TVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWK  665

Query  347  D  347
             
Sbjct  666  P  666


 Score = 79.9 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/281 (15%), Positives = 86/281 (31%), Gaps = 42/281 (15%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR-----------KFQNSPAEDFQEPCQ  166
             + C+ K  L   +C +      +L       V                     FQ    
Sbjct  128  NIQCWLKGDLKLFIC-YVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGSFQMVHC  186

Query  167  YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-TFQGCGILQPDPPANITVT  225
                 +   C + VP    +  ++     +S G  F     + Q   +++PDPP  + + 
Sbjct  187  NCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPPLGLHME  246

Query  226  AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
                +   L ++W  P       + L+++++Y    +               ++     G
Sbjct  247  IT--DDGNLKISWSSPPLVP---FPLQYQVKYSENSTTVIREADKIVSATSLLVDSILPG  301

Query  286  LRHVVQLRAQEEFGQGEWSEWS-PEAMGTP-----------------------WTESRSP  321
              + VQ+R +   G G WS+WS P    T                          E++  
Sbjct  302  SSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKIV  361

Query  322  PAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSV  362
            P++  V     A    +   +++    +  T   + ++   
Sbjct  362  PSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPR  402


> sp|P79194|GHR_MACMU Growth hormone receptor OS=Macaca mulatta 
OX=9544 GN=GHR PE=2 SV=1
Length=638

 Score = 93.7 bits (231),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 34/205 (17%), Positives = 67/205 (33%), Gaps = 22/205 (11%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTT--KAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            +EP+ +  R        C W         +     L   +          + C     + 
Sbjct  49   KEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAG  108

Query  173  KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP-------ANITV  224
            + SC            Y + +             + F    I+QPDPP        N+++
Sbjct  109  ENSCYFNSSFTSVWIPYCIKLTSNGD----TVDGKCFSVDEIVQPDPPIALNWTLLNVSL  164

Query  225  TAVARNPRWLSVTWQDPHSWN--SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
            T +  +   + V W+ P + +    +  L +EL+Y+      +   M   L     ++  
Sbjct  165  TGIHAD---ILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKM-MDPILSTSVPVYSL  220

Query  283  WSGLRHVVQLRAQEEFG--QGEWSE  305
                 + V +R++       GE+SE
Sbjct  221  KVDKEYEVLVRSKRRNSRNYGEFSE  245


> sp|E1C8P7|DSCL1_CHICK Down syndrome cell adhesion molecule-like 
protein 1 homolog OS=Gallus gallus OX=9031 GN=DSCAML1 PE=1 
SV=2
Length=2042

 Score = 93.3 bits (230),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/265 (19%), Positives = 97/265 (37%), Gaps = 27/265 (10%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS----RWAGMGRRLLLRSVQLHDSGNYSC  96
               V L C  V  E    + W      +    +    R       L+LRSV+  DSG Y+C
Sbjct  1306  KDVRLPCNSVG-EPVPAIKWTKDSEDSAIPVTVDGHRLIQANGTLVLRSVKAEDSGYYTC  1364

Query  97    YRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     ++LLV VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1365  TATNTWGFDTIIINLLVQVPPDQPRLT-VSKTSASSITLAWIPGDNGGSSIRGFVLQYSV  1423

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS    + F    + S + +   C         ++Y V +   +SVG+           
Sbjct  1424  DNSEEWKDVFISSSERSFKLESLKC--------GTWYKVKLAAKNSVGAGRISEIIEAKT  1475

Query  212   GILQPDPPANITV-TAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWM  269
                +P    +  + T +      L++       W+S    +    L YR + +  + +  
Sbjct  1476  HGREPSFSKDQHLFTHINSTHARLNLQ-----GWSSGGCPITAIVLEYRPKGNWGWQSLR  1530

Query  270   VKDLQHHCVIHDAWSGLRHVVQLRA  294
               +      + +      + ++++A
Sbjct  1531  -TNSSGEVFLTELREATWYELRMKA  1554


 Score = 62.9 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 49/259 (19%), Positives = 89/259 (34%), Gaps = 20/259 (8%)

Query  77    MGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCE  133
             +   L L+     DS  +SC+     G   G + L V  PP+ P+L   R+    ++   
Sbjct  849   VISTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELE-IREVKARSMNLR  907

Query  134   WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
             W  R   + +      +     S + DF +    +         +      +S Y + M 
Sbjct  908   WTQRFDGN-SIITGFDIEYKNKSDSWDF-KQSTRNISPTINQANIVDLH-PASVYSIRMY  964

Query  194   VASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
               + +G      +         PD PP ++T+  +    + + VTW+ P     +     
Sbjct  965   SFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPM--TSQSIQVTWKAPKKELQNGVIRG  1022

Query  253   FELRYRAERSKTFT------TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
             +++ YR E S                      + +     ++ V ++A    G G  S  
Sbjct  1023  YQIGYR-ENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGP-S--  1078

Query  307   SPEAMGTPWTESRSPPAEN  325
             S E   T   +  S P EN
Sbjct  1079  SSEINATTLEDVPSQPPEN  1097


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/113 (19%), Positives = 40/113 (35%), Gaps = 8/113 (7%)

Query  193   CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                ++ G     T        + PD P    +T    +   +++ W    +  SS     
Sbjct  1365  TATNTWGF---DTIIINLLVQVPPDQP---RLTVSKTSASSITLAWIPGDNGGSSIRG--  1416

Query  253   FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             F L+Y  + S+ +    +   +    +     G  + V+L A+   G G  SE
Sbjct  1417  FVLQYSVDNSEEWKDVFISSSERSFKLESLKCGTWYKVKLAAKNSVGAGRISE  1469


 Score = 43.3 bits (100),  Expect = 0.006, Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 77/270 (29%), Gaps = 27/270 (10%)

Query  9    LAALLAAPGAAL-----APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR  63
            L ++L  P  ++        + P          +  G  + + C     +    + W   
Sbjct  575  LCSVLIQPQLSISQSVHVTVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIHITWRKD  634

Query  64   KPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNYSCYRAGRPAGTVH---LLVDVPPE--  115
                 S              L + SV L  +GNY+C  +   A       L+V VPP   
Sbjct  635  GHVILSGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFV  694

Query  116  -EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
             +P            + C            K +    K   +P +    P     +    
Sbjct  695  VQPNNQDGIYGKAGVLNCS----VDGYPPPKVMWKHAKGSGNPQQYHPIPLTGRIQILPN  750

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARN--  230
            S  L     +          ++ VG+    S   T +   ++   P   I +   ++   
Sbjct  751  SSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGQSKELN  810

Query  231  -----PRWLSVTWQDPHSWNSSFYRLRFEL  255
                  R + + W+   +       +R+ +
Sbjct  811  CTARGERPIIIRWEKGDTVIDPDRNMRYAI  840


> sp|Q9MYL0|LEPR_MACMU Leptin receptor OS=Macaca mulatta OX=9544 
GN=LEPR PE=2 SV=2
Length=1163

 Score = 92.6 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/252 (19%), Positives = 90/252 (36%), Gaps = 16/252 (6%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS-----PAEDFQEPCQYSQESQ  172
             +SC     L+ + C W   +  SL   + L +R  ++S                    Q
Sbjct  431  NISCETDGHLTKMTCRWSTNTIQSLA-GSTLQLRYRRSSLYCFDIPSIHPISKPKDCYLQ  489

Query  173  KFSCQLAV--PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
                   V  P    S Y + + +   +GS  S         +++P PP+++    + +N
Sbjct  490  SDGFYECVFQPIFLLSGYTMWIRINHPLGSLDSPPTCVLPDSVVKPLPPSSVKAEII-KN  548

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCVIHDAWSG-LRH  288
               L ++W+ P         L+F++RY     +  +  + V D +   V          +
Sbjct  549  IGLLKISWEKP--VFPE-NNLQFQIRYGLSGKEIQWKMYDVYDAKSKSVSLPVPDFCAVY  605

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT-TNKDDDNILFRD  347
             VQ+R +   G G WS WS  A  T   + + P    E    +   T   + +  +L++ 
Sbjct  606  AVQVRCKRSDGLGLWSNWSNPAY-TVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKP  664

Query  348  SANATSLPVQDS  359
                 SL     
Sbjct  665  LMKNESLCSVQR  676


 Score = 77.2 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 71/217 (33%), Gaps = 18/217 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR-----------KFQNSPAEDFQEPCQ  166
             + C+ K  L   +C +      +        V                     FQ    
Sbjct  126  NIQCWLKGDLKLFIC-YVESLFKNPFKNYKHKVHLLYVLPEVLEDSPLVPQKGSFQMVHC  184

Query  167  YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-TFQGCGILQPDPPANITVT  225
                 ++  C + VP    +  ++     +S G  F     + Q   +++PDPP  + + 
Sbjct  185  NCSVHERCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPPLGLRME  244

Query  226  AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
                +   L ++W  P       + L++E++Y    +               ++     G
Sbjct  245  IT--DDGNLKISWSSPPLVP---FPLQYEVKYSENSTTVIREADKIVSATSLLVDGILPG  299

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
              + VQ+R +   G G WS+WS   + T       PP
Sbjct  300  SSYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPP  336


> sp|Q8K4B4|IL23R_MOUSE Interleukin-23 receptor OS=Mus musculus 
OX=10090 GN=Il23r PE=2 SV=1
Length=644

 Score = 91.4 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/258 (16%), Positives = 80/258 (31%), Gaps = 18/258 (7%)

Query  97   YRAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
            +          +    PP+ P  L+C       N+ C W       + TK ++ V+  + 
Sbjct  108  HFQETLICGKDISSGHPPDAPSNLTCVIYEYSGNMTCTWNTGKPTYIDTKYIVHVKSLET  167

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
               E+ Q       +    S Q +        Y+V +   +S+G + S+        I+ 
Sbjct  168  --EEEQQYLASSYVKISTDSLQGSRK------YLVWVQAVNSLGMENSQQLHVHLDDIVI  219

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P                   V W+        F     E+RY+   ++T++         
Sbjct  220  PSASIISRAETTNDTVPKTIVYWKSKTMIEKVFC----EMRYKTTTNQTWSVKEFDANFT  275

Query  276  --HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQA  333
                         ++V Q+R Q E G+  W  WS   +     E+       +  +    
Sbjct  276  YVQQSEFYLEPDSKYVFQVRCQ-ETGKRNWQPWSSPFVHQTSQETGKR--NWQPWSSPFV  332

Query  334  LTTNKDDDNILFRDSANA  351
              T++    +  + S   
Sbjct  333  HQTSQTVSQVTAKSSHEP  350


> sp|O70458|OSMR_MOUSE Oncostatin-M-specific receptor subunit beta 
OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
Length=971

 Score = 90.6 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/274 (18%), Positives = 97/274 (35%), Gaps = 20/274 (7%)

Query  84   RSVQLHDSG-NYSCYRAG---RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST  139
              V L D+G N +C       R  GTV  +  V  E   +SC  +     + C W P   
Sbjct  201  NVVFLSDTGTNINCQATKGPKRIFGTVLFVSKVLEEPKNVSCETRDF-KTLDCSWEPGVD  259

Query  140  PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG  199
             +LT +             E F + C+ S    + S    + EG    Y  ++   + + 
Sbjct  260  TTLTWRKQRFQNYTL---CESFSKRCEVSNY--RNSYTWQITEGSQEMYNFTLTAENQL-  313

Query  200  SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA  259
             K S    F     + P  P ++T+  +      +  TW+     N+     + +L+Y  
Sbjct  314  RKRSVNINFNLTHRVHPKAPQDVTLKIIGATKANM--TWKVHSHGNNYTLLCQVKLQYGE  371

Query  260  ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
               +   +     +  + +  D     ++   +R        +WS+W+ +   TP T   
Sbjct  372  VIHEHNVSVH---MSANYLFSDLDPDTKYKAFVRCASANHFWKWSDWTQKEFSTPET---  425

Query  320  SPPAENEVSTPMQALTTNKDDDNILFRDSANATS  353
            +P    +V   + +    +    + ++    + +
Sbjct  426  APSQALDVWRQVWSE-NGRRIVTLFWKPLLKSQA  458


> sp|F1NY98|DSCAM_CHICK Down syndrome cell adhesion molecule homolog 
OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
Length=2034

 Score = 86.0 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 55/314 (18%), Positives = 105/314 (33%), Gaps = 29/314 (9%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR--------RLLLRSVQLHDS  91
             G    ++C     E    V W           SR+    +         L +      DS
Sbjct  828   GQKKEMSC-TAHGEKPIIVRWEKEDRIINPEMSRYLVSTKEVGDEVISTLQILPTVREDS  886

Query  92    GNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
             G +SC+     G   G + L V  PP+ P++   R+    ++   W      +   T   
Sbjct  887   GFFSCHAINSYGEDRGIIQLTVQEPPDPPEIE-IREVRARSIALRWTMGFDGNSPITGYD  945

Query  148   LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
             +  +   +S     +      Q +Q     L      SS Y + M   + +G   +  + 
Sbjct  946   IECKNKSDSWDSVQRTKDVSPQLNQATIIDLH----PSSTYNIRMYAKNRIGKSEASNEL  1001

Query  208   FQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK---  263
                     PD PP ++ +  +  + + + VTW+ P     +     +++ YR   +    
Sbjct  1002  TITTDEAAPDGPPQDVQLEPI--SSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSAGGNF  1059

Query  264   TFTTWMVKDLQHH--CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
              F    +          +++     ++ + ++A    G G  S  S E + T   +  S 
Sbjct  1060  QFNIISIDTTGDSEVYTLNNLKKFTQYGMVVQACNRAGIGP-S--SQEIITTTLEDVPSC  1116

Query  322   PAENEVSTPMQALT  335
             P  N  +T     T
Sbjct  1117  PPGNVQATATSPET  1130


 Score = 84.1 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 51/269 (19%), Positives = 92/269 (34%), Gaps = 36/269 (13%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGS----HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
               + L C  V  +   TV W+       S       R        ++R+V+  DSG YSC
Sbjct  1327  KDIVLPCKAVG-DPAPTVKWMKDSNGTPSLVMIDGRRSIFSNGSFVIRTVKAEDSGYYSC  1385

Query  97    YRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
               +   G     ++L V VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1386  VASNNWGSDEIILNLQVQVPPDQPRLT-VSKTTSSSITLSWIPGDNGGSSIRGYILQYSE  1444

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS         P + S   +   C         ++Y  ++   + VG            
Sbjct  1445  DNSEQWGSFPISPSERSYRLETLKC--------GTWYKFTLTAQNGVGPGR-------IS  1489

Query  212   GILQPDPPANITVTAVARNPRWLSVTWQDPHS------WNSSFYRLR-FELRYRAERSKT  264
              I++      +         + L  +            WN     +  F L YR   +  
Sbjct  1490  EIIEA---KTLGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTV  1546

Query  265   FTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             +TT     L    +++D      + +Q+R
Sbjct  1547  WTTAQRTSLSKSYILYDLQEATWYELQMR  1575


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 60/334 (18%), Positives = 105/334 (31%), Gaps = 49/334 (15%)

Query  26    PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR------  79
             P   V       + G +V L C   E     T+ W   K A        A  GR      
Sbjct  716   PRFVVQPSDQDGIYGKAVILNC-SAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTN  774

Query  80    -RLLLRSVQLHDSGNYSCYRAGRPAGTV----HLLVDVPP---EEPQLSCFRKSPLSNVV  131
               LL++ V   DSG Y C  +      V    +L V +P      P  +   +     + 
Sbjct  775   GSLLIKHVLEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMS  834

Query  132   CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS  191
             C     +                    ED     + S+     S +    E  S+  I+ 
Sbjct  835   CT----AHGEKPI--------IVRWEKEDRIINPEMSRYL--VSTKEVGDEVISTLQILP  880

Query  192   MCVASSVGSKFSKTQTF-QGCGILQ------PDPPANITVTAVARNPRWLSVTWQDPHSW  244
                  S         ++ +  GI+Q      PDPP    +       R +++ W      
Sbjct  881   TVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPE---IEIREVRARSIALRWTMGFDG  937

Query  245   NSSFYRLRFELRYRAERSKTFTTWM----VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
             NS      +++  + + S ++ +      V    +   I D      + +++ A+   G+
Sbjct  938   NSPITG--YDIECKNK-SDSWDSVQRTKDVSPQLNQATIIDLHPSSTYNIRMYAKNRIGK  994

Query  301   GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
                SE S E   T    +   P ++    P+ + 
Sbjct  995   ---SEASNELTITTDEAAPDGPPQDVQLEPISSQ  1025


 Score = 46.3 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 48/132 (36%), Gaps = 9/132 (7%)

Query  174   FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
              S  +   + + S Y  S   +++ G   S          + PD P    +T        
Sbjct  1368  GSFVIRTVKAEDSGYY-SCVASNNWG---SDEIILNLQVQVPPDQP---RLTVSKTTSSS  1420

Query  234   LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             ++++W    +  SS     + L+Y  + S+ + ++ +   +    +     G  +   L 
Sbjct  1421  ITLSWIPGDNGGSSIRG--YILQYSEDNSEQWGSFPISPSERSYRLETLKCGTWYKFTLT  1478

Query  294   AQEEFGQGEWSE  305
             AQ   G G  SE
Sbjct  1479  AQNGVGPGRISE  1490


> sp|Q7ZW34|CNTN5_DANRE Contactin-5 OS=Danio rerio OX=7955 GN=cntn5 
PE=2 SV=1
Length=1056

 Score = 82.5 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 58/339 (17%), Positives = 106/339 (31%), Gaps = 41/339 (12%)

Query  40   GDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPS-------RWAGMGRRLLLRSVQLHDS  91
            G+SV L+C    +P  + +  W+L      +          +       L++RS+ L  +
Sbjct  542  GESVVLSCKVTHDPSLDVSFLWLLNNQPLNTQQDGGHFEYIQTQSSTADLMIRSILLKHA  601

Query  92   GNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
            G Y C              LLV  PP  P +    +   S     W          T   
Sbjct  602  GKYGCRAQTSTDSVLAEAELLVRGPPGPPGVVIVEEITASTATLSWSHGVDNHSPITTYN  661

Query  148  LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
            +  R   +   +   +           S  +AV       Y   +   +S+G+      +
Sbjct  662  VQARSPVSLGWQT-VKTDPDPVTGSMESA-MAVDLNPWVEYEFRVVATNSIGTGDPSPPS  719

Query  208  FQGCGI--LQPDPPANITVTAVARNPRW--LSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
                    +    PAN+       N R   L ++W+       +     + + +R   ++
Sbjct  720  RAVRTKEAVPSVAPANVR----GGNGRRHELVISWEPVSEEYQNGEGFGYIVAFRVNGTR  775

Query  264  TFTTWMVKDL-QHHCVIHDAW--SGLRHVVQLRAQEEFGQGEWSE----WSPEAMGTPWT  316
             +   MV           D          V++      G G +SE    +S E       
Sbjct  776  GWKEKMVTSADSTTYKYRDETFPPLTPFEVRVGVYNNKGDGPFSEVVTVFSAEG------  829

Query  317  ESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLP  355
            E R PP+E      +QA   +  +  +L++  +     P
Sbjct  830  EPREPPSE------VQAFAVSSSEIKVLWKPPSPGLGRP  862


> sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo 
sapiens OX=9606 GN=DSCAM PE=1 SV=2
Length=2012

 Score = 82.5 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/269 (19%), Positives = 91/269 (34%), Gaps = 36/269 (13%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGS----HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
               + L C  V  + +  V W+       S       R        ++R+V+  DSG YSC
Sbjct  1301  KDIVLPCKAVG-DPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSC  1359

Query  97    YRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     ++L V VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1360  IANNNWGSDEIILNLQVQVPPDQPRLT-VSKTTSSSITLSWLPGDNGGSSIRGYILQYSE  1418

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS         P + S   +   C         ++Y  ++   + VG            
Sbjct  1419  DNSEQWGSFPISPSERSYRLENLKC--------GTWYKFTLTAQNGVGPGR-------IS  1463

Query  212   GILQPDPPANITVTAVARNPRWLSVTWQDPHS------WNSSFYRLR-FELRYRAERSKT  264
              I++      +         + L  +            WN     +  F L YR   +  
Sbjct  1464  EIIEA---KTLGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTV  1520

Query  265   FTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             +TT     L    +++D      + +Q+R
Sbjct  1521  WTTAQRTSLSKSYILYDLQEATWYELQMR  1549


 Score = 80.2 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 55/324 (17%), Positives = 106/324 (33%), Gaps = 34/324 (10%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR--------RLLLRSVQLHDS  91
             G    ++C     E    V W           +R+    +         L +      DS
Sbjct  802   GQKKEMSC-TAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDS  860

Query  92    GNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
             G +SC+     G   G + L V  PP+ P++   +      +   W      +   T   
Sbjct  861   GFFSCHAINSYGEDRGIIQLTVQEPPDPPEIE-IKDVKARTITLRWTMGFDGNSPITGYD  919

Query  148   LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
             +  +   +S     +         Q  S  +      S+ Y + M   + +G      + 
Sbjct  920   IECKNKSDSWDSAQRTK---DVSPQLNSATIIDIHPSST-YSIRMYAKNRIGKSEPSNEL  975

Query  208   FQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---AERSK  263
                     PD PP  + +  +  + + + VTW+ P     +     +++ YR      + 
Sbjct  976   TITADEAAPDGPPQEVHLEPI--SSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNF  1033

Query  264   TFTTWMVKDLQHH--CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
              F    V          + +     ++ + ++A    G G  S  S E + T   +  S 
Sbjct  1034  QFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGP-S--SQEIITTTLEDVPSY  1090

Query  322   PAENEVSTPMQALTTNKDDDNILF  345
             P EN      QA+ T+ +  +I +
Sbjct  1091  PPENV-----QAIATSPESISISW  1109


 Score = 52.9 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 62/334 (19%), Positives = 104/334 (31%), Gaps = 69/334 (21%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR------  79
            P   V       + G +V L C   E     T+ W   K A        A  GR      
Sbjct  690  PKFVVQPRDQDGIYGKAVILNC-SAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSN  748

Query  80   -RLLLRSVQLHDSGNYSCYRAGRPAGTV----HLLVDVP--------------PEEPQLS  120
              LL++ V   DSG Y C  +      V    +L V +P               ++ ++S
Sbjct  749  GSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMS  808

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            C        +V         +      L+  K      E+     Q     ++ S   + 
Sbjct  809  CTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEV---GEEVISTLQILPTVREDSGFFSC  865

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ------PDPPANITVTAVARNPRWL  234
                           +S G         +  GI+Q      PDPP  I +  V    R +
Sbjct  866  H------------AINSYG---------EDRGIIQLTVQEPPDPPE-IEIKDVKA--RTI  901

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFT----TWMVKDLQHHCVIHDAWSGLRHVV  290
            ++ W      NS      +++  + + S ++     T  V    +   I D      + +
Sbjct  902  TLRWTMGFDGNSPITG--YDIECKNK-SDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSI  958

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAE  324
            ++ A+   G+   SE S E   T    +   P +
Sbjct  959  RMYAKNRIGK---SEPSNELTITADEAAPDGPPQ  989


 Score = 46.0 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/112 (18%), Positives = 41/112 (37%), Gaps = 8/112 (7%)

Query  194   VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
               ++ G   S          + PD P    +T        ++++W    +  SS     +
Sbjct  1361  ANNNWG---SDEIILNLQVQVPPDQP---RLTVSKTTSSSITLSWLPGDNGGSSIRG--Y  1412

Query  254   ELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
              L+Y  + S+ + ++ +   +    + +   G  +   L AQ   G G  SE
Sbjct  1413  ILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISE  1464


> sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog 
OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1
Length=2013

 Score = 82.5 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/269 (19%), Positives = 91/269 (34%), Gaps = 36/269 (13%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGS----HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
               + L C  V  + +  V W+       S       R        ++R+V+  DSG YSC
Sbjct  1301  KDIVLPCKAVG-DPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFVIRTVKAEDSGYYSC  1359

Query  97    YRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     ++L V VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1360  VANNNWGSDEIILNLQVQVPPDQPRLT-VSKTTSSSITLSWLPGDNGGSSIRGYILQYSE  1418

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS         P + S   +   C         ++Y  ++   + VG            
Sbjct  1419  DNSEQWGSFPISPSERSYRLENLKC--------GTWYKFTLTAQNGVGPGR-------IS  1463

Query  212   GILQPDPPANITVTAVARNPRWLSVTWQDPHS------WNSSFYRLR-FELRYRAERSKT  264
              I++      +         + L  +            WN     +  F L YR   +  
Sbjct  1464  EIIEA---KTLGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTV  1520

Query  265   FTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             +TT     L    +++D      + +Q+R
Sbjct  1521  WTTAQRTSLSKSYILYDLQEATWYELQMR  1549


 Score = 78.7 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 54/324 (17%), Positives = 105/324 (32%), Gaps = 34/324 (10%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR--------RLLLRSVQLHDS  91
             G    ++C     E    V W           +R+    +         L +      DS
Sbjct  802   GQRKEMSC-TAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDS  860

Query  92    GNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
             G +SC+     G   G + L V  PP+ P++   +      +   W      +   T   
Sbjct  861   GFFSCHAINSYGEDRGIIQLTVQEPPDPPEIE-IKDVKARTITLRWTMGFDGNSPITGYD  919

Query  148   LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
             +  +   +S     +         Q  S  +      S+ Y + M   + +G      + 
Sbjct  920   IECKNKSDSWDSAQRTK---DVSPQLNSATIIDIHPSST-YSIRMYAKNRIGKSEPSNEI  975

Query  208   FQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---AERSK  263
                     PD PP  + +     + + + VTW+ P     +     +++ YR      + 
Sbjct  976   TITADEAAPDGPPQEVHLEPT--SSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNF  1033

Query  264   TFTTWMVKDLQHH--CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
              F    +          + +     ++ + ++A    G G  S  S E + T   +  S 
Sbjct  1034  QFNIISIDTTGDSEVYTLDNLNKFTQYGLVVQACNRAGTGP-S--SQEIITTTLEDVPSY  1090

Query  322   PAENEVSTPMQALTTNKDDDNILF  345
             P EN      QA+ T+ +  +I +
Sbjct  1091  PPENV-----QAIATSPESISISW  1109


 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 63/344 (18%), Positives = 105/344 (31%), Gaps = 69/344 (20%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR------  79
            P   V       + G +V L C   E     T+ W   K A        A  GR      
Sbjct  690  PKFVVQPRDQDGIYGKAVILNC-SAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSN  748

Query  80   -RLLLRSVQLHDSGNYSCYRAGRPAGTV----HLLVDVP--------------PEEPQLS  120
              LL++ V   DSG Y C  +      V    +L V +P               +  ++S
Sbjct  749  GSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQRKEMS  808

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            C        +V         +      L+  K      E+     Q     ++ S   + 
Sbjct  809  CTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEV---GEEVISTLQILPTVREDSGFFSC  865

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ------PDPPANITVTAVARNPRWL  234
                           +S G         +  GI+Q      PDPP  I +  V    R +
Sbjct  866  H------------AINSYG---------EDRGIIQLTVQEPPDPPE-IEIKDVKA--RTI  901

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFT----TWMVKDLQHHCVIHDAWSGLRHVV  290
            ++ W      NS      +++  + + S ++     T  V    +   I D      + +
Sbjct  902  TLRWTMGFDGNSPITG--YDIECKNK-SDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSI  958

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
            ++ A+   G+   SE S E   T    +   P +     P  + 
Sbjct  959  RMYAKNRIGK---SEPSNEITITADEAAPDGPPQEVHLEPTSSQ  999


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 48/132 (36%), Gaps = 9/132 (7%)

Query  174   FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
              S  +   + + S Y  S    ++ G   S          + PD P    +T        
Sbjct  1342  GSFVIRTVKAEDSGYY-SCVANNNWG---SDEIILNLQVQVPPDQP---RLTVSKTTSSS  1394

Query  234   LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             ++++W    +  SS     + L+Y  + S+ + ++ +   +    + +   G  +   L 
Sbjct  1395  ITLSWLPGDNGGSSIRG--YILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLT  1452

Query  294   AQEEFGQGEWSE  305
             AQ   G G  SE
Sbjct  1453  AQNGVGPGRISE  1464


 Score = 38.6 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 56/193 (29%), Gaps = 26/193 (13%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA--------GMGRRLLLRSVQLHD  90
            P + V+L C  V+     TV W L                      +   L + S Q+ D
Sbjct  420  PAEPVSLVCN-VKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNVVSYLNISSSQVRD  478

Query  91   SGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAV  147
             G Y C     AG       + V  P            P+ N+           +  + +
Sbjct  479  GGVYRCTANNSAGVVLYQARINVRGP--------ASIRPMKNITA--IAGRDTYIHCRVI  528

Query  148  LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV----PEGDSSFYIVSMCVASSVGSKFS  203
                            P  + Q + + +  L +     E D   Y  ++ V   + +  S
Sbjct  529  GYPYYSIKWYKNANLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQS  588

Query  204  KTQTFQGCGILQP  216
               T +    +QP
Sbjct  589  VHVTVKVPPFIQP  601


> sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog 
OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1
Length=2013

 Score = 82.2 bits (201),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/269 (19%), Positives = 91/269 (34%), Gaps = 36/269 (13%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGS----HPSRWAGMGRRLLLRSVQLHDSGNYSC  96
               + L C  V  + +  V W+       S       R        ++R+V+  DSG YSC
Sbjct  1301  KDIVLPCKAVG-DPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSC  1359

Query  97    YRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKF  153
                   G     ++L V VPP++P+L+   K+  S++   W P      + +  +L    
Sbjct  1360  VANNNWGSDEIILNLQVQVPPDQPRLT-VSKTTSSSITLSWLPGDNGGSSIRGYILQYSE  1418

Query  154   QNSP--AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
              NS         P + S   +   C         ++Y  ++   + VG            
Sbjct  1419  DNSEQWGSFPISPSERSYRLENLKC--------GTWYKFTLTAQNGVGPGR-------IS  1463

Query  212   GILQPDPPANITVTAVARNPRWLSVTWQDPHS------WNSSFYRLR-FELRYRAERSKT  264
              I++      +         + L  +            WN     +  F L YR   +  
Sbjct  1464  EIIEA---KTLGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTV  1520

Query  265   FTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             +TT     L    +++D      + +Q+R
Sbjct  1521  WTTAQRTSLSKSYILYDLQEATWYELQMR  1549


 Score = 78.7 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 54/324 (17%), Positives = 105/324 (32%), Gaps = 34/324 (10%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR--------RLLLRSVQLHDS  91
             G    ++C     E    V W           +R+    +         L +      DS
Sbjct  802   GQRKEMSC-TAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDS  860

Query  92    GNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
             G +SC+     G   G + L V  PP+ P++   +      +   W      +   T   
Sbjct  861   GFFSCHAINSYGEDRGIIQLTVQEPPDPPEIE-IKDVKARTITLRWTMGFDGNSPITGYD  919

Query  148   LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
             +  +   +S     +         Q  S  +      S+ Y + M   + +G      + 
Sbjct  920   IECKNKSDSWDSAQRTK---DVSPQLNSATIIDIHPSST-YSIRMYAKNRIGKSEPSNEI  975

Query  208   FQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---AERSK  263
                     PD PP  + +     + + + VTW+ P     +     +++ YR      + 
Sbjct  976   TITADEAAPDGPPQEVHLEPT--SSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNF  1033

Query  264   TFTTWMVKDLQHH--CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
              F    +          + +     ++ + ++A    G G  S  S E + T   +  S 
Sbjct  1034  QFNIISIDTTGDSEVYTLDNLNKFTQYGLVVQACNRAGTGP-S--SQEIITTTLEDVPSY  1090

Query  322   PAENEVSTPMQALTTNKDDDNILF  345
             P EN      QA+ T+ +  +I +
Sbjct  1091  PPENV-----QAIATSPESISISW  1109


 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 63/344 (18%), Positives = 105/344 (31%), Gaps = 69/344 (20%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR------  79
            P   V       + G +V L C   E     T+ W   K A        A  GR      
Sbjct  690  PKFVVQPRDQDGIYGKAVILNC-SAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSN  748

Query  80   -RLLLRSVQLHDSGNYSCYRAGRPAGTV----HLLVDVP--------------PEEPQLS  120
              LL++ V   DSG Y C  +      V    +L V +P               +  ++S
Sbjct  749  GSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQRKEMS  808

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
            C        +V         +      L+  K      E+     Q     ++ S   + 
Sbjct  809  CTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEV---GEEVISTLQILPTVREDSGFFSC  865

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ------PDPPANITVTAVARNPRWL  234
                           +S G         +  GI+Q      PDPP  I +  V    R +
Sbjct  866  H------------AINSYG---------EDRGIIQLTVQEPPDPPE-IEIKDVKA--RTI  901

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFT----TWMVKDLQHHCVIHDAWSGLRHVV  290
            ++ W      NS      +++  + + S ++     T  V    +   I D      + +
Sbjct  902  TLRWTMGFDGNSPITG--YDIECKNK-SDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSI  958

Query  291  QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
            ++ A+   G+   SE S E   T    +   P +     P  + 
Sbjct  959  RMYAKNRIGK---SEPSNEITITADEAAPDGPPQEVHLEPTSSQ  999


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/113 (18%), Positives = 41/113 (36%), Gaps = 8/113 (7%)

Query  193   CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                ++ G   S          + PD P    +T        ++++W    +  SS     
Sbjct  1360  VANNNWG---SDEIILNLQVQVPPDQP---RLTVSKTTSSSITLSWLPGDNGGSSIRG--  1411

Query  253   FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             + L+Y  + S+ + ++ +   +    + +   G  +   L AQ   G G  SE
Sbjct  1412  YILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISE  1464


 Score = 38.6 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 56/193 (29%), Gaps = 26/193 (13%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA--------GMGRRLLLRSVQLHD  90
            P + V+L C  V+     TV W L                      +   L + S Q+ D
Sbjct  420  PAEPVSLVCN-VKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNVVSYLNISSSQVRD  478

Query  91   SGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAV  147
             G Y C     AG       + V  P            P+ N+           +  + +
Sbjct  479  GGVYRCTANNSAGVVLYQARINVRGP--------ASIRPMKNITA--IAGRDTYIHCRVI  528

Query  148  LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV----PEGDSSFYIVSMCVASSVGSKFS  203
                            P  + Q + + +  L +     E D   Y  ++ V   + +  S
Sbjct  529  GYPYYSIKWYKNANLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQS  588

Query  204  KTQTFQGCGILQP  216
               T +    +QP
Sbjct  589  VHVTVKVPPFIQP  601


> sp|P42702|LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo 
sapiens OX=9606 GN=LIFR PE=1 SV=1
Length=1097

 Score = 81.4 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 57/370 (15%), Positives = 114/370 (31%), Gaps = 42/370 (11%)

Query  21   APRRCPAQEVARGVLTS--------LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS  72
                     +     T         L G  +T  C   E   +A +              
Sbjct  238  WSPVKNISWIP-DSQTKVFPQDKVILVGSDITFCCVSQEKVLSALI------GHTNCPLI  290

Query  73   RWAGMGRRLLLRSVQLH-DSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV  131
               G    + +R++ +   SG    +          +    PP+ PQ        L  ++
Sbjct  291  HLDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEII  350

Query  132  CEWGPRSTPSL----TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
            C W P    +L     T   L V  F        +     ++  Q     L   E     
Sbjct  351  CSWNPGRVTALVGPRATSYTL-VESFSGKYVRLKRAEAPTNESYQLLFQMLPNQE----I  405

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
            Y  ++   + +G   S          + P  P +  V  +  N   + ++W  P ++   
Sbjct  406  YNFTLNAHNPLGRSQSTIL-VNITEKVYPHTPTSFKVKDI--NSTAVKLSWHLPGNFAKI  462

Query  248  FYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             +    E++     +  +  T   V++  +   +        +  ++R   E    +WS+
Sbjct  463  NFLCEIEIKKSNSVQEQRNVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFW-KWSK  521

Query  306  WS--PEAMGTPWTESRSPPAENEVSTPM--------QALTTNKDDDNILFRDSANATSLP  355
            WS   + + T  + S+ P    E  +          + L  N+ +  IL  + + ++   
Sbjct  522  WSNKKQHLTTEASPSKGPDTWRE-WSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEE  580

Query  356  VQDSSSVPLP  365
             Q  S +P P
Sbjct  581  TQSLSEIPDP  590


 Score = 47.1 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 38/204 (19%), Positives = 66/204 (32%), Gaps = 30/204 (15%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
            L C   + L    C W   S     T   +           + +    Y  E       +
Sbjct  53   LKCVTNN-LQVWNCSWKAPSGTGRGTDYEV---------CIENRSRSCYQLEKTS----I  98

Query  179  AVPEGDSSFYIVSMCVASSVGSKFS-KTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
             +P      Y +++      GS  S  T   Q   ++ PD P  + ++A   +   L + 
Sbjct  99   KIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLI-PDTPEILNLSA-DFSTSTLYLK  156

Query  238  WQDPHSWNSSFYRLRFELRYRAERSKTFT---TWMVKDLQHHCVIHDAWSG------LRH  288
            W D  S       + +E++   + S       T          + H +W+         H
Sbjct  157  WNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIH  216

Query  289  VVQLRA-QEEFGQG---EWSEWSP  308
             V++R   +        EWS+WSP
Sbjct  217  FVEIRCYIDNLHFSGLEEWSDWSP  240


> sp|Q65Z14|OSMR_RAT Oncostatin-M-specific receptor subunit beta 
OS=Rattus norvegicus OX=10116 GN=Osmr PE=2 SV=1
Length=962

 Score = 81.0 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/250 (15%), Positives = 81/250 (32%), Gaps = 16/250 (6%)

Query  104  GTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE  163
            GTV  +  V  E    SC  +     + C W P    +L+                  +E
Sbjct  226  GTVLFVSKVLEEPKNFSCETRDF-KTLNCLWEPGIDTTLSWHKQRSQHYTLYESFSGRRE  284

Query  164  PCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
                   + + S    + E     Y  ++   +++  K S + +F     + P  P ++T
Sbjct  285  -----VSNHRNSHTWQITEDSQETYNFTLTAENNL-RKRSVSISFNLTHRVHPKAPHDVT  338

Query  224  VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAW  283
            +  V      +  TW+ P   +   Y L  ++  + E        +      + +  D  
Sbjct  339  LKTVGATKAHM--TWKVPSRGD---YTLLCQVELQCEGEVIHEHNVSVHTSANYLFSDLE  393

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNI  343
                +   +R        +WS+W  +   TP     +P    +V   ++     +    +
Sbjct  394  PDTEYKACVRCASANHFWKWSDWMQKKFRTP---EAAPSEALDVWRDVRTE-NGRHVVTL  449

Query  344  LFRDSANATS  353
             ++    + +
Sbjct  450  FWKPLLKSQA  459


> sp|Q95LF0|I13R2_CANLF Interleukin-13 receptor subunit alpha-2 
OS=Canis lupus familiaris OX=9615 GN=IL13RA2 PE=2 SV=1
Length=386

 Score = 78.7 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 65/187 (35%), Gaps = 22/187 (12%)

Query  132  CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS  191
            C W P       T   L           D    C    +    +     P  +SS Y   
Sbjct  154  CSWKPGMGVHFDTNYQLFYWY----EGLDHSAECTDYIKVNGKNMGCRFPYLESSDYKDF  209

Query  192  MCVASSVGSKFSKTQT-----FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
                +  GS  S+        FQ   I++P PP  +++T   +N   +++ W  P     
Sbjct  210  YICVN--GSSESQPIRPSYFIFQLQNIVKPMPPDYLSLTV--KNSEEINLKWNMP----K  261

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD-AWSGLRHVVQLRAQEEFG---QGE  302
                 +  + Y  E ++  TTW+   +++   I   +    +    +R++        G 
Sbjct  262  GPIPAKCFI-YEIEFTEDGTTWVTTTVENEIQITRTSNESQKLCFLVRSKVNIYCSDDGI  320

Query  303  WSEWSPE  309
            WSEWS E
Sbjct  321  WSEWSDE  327


 Score = 44.8 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 48/117 (41%), Gaps = 9/117 (8%)

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY---RLRFELRYRAERSKTFTTWMV  270
            ++ +PP +  +        +LS+ WQ P       +    + +EL+YR   S+ + T + 
Sbjct  29   IKVNPPQDFEI-VDPGYLGYLSLQWQPP--LFPDNFKECTIEYELKYRNIDSENWKTIIT  85

Query  271  KDLQHHCVIHDAWSGLRHVVQ--LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
            K+L H+    D   G+   +   L AQ   G    S W+     T    +R    ++
Sbjct  86   KNL-HYKDGFDLNKGIEAKINTLLPAQCTNGSEVRSSWAETTYWTSPQGNRETKIQD  141


> sp|Q5XNR9|LIFR_CANLF Leukemia inhibitory factor receptor OS=Canis 
lupus familiaris OX=9615 GN=LIFR PE=2 SV=1
Length=1097

 Score = 79.9 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/317 (15%), Positives = 100/317 (32%), Gaps = 16/317 (5%)

Query  15   APGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW  74
            +P   ++       +V       L G  +T  C   E   +A +                
Sbjct  239  SPLKNISWSPDSQTKVFPQDKVILVGSDITFCCVTQEKVLSAQI------GQTNCPLIHL  292

Query  75   AGMGRRLLLRSVQLH-DSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCE  133
             G    + + ++ +  +SG    +          + V  PP+ PQ        L  +VC 
Sbjct  293  DGENVAIKIHNISVSANSGTNVVFTTEDNIFGTVIFVGYPPDIPQKVNCETYDLKEIVCT  352

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
            W P    +L          F++   + +    +    + +          +   Y  ++ 
Sbjct  353  WNPGRPTALVGPRNTSYTLFESFSGK-YVRFKRVEAPTNESYQLFFQMRPNQEIYNFTLN  411

Query  194  VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
              + +G   S          + P  P +I V  +  N   + ++W  P ++       + 
Sbjct  412  ARNPLGRSESTIL-INITEKVYPRIPTSIKVKDI--NSTAVMLSWHLPGNFAKIKLLCQI  468

Query  254  ELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA-  310
            E+      +  +  T   V++  +   +        +  ++R   E    +WS+WS E  
Sbjct  469  EINKTNSVQELRNVTIKGVENSSYLVAVDKLNPYTIYTFRIRCSTETFW-KWSKWSNEKK  527

Query  311  -MGTPWTESRSPPAENE  326
             + T    S+ P    E
Sbjct  528  YLTTEAIPSKGPDTWRE  544


 Score = 40.2 bits (92),  Expect = 0.040, Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 63/206 (31%), Gaps = 34/206 (17%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
            L C   +      C W   S     T   + +        E+    C      Q      
Sbjct  53   LKCITNNLRV-WDCSWKAPSAAGHGTVYEICI--------ENRSHSC-----YQSEKTNT  98

Query  179  AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGI---LQPDPPANITVTAVARNPRWLS  235
             +P      + +++   + +    +    F        L PD P  + ++A   +   + 
Sbjct  99   KIPALLPGDHEITI---NRLYDFGNPISKFTLNEKNVSLIPDTPEILNLSA-DFSTSTIH  154

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTF-------TTWMVKDLQHHCVIHDAWSG--L  286
            + W D  S       + +E++   + +          TT   KD  HH            
Sbjct  155  LKWNDRGSVFPHQLTVIWEIKILRKENMEIVKLITHNTTVNGKDTVHHWSWTSDMPLECA  214

Query  287  RHVVQLRA--QEEFGQG--EWSEWSP  308
             H V +R    +    G  EWS+WSP
Sbjct  215  IHSVGIRCYVDDPHFSGRKEWSDWSP  240


> sp|P42703|LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus 
musculus OX=10090 GN=Lifr PE=1 SV=1
Length=1092

 Score = 79.9 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/323 (15%), Positives = 99/323 (31%), Gaps = 33/323 (10%)

Query  21   APRRCPAQEV---ARGVLTS----LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
                     +      V       L G ++T+ C       +  +   LR          
Sbjct  233  WSPLKNISWIRNTETNVFPQDKVVLAGSNMTICCMSPTKVLSGQIGNTLRPL--------  284

Query  74   WAGMGRRLLLRSVQ---LHDSGNYSCYRAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSN  129
                G+ + +  +      +SG    +          +    PP+ P +LSC     L  
Sbjct  285  IHLYGQTVAIHILNIPVSENSGTNIIFITDDDVYGTVVFAGYPPDVPQKLSCET-HDLKE  343

Query  130  VVCEWGPRSTPSL--TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
            ++C W P     L         + +  +  +  F      + E+ +   Q          
Sbjct  344  IICSWNPGRITGLVGPRNTEYTLFESISGKSAVFHRIEGLTNETYRLGVQ---MHPGQEI  400

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
            +  ++   + +G   S          + P  P ++ V  +  N   ++ +W  P ++   
Sbjct  401  HNFTLTGRNPLGQAQSAVV-INVTERVAPHDPTSLKVKDI--NSTVVTFSWYLPGNFTKI  457

Query  248  FYRLRFEL--RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                + E+      +  +  T    +D  +H  +        +  ++R   +    +WS 
Sbjct  458  NLLCQIEICKANSKKEVRNATIRGAEDSTYHVAVDKLNPYTAYTFRVRCSSKTFW-KWSR  516

Query  306  WSPEA--MGTPWTESRSPPAENE  326
            WS E   + T  T S+ P    E
Sbjct  517  WSDEKRHLTTEATPSKGPDTWRE  539


> sp|O70535|LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus 
norvegicus OX=10116 GN=Lifr PE=2 SV=1
Length=1093

 Score = 76.8 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/314 (14%), Positives = 96/314 (31%), Gaps = 23/314 (7%)

Query  21   APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRR  80
              R        +  +    G ++T+ C       +  +    R              G  
Sbjct  242  WTRNTETNVFPQDKVVLA-GSNMTICCISTTKVLSGQIGNTFRPL--------IHLYGET  292

Query  81   LLLRSVQ---LHDSGNYSCYRAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLSNVVCEWGP  136
            + +  +      +SG+   +          +    PP+ P +LSC     L  ++C W P
Sbjct  293  VAINILNIPVSENSGSNVIFSTVDDVYGTVVFAGYPPDVPQKLSCET-HDLKEIICSWNP  351

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                 L          F++   +           + +          D   +  ++   +
Sbjct  352  GRITGLVGPRNTEYTLFESISGKSAVFHRFEEL-ANETYWLTLKMAPDQEIHNFTLTARN  410

Query  197  SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL-  255
             +G   S          +    P ++ V  V  N   ++++W  P ++       + E+ 
Sbjct  411  PLGQTESAIV-INATERVALHVPISLKVKDV--NSTVVTLSWYLPGNFTKINLVCQIEIC  467

Query  256  -RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA--MG  312
                 +  +  T    +D  +H  +        +  ++R   E    +WS+WS E   + 
Sbjct  468  KANSKKEVRNVTMRGAEDSTYHVAVDKLNPYTIYTFRVRCSSETFW-KWSKWSNEKRYLT  526

Query  313  TPWTESRSPPAENE  326
            T  T S+ P    E
Sbjct  527  TEATPSKGPDTWRE  540


> sp|Q14627|I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 
OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
Length=380

 Score = 74.5 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 64/185 (35%), Gaps = 22/185 (12%)

Query  132  CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS  191
            C W P     L T   L           D    C    ++   +     P  ++S Y   
Sbjct  155  CSWKPGIGVLLDTNYNLFYWY----EGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDF  210

Query  192  MCVASSVGSKFSKTQ-----TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
                +  GS  +K       TFQ   I++P PP  + +T    +   + + W  P     
Sbjct  211  YICVN--GSSENKPIRSSYFTFQLQNIVKPLPP--VYLTFTRESSCEIKLKWSIPLGPIP  266

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ----LRAQEEFGQGE  302
            +     +E+  R E   T  T  V++  +     +    L  VV+    +   ++   G 
Sbjct  267  AR-CFDYEIEIR-EDDTTLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSDD---GI  321

Query  303  WSEWS  307
            WSEWS
Sbjct  322  WSEWS  326


 Score = 44.0 bits (102),  Expect = 0.002, Method: Composition-based stats.
 Identities = 25/114 (22%), Positives = 47/114 (41%), Gaps = 12/114 (11%)

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY---RLRFELRYRAERSKTFTTWMV  270
            ++ +PP +  +        +L + WQ P S +   +    + +EL+YR   S+T+ T + 
Sbjct  30   IKVNPPQDFEI-VDPGYLGYLYLQWQPPLSLD--HFKECTVEYELKYRNIGSETWKTIIT  86

Query  271  KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE--WSEWSPEAMGTPWTESRSPP  322
            K+L H+    D   G+   +      +   G    S W+     T W   +  P
Sbjct  87   KNL-HYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET---TYWISPQGIP  136


> sp|P34902|IL2RG_MOUSE Cytokine receptor common subunit gamma 
OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
Length=369

 Score = 73.7 bits (179),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 41/209 (20%), Positives = 83/209 (40%), Gaps = 14/209 (7%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P++ CF  + +  + C W   S P   T   L  R    S    FQE C +   S++ + 
Sbjct  58   PEVQCFVFN-IEYMNCTWNSSSEPQ-ATNLTLHYRYKV-SDNNTFQE-CSHYLFSKEITS  113

Query  177  QLAVPEGDSSFY-IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
               + + D   Y    + +      +    Q      ++ P  P N+T++ ++     L 
Sbjct  114  GCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSE--SQLE  171

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            + W+  H        L++ ++YR+ R +++T  +V + +    +       R+  ++R++
Sbjct  172  LRWKSRHIKER---CLQYLVQYRSNRDRSWTELIV-NHEPRFSLPSVDELKRYTFRVRSR  227

Query  296  EEFGQGE---WSEWSPEAMGTPWTESRSP  321
                 G    WS+WS        T   +P
Sbjct  228  YNPICGSSQQWSKWSQPVHWGSHTVEENP  256


> sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 
SV=1
Length=35213

 Score = 73.3 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 53/316 (17%), Positives = 103/316 (33%), Gaps = 28/316 (9%)

Query  58     VHWVLRKPAAGSHPSRWAGMGRRL-LLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVP  113
              V W      +    S  +     L ++ +V   DSG Y       +G  +  V++ V   
Sbjct  23681  VKWAREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDT  23740

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR-STPSLTT-KAVLLVRKFQNSPAEDFQEPC---QYS  168
              P  PQ    ++   ++V   W P            ++  R+            C    + 
Sbjct  23741  PGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWK  23800

Query  169    QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
               +  +  C         + Y + +   ++   K S+          +P PP  IT+T V 
Sbjct  23801  VDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE----------RPLPPGKITLTDVT  23850

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              RN   +S++W+ P   +     L + +  +++ S  + T     +     I     G  +
Sbjct  23851  RNS--VSLSWEKPEH-DGGSRILGYIVEMQSKGSDRWATCATVKV-TEATITGLIQGEEY  23906

Query  289    VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
                ++ AQ E G  +  + S   +     +   PPA   +      L       ++ F   
Sbjct  23907  SFRVSAQNEKGISDPRQLSVPVIA---KDLVIPPAFKLLFNTFTVLAGEDLKIDVPF--I  23961

Query  349    ANATSLPVQDSSSVPL  364
                           +PL
Sbjct  23962  GRPPPAVTWHKDDIPL  23977


 Score = 69.8 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 55/329 (17%), Positives = 99/329 (30%), Gaps = 27/329 (8%)

Query  40     GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNY---SC  96
              G  +T+  P  +    A   W        +             +   +  D G Y     
Sbjct  14803  GQPLTMVVP-YDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQ  14861

Query  97     YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQN  155
               + G+  G ++L V   P   +     ++    V   W  P +                 
Sbjct  14862  NKHGKAEGFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIG-------YV  14914

Query  156    SPAEDFQEPCQYSQESQKFSCQLAVPEGDS--SFYIVSMCVASSVGSKF--SKTQTFQGC  211
                  D +         +  SC+  V         Y+  +   + VG+          +  
Sbjct  14915  VERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEAR  14974

Query  212    GILQ-PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV  270
                   P PP N+T+T V R    +S+TW+ P  ++       + +  R + S  + T M 
Sbjct  14975  SKYDVPGPPLNVTITDVNRFG--VSLTWEPPE-YDGGAEITNYVIELRDKTSIRWDTAMT  15031

Query  271    KDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
                 +     + D   G  +  ++RAQ   G G+ S  +P        E  SPP     S 
Sbjct  15032  VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNASE  15091

Query  330    PMQALTTNKDDDNILFRDSANATSLPVQD  358
                Q+         + +         P+  
Sbjct  15092  QTQSSVQ------LTWEPPLKDGGSPILG  15114


 Score = 67.9 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 73/435 (17%), Positives = 138/435 (32%), Gaps = 56/435 (13%)

Query  57     TVHWVLRKPAAGSHPS---RWAGMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLV  110
              +V W   +    +          +   L++   Q  D+G Y+      AG   GT+ + V
Sbjct  21802  SVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKV  21861

Query  111    DVPPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
                 P  P     F +     +  +WGP      +     ++ K  +   +     C  + 
Sbjct  21862  VGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVT--CASAV  21919

Query  170    ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF---SKTQ----TFQGCGILQPD--PPA  220
              +   F         +   Y   +   +  G      S+       F       PD  PP 
Sbjct  21920  QKTTFRVTR---LHEGIEYTFRVSAENKYGVGEGLKSEPIVAKHPFDV-----PDAPPPP  21971

Query  221    NITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWMVKDLQ-HHCV  278
              NI    V      +S+TW DP    +    +  + + ++   S  +       ++     
Sbjct  21972  NI----VDVRHDSVSLTWTDPK--KTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFK  22025

Query  279    IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP--------AENEVSTP  330
              +     GL +  ++ A    G G+ S  S   +     +    P        +   + T 
Sbjct  22026  VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVISVTRNSVTLIWTE  22085

Query  331    MQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKK  390
               +    +K    I+ +    + S    +  +VP   F V              +V   K 
Sbjct  22086  PKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTD------------LVEGGKY  22133

Query  391    TWKLRALKEGKTSMHPPYSLGQLV--PERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRP  448
               +++RA         P  S G ++   E   PT VL P I   ++  +  S   S+ +  
Sbjct  22134  EFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDSIVLSAISIL  22193

Query  449    DARDPRSPYDISNTD  463
                  P+S +  +  D
Sbjct  22194  GKPLPKSSWSRAGKD  22208


 Score = 65.6 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 53/322 (16%), Positives = 99/322 (31%), Gaps = 23/322 (7%)

Query  13     LAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK---PAAGS  69
              L+ P  A      PA ++     T L G+ + +  P +     A V W            
Sbjct  23924  LSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPA-VTWHKDDIPLKQTTR  23982

Query  70     HPSRWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPEEPQ-LSCFRKS  125
                +        L ++     D G+Y+      AG    T++++V   P  P       + 
Sbjct  23983  VNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEV  24042

Query  126    PLSNVVCEWGPR-STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD  184
                 +V   W P       +     +V K   S           ++ + K     A     
Sbjct  24043  TADSVTLSWEPPKYDGGSSIN-NYIVEKRDTSTTAWQIVSATVARTTIK-----ACRLKT  24096

Query  185    SSFYIVSMCVASSVGSKF---SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
                 Y   +   +  G      S+    Q    + P PP    VT  +++   + V W +P
Sbjct  24097  GCEYQFRIAAENRYGKSTYLNSEPVVAQYPFKV-PGPPGTPFVTLASKDS--MEVQWHEP  24153

Query  242    HSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               S +     + + L  +   S  +       + Q          G+ +  ++ A+   G 
Sbjct  24154  VS-DGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGI  24212

Query  301    GEWSEWSPEAMGTPWTESRSPP  322
              G+ S+ S         +    P
Sbjct  24213  GKPSKPSECYAAHDPCDPPGRP  24234


 Score = 65.6 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 111/297 (37%), Gaps = 32/297 (11%)

Query  79     RRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW  134
                ++    +   +G Y    +   G    T+ + +   P++P           ++VV  W
Sbjct  32474  HLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISW  32533

Query  135    GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
               P +    +     +V K +     ++Q     S      +C++ V   +++ Y   +  
Sbjct  32534  KPPADDGGSWITNYVVEKCEAKEGAEWQLV---SSAISVTTCRI-VNLTENAGYYFRVSA  32589

Query  195    ASSVGSKFSKTQTFQGCGILQ-----PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
               ++ G   S+        I++     P  P   T+TAV ++     V W+ P S +    
Sbjct  32590  QNTFGI--SEPLEVASIVIIKSPFEKPGVPGKPTITAVTKDS--CVVAWKPPAS-DGGAK  32644

Query  250    RLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
                 + L  R ++   +     ++++     + +   GL +  +++ +   G+ EWSE S 
Sbjct  32645  IRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISE  32704

Query  309    EAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP  365
                  TP ++            P+QA    ++  N+  R  +NAT +        P+ 
Sbjct  32705  PV--TPKSD-----------VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIV  32748


 Score = 64.1 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 71/188 (38%), Gaps = 10/188 (5%)

Query  146    AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
              A +  +K      E  +     S+     S + A  E   ++    +CV+++ GS  +  
Sbjct  27213  ATVAWKKDGQVLRETTRVNVASSKTVTTLSIKEASREDVGTY---ELCVSNTAGSI-TVP  27268

Query  206    QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
               T       +P PP  I +  V  +   +S++W  P  ++       + +  R   S T+
Sbjct  27269  ITVIVLD--RPGPPGPIRIDEV--SCDNVSISWNPPE-YDGGCQISNYIVEKRETTSTTW  27323

Query  266    TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
                      +    I    +G  +  ++ A+  +G+  +SE S      P++    PP   
Sbjct  27324  QVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFS-PPGPPGTP  27382

Query  326    EVSTPMQA  333
              +V    ++
Sbjct  27383  KVVHATKS  27390


 Score = 63.7 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 55/146 (38%), Gaps = 6/146 (4%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              S+ + +  G K       +      P P A++ V+ V +      V+W  P + +     
Sbjct  20466  SLTLVNPAGEKA-VFVNVKVLD--TPGPVADLKVSDVTKTS--CHVSWAPPEN-DGGSQV  20519

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    KT++T   +  +    + +   G  +  ++ A  E+G G  ++     
Sbjct  20520  THYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPV  20579

Query  311    MGTPWTESRSPPAENEVSTPMQALTT  336
              + +       PP + EV+   +   T
Sbjct  20580  LASDPLSEPDPPRKLEVTEMTKNSAT  20605


 Score = 63.3 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/114 (23%), Positives = 52/114 (46%), Gaps = 8/114 (7%)

Query  188    YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
              YI+++   +S G K   T   +      P PP N+TV  V+++  +  VTW DP   +  
Sbjct  21553  YILTLE--NSCGKKE-YTIVVKVLD--TPGPPVNVTVKEVSKDSAY--VTW-DPPIIDGG  21604

Query  248    FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                 + + +  R    K+++T   +  +    + +   G  +  ++ A+ E+G G
Sbjct  21605  SPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIG  21658


 Score = 62.5 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 86/268 (32%), Gaps = 26/268 (10%)

Query  80     RLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP  136
               L L SV   DSG+Y+      +G  + T+ L V   P  P      K      +  W P
Sbjct  21141  TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEP  21200

Query  137    RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                    +     ++ K + S     Q            SC +     +   Y   +C  +
Sbjct  21201  PLEDGGSEITNYIIDKRETSRPNWAQVSATVPIT----SCTVEK-LIEGHEYQFRICAEN  21255

Query  197    SVGSKFSKTQTFQGCGILQ-----P---DPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
                G             I +     P   DPP    ++ + +    ++V+W+ P   +   
Sbjct  21256  KYG--VGDPI-LTEPAIAKNPYDPPGRCDPP---VISNITK--DHMTVSWKAPAD-DGGS  21306

Query  249    YRLRFELRYRAERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                  + +  R  ++  +T    K  ++          G  +  ++ A  + G G+ S+ S
Sbjct  21307  PITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDAS  21366

Query  308    PEAMGTPWTESRSPPAENEVSTPMQALT  335
                           PPA  +V    ++  
Sbjct  21367  KAVYAQDPLYPPGPPAFPKVYDTTRSSV  21394


 Score = 62.5 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 51/306 (17%), Positives = 101/306 (33%), Gaps = 30/306 (10%)

Query  58     VHWVLRKPAAGSHPSRWAGMGRR-LLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVP  113
              V W   +                 L++ +V   DSG Y+      +G     V++ V   
Sbjct  26928  VKWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDS  26987

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR--STPSLTTKAVLLVRKFQNSPAEDFQEPCQ---YS  168
              P  P     R+    +V   W P      +  T  ++  R+            C    + 
Sbjct  26988  PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKNTFK  27047

Query  169    QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
               E+ +  C        S+ Y + +   ++   K S+           P PP  +T+  V 
Sbjct  27048  IENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEP----------PLPPGRVTLVDVT  27097

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              RN    ++ W+ P S +       + +  + + S+ ++    +       I    +G  +
Sbjct  27098  RNTA--TIKWEKPES-DGGSKITGYVVEMQTKGSEKWSACT-QVKTLETTISGLTAGEEY  27153

Query  289    VVQLRAQEEFGQGEWSEWSPEAMGTP--WTESRSPPAENEVSTPMQALTTNKDDDNILFR  346
              V ++ A  E G+ +     P  +G P    +    P+             ++   +I F+
Sbjct  27154  VFRVAAVNEKGRSD-----PRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLKIDIPFK  27208

Query  347    DSANAT  352
                  AT
Sbjct  27209  GRPQAT  27214


 Score = 61.0 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/247 (15%), Positives = 82/247 (33%), Gaps = 35/247 (14%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP  P+++   K+   ++   W  P            L  + ++  +  + +  + +   
Sbjct  28857  PPSIPEVTKITKN---SMTVVWDRPTVDGGSEINGYFL--ERRDKKSLAWLKVLKETIRD  28911

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCG--ILQPDPPANITVTAVA  228
               +          ++S Y   +C  ++ G   FS+   F      I  P PPA I +    
Sbjct  28912  TRQKVT---GLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADST  28968

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV--KDLQHHCVIHDAWSGL  286
              ++   +++ W  P  ++       + +  +    + +T      +      V+ +   G+
Sbjct  28969  KSS--ITLGWSKP-VYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLKPGV  29025

Query  287    RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFR  346
               +  Q+ A    GQG                   P    E +     L   + D ++  R
Sbjct  29026  NYYFQVSAVNCAGQG------------------EPITMTEPAQAKDVLEEPEIDLDVALR  29067

Query  347    DSANATS  353
               S  A +
Sbjct  29068  TSVIAKA  29074


 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 47/310 (15%), Positives = 98/310 (32%), Gaps = 45/310 (15%)

Query  15     APGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP---AAGSHP  71
              +    L     P        +T+  G++  L+C  V       + W         +  + 
Sbjct  32311  SVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVG-RPLPDIKWYRFGKELIQSRKYK  32369

Query  72     SRWAGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE-EPQLSCFRKSPL  127
                  G    L + + +  D G Y+C      G    +  LL+   P+  P      K   
Sbjct  32370  MSSDGRTHTLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFHPGYPLKEK-YY  32428

Query  128    SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
                V            T +  ++           F     + Q+  + S ++ +   +   
Sbjct  32429  GAV----------GSTLRLHVMYIGRPVPAMTWF-----HGQKLLQNSEKITIENTEHYT  32473

Query  188    YIV--SMCVASSVGSK----FSKTQTFQGCGIL----QPDPPAN-ITVTAVARNPRWLSV  236
              ++V  ++   +  G       +   T      +    +PD P   I + A+ +N   + +
Sbjct  32474  HLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNS--VVI  32531

Query  237    TWQDPH----SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
              +W+ P     SW +++   + E    A+    +           C I +      +  ++
Sbjct  32532  SWKPPADDGGSWITNYVVEKCE----AKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRV  32587

Query  293    RAQEEFGQGE  302
               AQ  FG  E
Sbjct  32588  SAQNTFGISE  32597


 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 94/306 (31%), Gaps = 35/306 (11%)

Query  147    VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ  206
               +  +K      +  +   + +  S   +    V      +    +   ++VG       
Sbjct  22885  TVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYP---LTAKNTVGEV-GDVI  22940

Query  207    TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
              T Q   I  P PP    +     +  +++ +W+ P + +       + +  R   S T+ 
Sbjct  22941  TIQVHDI--PGPPTG-PIKFDEVSSDFVTFSWEPPEN-DGGVPISNYVVEMRQTDSTTWV  22996

Query  267    TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
                    ++         +G+ +  ++RAQ  +G G     +      P+ +   PP    
Sbjct  22997  ELATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASVVANYPF-KVPGPPG---  23052

Query  327    VSTPMQALTTNKDDDNILFRDSANATSLPVQ----DSSSVPLPTFLVAGGSLAFGTLL-C  381
                   Q     KD   I + +  +    P+     +        +     +L  G +   
Sbjct  23053  ---TPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKS  23109

Query  382    IAIVLRFKKTWKLRALK-EGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSD  440
                +       +++ A    GK+    P            P   L P I PP  P  L   
Sbjct  23110  TGLTDGIAYEFRVIAENMAGKSKPSKP----------SEPMFALDP-IDPPGKPVPL---  23155

Query  441    NTSSHN  446
              N + H 
Sbjct  23156  NITRHT  23161


 Score = 58.7 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 65/197 (33%), Gaps = 13/197 (7%)

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR-STPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              P  P            V   W P         T  V+ +R          +     +  +
Sbjct  14980  PGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELR-----DKTSIRWDTAMTVRA  15034

Query  172    QKFSCQLA-VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG-ILQPDPPANITVTAVAR  229
              +  S  +  V EG    + V       VG   + T   +    I +P PP N+   A  +
Sbjct  15035  EDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNL--NASEQ  15092

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRH  288
                  + +TW+ P   +     L + +  R E    +    +K + +    +     G ++
Sbjct  15093  TQSSVQLTWEPPLK-DGGSPILGYIIERREEGKDNWIRCNMKPVPELTYKVTGLQKGNKY  15151

Query  289    VVQLRAQEEFGQGEWSE  305
              + ++ A+   G  + SE
Sbjct  15152  LYRVSAENAAGVSDPSE  15168


 Score = 58.7 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 55/150 (37%), Gaps = 10/150 (7%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +   +  GS  +   T       +P P  N+ +T V  +    ++ W  P   +     
Sbjct  20064  VITATNPAGSFVAY-ATVNVLD--KPGPVRNLKITDV--SSDRCTIRWDPPE--DDGGCE  20116

Query  251    LRFELRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              ++  +  + E  +  ++T+    L     +     G  ++ ++RA+ + G G  +E  P 
Sbjct  20117  IQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPV  20176

Query  310    AMGTPWT--ESRSPPAENEVSTPMQALTTN  337
                 T +       PP   +VS     +  N
Sbjct  20177  IAKTKYDRPGRPDPPEVTKVSKEEMTVVWN  20206


 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 50/323 (15%), Positives = 96/323 (30%), Gaps = 21/323 (7%)

Query  11     ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
               +L  P  A      P+ ++     +   G+ + +  P V       + WV         
Sbjct  26086  RVLGIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIP-VIGRPRPKISWVKDGEPLKQT  26144

Query  71     PS---RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQL----SCFR  123
                           L ++     D G YS             L  +  E+P        F 
Sbjct  26145  TRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFD  26204

Query  124    KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG  183
              +     VV  W P +       +  +V K   +           ++ + K S        
Sbjct  26205  EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTTIKIS-----KLK  26259

Query  184    DSSFYIVSMCVASSVGSKF---SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
                + Y   +   +  G      SK    Q     +P PP    VT++++    + V W +
Sbjct  26260  TGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFK-EPGPPGTPFVTSISK--DQMLVQWHE  26316

Query  241    PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFG  299
              P + +       + L  + + S  +       +Q           GL +  ++ A+   G
Sbjct  26317  PVN-DGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVG  26375

Query  300    QGEWSEWSPEAMGTPWTESRSPP  322
               G+ S+ S   +     +    P
Sbjct  26376  IGKPSKVSECYVARDPCDPPGRP  26398


 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 55/330 (17%), Positives = 104/330 (32%), Gaps = 27/330 (8%)

Query  22     PRRCPAQEVAR-GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM---  77
                + P  ++   GVLT   GD++ L   GV  +    V W   K A     S    +   
Sbjct  19986  DLQKPVLDLKLSGVLTVKAGDTIRLE-AGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTS  20044

Query  78     --GRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVC  132
                  +  L   +  D G Y        G       + V   P   +              
Sbjct  20045  AESSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTI  20104

Query  133    EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
               W P           +     +   ++        +      +    + EG+   YI  +
Sbjct  20105  RWDPPEDDG---GCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNE--YIFRV  20159

Query  193    CVASSVGS---KFSKTQTFQGCGIL--QPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
                 + +G+     SK    +       +PDPP    VT V++    ++V W  P  ++  
Sbjct  20160  RAENKIGTGPPTESKPVIAKTKYDRPGRPDPPE---VTKVSKEE--MTVVWNAPE-YDGG  20213

Query  248    FYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
                   + L  + + +  +       + +    + +   G  +  +++A+ E G GE S  
Sbjct  20214  KSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLP  20273

Query  307    SPEAMGTPWTESRSPPAENEVSTPMQALTT  336
              S   +     E   PP   +V    ++  T
Sbjct  20274  SRPVVAKDPIEPPGPPTNFKVVDTTKSSIT  20303


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/230 (17%), Positives = 78/230 (34%), Gaps = 22/230 (10%)

Query  136    PRSTPSLTTKAV---LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE---GDSSFYI  189
              P       T         +  +         P     E+ + S  + +PE     S  Y 
Sbjct  17620  PAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECTRAHSGKY-  17678

Query  190    VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
               S+   +  G K +     +      P PP ++ V+ + R      ++W+ P   +    
Sbjct  17679  -SITAKNKAGQKTAN-CRVKVMD--APGPPKDLKVSDITRGS--CRLSWKMPD--DDGGD  17730

Query  250    RLR-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
              R++ + +  +    K +T           V+ D  S  ++  ++RA+  FG G      P
Sbjct  17731  RIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIG------P  17784

Query  309    EAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
               A     T +R P    +    ++     K+  ++ ++   N    PV  
Sbjct  17785  PAETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTH  17834


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 44/336 (13%), Positives = 89/336 (26%), Gaps = 30/336 (9%)

Query  17     GAALAP---RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
                A+        P    A  + T +  +S  LT      +  + +          +    
Sbjct  15561  ATAVVEVNVLDKPGPPAAFDI-TDVTNESCLLTWNPPRDDGGSKIT-NYVVERKATDSDV  15618

Query  74     WAGMGRRLLL---RSVQLHDSGNYSCYRA-------GRPAGTVHLLVDV---PPEEPQLS  120
              W  +   +     ++ +L  +  Y    A       G P     ++      PP  P   
Sbjct  15619  WHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAAPIIAKYQFDPPGPPTRL  15678

Query  121    CFRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA  179
                       V   W  P            +  +  +   + +    +      K +    
Sbjct  15679  EPSDITKDAVTLTWCEPDDDGGSPITGYWV--ERLDPDTDKWVRCNKMPV---KDTTYRV  15733

Query  180    VPEGDSSFYIVSMCVASSVG--SKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSV  236
                  +   Y   +   +  G       T+       + P  PP   TV  + +    L +
Sbjct  15734  KGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGKTS--LVL  15791

Query  237    TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQE  296
               W  P   +       + +      +  +            ++     G  +  ++RA  
Sbjct  15792  NWTKPEH-DGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVN  15850

Query  297    EFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQ  332
              + G+ E SE S   +        SPP   EV    +
Sbjct  15851  KAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK  15886


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/192 (15%), Positives = 73/192 (38%), Gaps = 22/192 (11%)

Query  153    FQNSPAEDFQEPCQYSQESQKFSCQLAV-PEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
                    ED + P +   +      +L +         I S+ V +  G+K   T + +  
Sbjct  19038  KVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGTK---TVSVKVL  19094

Query  212    GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
               + +P PP ++ V+ + ++  +L  TW++P   +       + +  +   +  ++     
Sbjct  19095  VLDKPGPPRDLEVSEIRKDSCYL--TWKEPLD-DGGSVVTNYVVERKDVATAQWSPLSTT  19151

Query  272    DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM  331
                +   +      G +++ ++ A+ ++G+G            P+ E+  P    +   P+
Sbjct  19152  SKKKSHMAKHLTEGNQYLFRVAAENQYGRG------------PFVETPKPIKALD---PL  19196

Query  332    QALTTNKDDDNI  343
                    KD  ++
Sbjct  19197  HPPGPPKDLHHV  19208


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/265 (15%), Positives = 91/265 (34%), Gaps = 26/265 (10%)

Query  58     VHWVLRKPAAGSHPSRWAGMGRR-LLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVP  113
              + W   +           G+    L + +   +D+G Y       +G  +  V + V   
Sbjct  25845  ITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDT  25904

Query  114    PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
              P  PQ    ++    +V+  W P            +     +      +     S +  K
Sbjct  25905  PGPPQNLAVKEVRKDSVLLVWEPPIIDG----GAKVKNYVIDKRESTRKAYANVSSKCNK  25960

Query  174    FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITVTAVAR  229
               S ++     + + Y   +   +  G         +    ++    P PP  +T+T V++
Sbjct  25961  TSFRVE-NLTEGAIYYFRVMAENEFGVG----VPTETSDAVKASEPPSPPGKVTLTDVSQ  26015

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                   S+ W+ P   +     L + +  + + ++ ++    +    + V+    SG  + 
Sbjct  26016  TSA--SLMWEKPEH-DGGSRILGYVVEMQPKGTEKWSVV-AESKVCNAVVSGLSSGQEYQ  26071

Query  290    VQLRAQEEFGQGEWSEWSPEAMGTP  314
               +++A  E G+ +     P  +G P
Sbjct  26072  FRVKAYNEKGKSD-----PRVLGIP  26091


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 58/168 (35%), Gaps = 7/168 (4%)

Query  157    PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFY-IVSMCVASSVGSKFSKTQTFQGCGILQ  215
                E  ++  + + E    S  L + E     +   S+   +S G+  ++  +       +
Sbjct  26137  DGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTA-TENLSVIVLE--K  26193

Query  216    PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
              P PP    V     +  ++ ++W+ P           + +  R   +  +        + 
Sbjct  26194  PGPPVG-PVKFDEVSADFVVISWEPPAYTGGCQIS-NYIVEKRDTTTTNWQMVSATVART  26251

Query  276    HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                 I    +G  +  ++ A+  +G+    +  P  +  P+ E   PP 
Sbjct  26252  TIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKE-PGPPG  26298


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 90/287 (31%), Gaps = 19/287 (7%)

Query  16     PGAALAPRRCPAQEVARGVLTSLP---GDSVTLTCPGVEPEDNATVHWVLRKPAAGSH-P  71
              P  A      P  +V   +  +L    G S T+T P         V W        +   
Sbjct  27963  PQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVP-FRGRPIPNVSWSKPDTDLRTRAY  28021

Query  72     SRWAGMGRRLLLRSVQLHDSGNYSCYRAGRP-AGTVHLLVDVP--PEEPQLSCFRKSPLS  128
                       L + +   +DSG Y+        A ++  +V V   P  P     R+    
Sbjct  28022  IDSTDSRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKE  28081

Query  129    NVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
                +  W  P +      K    + K + S           +    + S ++     + + 
Sbjct  28082  TAMLSWDVPENDGGAPVK-NYHIEKREASKKAWVSV----TNNCNRLSYKVT-NLQEGAI  28135

Query  188    YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
              Y   +   +  G               +P PP  + VT+V+++   +S++W  P   +  
Sbjct  28136  YYFRVSGENEFGVGVPAETKEGVKITEKPSPPEKLGVTSVSKDS--VSLSWLKPEH-DGG  28192

Query  248    FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA  294
                 + + +    +  KT+    V     H V+        +  ++ A
Sbjct  28193  SRIIHYVVEALEKGQKTWVKCAVVK-TTHHVVSGLRESHEYFFRVFA  28238


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 51/133 (38%), Gaps = 8/133 (6%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              + V++ VG K   T   +   + +PDPP    V     +   ++++W  P    +   ++
Sbjct  25091  ITVSNVVGQK---TAAIEIITLDKPDPPKG-PVKFDEISAESITLSWNPP--LYTGGCQI  25144

Query  252    R-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + ++ R   +  +        +    +    +G  +  ++ A+  +GQ    E  P  
Sbjct  25145  TNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVV  25204

Query  311    MGTPWTESRSPPA  323
                 P+ E   PP 
Sbjct  25205  AQYPYKE-PGPPG  25216


 Score = 56.4 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 70/229 (31%), Gaps = 16/229 (7%)

Query  79     RRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
                L + +   +D+G Y+      +G+ + T  + V   P  P    F+     +    W 
Sbjct  30200  STLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWD  30259

Query  136    -PRSTPSLTTK-AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
               P           V+  R+      +   E C  +++  K S        +   Y   + 
Sbjct  30260  APLLDGGARIHHYVIEKREASRRSWQVVSEKC--TRQILKVS-----ELTEGVPYYFRVS  30312

Query  194    VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
                +  G               QP PP  + V   +++   L   W  P   +       +
Sbjct  30313  AENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVL--AWLKPDH-DGGSRITSY  30369

Query  254    ELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
               L  R + S  +        Q    +        +  +++A+ + G  E
Sbjct  30370  LLEMRQKGSDFWVEAGHTK-QLTFTVERLVENTEYEFRVKAKNDAGYSE  30417


 Score = 56.4 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 63/160 (39%), Gaps = 11/160 (7%)

Query  175    SCQLAVP---EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
              S  L VP     D+  Y +++   + +GS    T +     I  P P  +I  + + ++ 
Sbjct  16230  SAHLEVPKSVHADAGVYTITLE--NKLGSA---TASINVKVIGLPGPCKDIKASDITKSS  16284

Query  232    RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ  291
                  +TW+ P  ++     L + L  R    +T+   M  + +    + D      +  +
Sbjct  16285  --CKLTWEPPE-FDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFR  16341

Query  292    LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM  331
              ++A  + G GE+ E     +     +   PP + EV  P 
Sbjct  16342  VKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPT  16381


 Score = 56.0 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/258 (14%), Positives = 78/258 (30%), Gaps = 23/258 (9%)

Query  58     VHWVLRKPAAGSHPS-RWAGMGRRLLLRSVQL--HDSGNYSCY---RAGRPAGTVHLLVD  111
              + W                    R+ L+  +    D G Y       +G   G+  + V 
Sbjct  19729  ITWSKEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVL  19788

Query  112    VPPEEPQLSCFRKSPLSNVVCEW-GPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQ  169
                P   Q          N    W  P        T  ++  RK                 
Sbjct  19789  DRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSI--------V  19840

Query  170    ESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPPANITVTA  226
               S      +      ++ Y   +C  + VG   +  +KT       I +P  P N+ +  
Sbjct  19841  ASDVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIAD  19900

Query  227    VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSG  285
                +   ++ + W+ P  ++     L + +  R + S  +       ++  H ++      
Sbjct  19901  KGKT--FVYLKWRRPD-YDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVEN  19957

Query  286    LRHVVQLRAQEEFGQGEW  303
                +  +++ + E G+ +W
Sbjct  19958  QIYEFRVQTKNEGGESDW  19975


 Score = 56.0 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 60/152 (39%), Gaps = 10/152 (7%)

Query  173    KFSCQLAVPEGDSS---FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                +C L +P+   S    Y  S+   +++G+  SK       G  +P PP    +   + 
Sbjct  17965  DDTCTLVIPQSRRSDTGLY--SITAVNNLGTA-SKEMRLNVLG--RPGPPVG-PIKFESI  18018

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
              +   ++++W  P   +       + +  R    KT+     +  +    I     G  +V
Sbjct  18019  SADQMTLSWLPPKD-DGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYV  18077

Query  290    VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
               ++ AQ ++G GE  +  PE     ++   +P
Sbjct  18078  FRIMAQNKYGIGEPLDSEPETARNLFSVPGAP  18109


 Score = 56.0 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 60/156 (38%), Gaps = 11/156 (7%)

Query  179    AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTW  238
                   D+  YI+ +   +S GSK S   T +      P PP N+ V  V ++   + + W
Sbjct  25873  NCDRNDAGKYILKLE--NSSGSK-SAFVTVKVLD--TPGPPQNLAVKEVRKDS--VLLVW  25925

Query  239    QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
              + P   +       + +  R    K +     K  +    + +   G  +  ++ A+ EF
Sbjct  25926  EPP-IIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEF  25984

Query  299    GQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
              G G  +E S        +E  SPP +  ++   Q  
Sbjct  25985  GVGVPTETSDAVKA---SEPPSPPGKVTLTDVSQTS  26017


 Score = 55.6 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 53/158 (34%), Gaps = 6/158 (4%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ + +S G   ++T         +P PP    V         ++++W+ P  ++     
Sbjct  24008  TVKLTNSAGEA-TETLNVIVLD--KPGPPTG-PVKMDEVTADSVTLSWEPP-KYDGGSSI  24062

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R   +  +        +         +G  +  ++ A+  +G+  +    P  
Sbjct  24063  NNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVV  24122

Query  311    MGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
                 P+ +   PP    V+   +     +  + +    S
Sbjct  24123  AQYPF-KVPGPPGTPFVTLASKDSMEVQWHEPVSDGGS  24159


 Score = 55.6 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/274 (14%), Positives = 78/274 (28%), Gaps = 23/274 (8%)

Query  59     HWVLRKPAAGSHPSRWAGMGR---RLLLRSVQLHDSGNYSCYRAGRPAGTV---HLLVDV  112
               W                       L++   +  D G Y+              ++ V  
Sbjct  15216  TWTFGDQVLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEINVNVIA  15275

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPRST--PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP  P+   F      +V   W P      S  T  V+   + ++   + + +       
Sbjct  15276  PPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVV---EKRDMSRKTWTK-VMDFVT  15331

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVG----SKFSKTQTFQGCGILQPDPPANITVTA  226
                +F+    V   +   Y+  +C  +  G    +   +         + PDPP N+    
Sbjct  15332  DLEFTVPDLVQGKE---YLFKVCARNKCGPGEPAYTDEPVNMSAPATV-PDPPENVKWRD  15387

Query  227    VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL  286
                 N   + +TW  P + +       + +      S  +             +     G 
Sbjct  15388  RTANS--IFLTWDPPKN-DGGSRIKGYIVEKCPRGSDKWVACGEPVPDTKMEVTGLEEGK  15444

Query  287    RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
               +  +++A    G  + S+ + E       E+  
Sbjct  15445  WYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPE  15478


 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 45/327 (14%), Positives = 97/327 (30%), Gaps = 33/327 (10%)

Query  13     LAAPGAALAPRRCPAQEVARGVLTS------LPGDSVTLTCPGVEPEDNATVHWVLRKPA  66
              LA P  A          +   V  +        G  + +  P +      ++ W      
Sbjct  25006  LAVPIIA------KDLVIEPDVRPAFSSYSVQVGQDLKIEVP-ISGRPKPSISWTKDGMP  25058

Query  67     AGSHPSRWAGMG---RRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPEEPQ-L  119
                               L ++     D G Y        G+    + ++    P+ P+  
Sbjct  25059  LKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGP  25118

Query  120    SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA  179
                F +    ++   W P            +V+K   +           S    + + ++ 
Sbjct  25119  VKFDEISAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVV----SATVARTTLKVT  25174

Query  180    VPEGDSSFYIVSMCVASSVGSK---FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
                +   + Y   +   +  G      S+    Q     +P PP    VTA+++    + V
Sbjct  25175  KLKT-GTEYQFRIFAENRYGQSFALESEPVVAQYPYK-EPGPPGTPFVTAISKES--MVV  25230

Query  237    TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQ  295
               W +P + N     + + L  +   S  +T      +        +   G+ +  ++ A+
Sbjct  25231  QWHEPIN-NGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAE  25289

Query  296    EEFGQGEWSEWSPEAMGTPWTESRSPP  322
                 G G+ S+ S   +     +    P
Sbjct  25290  NIVGVGKASKNSECYVARDPCDPPGTP  25316


 Score = 54.8 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/113 (19%), Positives = 46/113 (41%), Gaps = 8/113 (7%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++   +  G+K           +  P PP  I ++ V+      ++TW  P         
Sbjct  22240  TITATNPFGTKEEH-VKVSVLDV--PGPPGPIEISNVSAEKA--TLTWTPP--LEDGGSP  22292

Query  251    LRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
              ++  +  + E S+   T + +D+Q    V+     G  ++ ++ A   +G+GE
Sbjct  22293  IKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGE  22345


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/169 (15%), Positives = 56/169 (33%), Gaps = 8/169 (5%)

Query  136    PRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD-SSFYIVSMC  193
              P     L   K      +       D     +      +   +L++P+         ++ 
Sbjct  17208  PADVTGLPMPKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTIT  17267

Query  194    VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP-HSWNSSFYRLR  252
               ++ +GS F +    +     +P PP N+ VT +     +L  TW  P  +  S      
Sbjct  17268  ASNRLGSVF-RNVHVEVYD--RPSPPRNLAVTDIKAESCYL--TWDAPLDNGGSEITHYI  17322

Query  253    FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
               + R  + +   +       ++    I       ++  ++RA  ++G  
Sbjct  17323  IDKRDASRKKSEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGIS  17371


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/270 (15%), Positives = 83/270 (31%), Gaps = 37/270 (14%)

Query  57     TVHWVLRKPAAGSHPSRWAGMGR----------RLLLRSVQLHDSGNYSCYRAGRPAGTV  106
              T+ W    P                         L++   +  D+G YS           
Sbjct  17936  TLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTAS  17995

Query  107    -HLLVDVP--PEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLT--TKAVLLVRKFQNSPAED  160
                + ++V   P  P     F       +   W P      +  T  V+   + + +  + 
Sbjct  17996  KEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVI---EKREANRKT  18052

Query  161    FQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKF---SKTQTFQGCGILQP  216
              +         S+   C   +P+      Y+  +   +  G      S+ +T +    + P
Sbjct  18053  WVR-----VSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV-P  18106

Query  217    DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH-  275
                P   TV++V RN   ++V W++P  ++       + L  +   SK +       ++  
Sbjct  18107  GAPDKPTVSSVTRNS--MTVNWEEPE-YDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM  18163

Query  276    ----HCVIHDAWSGLRHVVQLRAQEEFGQG  301
                     +     G  +  ++ A    G G
Sbjct  18164  TLGVSYKVTGLIEGSDYQFRVYAINAAGVG  18193


 Score = 53.3 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 48/273 (18%), Positives = 79/273 (29%), Gaps = 42/273 (15%)

Query  50     VEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNY---SCYRAGRPAGTV  106
               E E+  ++    R     S          +L +R     D G Y        G      
Sbjct  16529  AEEEEPFSLPLTERLSINNSKQGE-----SQLRIRDSLRPDHGQYMIKVENDHGVAKAPC  16583

Query  107    HLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR-STPSLTT-KAVLLVRKFQNSPAEDFQ--  162
               + V   P  P    F      +V+C+W P             L  +      ++     
Sbjct  16584  SVSVLDTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVIT  16643

Query  163    ---EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK---FSKTQ----TFQGCG  212
                   C+YS               +   Y+  +   +  G      SK       F+   
Sbjct  16644  STLRNCKYSVT----------KLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFEP--  16691

Query  213    ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
                 PD P    V  V  N     V W +P   ++    L + L  R   S  ++      
Sbjct  16692  ---PDAPDKPIVEDVTSNSML--VKWNEPK--DNGSPILGYWLEKREVNSTHWSRVNKTL  16744

Query  273    LQH-HCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              L      +     GL +V ++ A+   G G++S
Sbjct  16745  LSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFS  16777


 Score = 52.9 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/183 (17%), Positives = 62/183 (34%), Gaps = 11/183 (6%)

Query  152    KFQNSPAEDFQEPCQYSQESQKFSCQL-AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG  210
                  +  E+     +     QK +  +      D   Y + +    +VG   +   T + 
Sbjct  26531  SKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLS---NVGGTKTIPITVKV  26587

Query  211    CGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
                  +P PP   + VT V     +L   W  P     +     + +  R     ++T   
Sbjct  26588  LD--RPGPPEGPLKVTGVTAEKCYL--AWNPPLQDGGASIS-HYIIEKRETSRLSWTQVS  26642

Query  270    VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
               +    +  +     G  ++ ++ A  ++G GE  E  P     P+ +   PP+  E S 
Sbjct  26643  NEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPY-KRPGPPSTPEASA  26701

Query  330    PMQ  332
                +
Sbjct  26702  ITK  26704


 Score = 52.9 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 71/217 (33%), Gaps = 20/217 (9%)

Query  114    PEEPQLSCFRKSPLSNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSP-AEDFQEPCQYSQE  170
              P +P +     +   +++ +W  P S      +  ++  R+ ++       ++   Y   
Sbjct  31029  PSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTR  31088

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCG--ILQPDPPANITVTAV  227
               +  S            Y   +   ++ G+   S+   F  C      P PP+   V  V
Sbjct  31089  LKVTSLMEGCD------YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRV--V  31140

Query  228    ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWSG  285
                  R +S+ W  P  ++     + + L  + + +  +           +   + D   G
Sbjct  31141  DTTKRSISLAWTKP-MYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLKMG  31199

Query  286    LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
               ++  ++ A    G    S++S         E    P
Sbjct  31200  QKYSFRVAAVNAKGM---SDYSETTAEIEPVERLEIP  31233


 Score = 52.9 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 53/139 (38%), Gaps = 8/139 (6%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              +  ++  GSK S     +     +P PP   + VT V       ++ W  P     S   
Sbjct  25487  LRASNVAGSK-SFPVNVKVLD--RPGPPEGPVQVTGVTAE--KCTLAWSPPLQDGGSDIS  25541

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R      +T    + + +   +     G +++ ++ A  ++G GE  E +P  
Sbjct  25542  -HYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVL  25600

Query  311    MGTPWTESRSPPAENEVST  329
              M  P+     PP   EV+ 
Sbjct  25601  MKNPFV-LPGPPKSLEVTN  25618


 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/147 (20%), Positives = 57/147 (39%), Gaps = 13/147 (9%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ + +S G+K S   T +      P PP N+ VT + ++   +S+TW+ P   +     
Sbjct  24801  TLTLENSSGTK-SAFVTVRVLD--TPSPPVNLKVTEITKDS--VSITWEPP-LLDGGSKI  24854

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    K++   +    ++   I     G  +  ++ A+ E+G G      P  
Sbjct  24855  KNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGL-----PAR  24909

Query  311    MGTP--WTESRSPPAENEVSTPMQALT  335
                 P    E   PP +  V    +   
Sbjct  24910  TADPIKVAEVPQPPGKITVDDVTRNSV  24936


 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/205 (16%), Positives = 67/205 (33%), Gaps = 26/205 (13%)

Query  136    PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA---VPEGDSSFYIVSM  192
              P     +                +D      Y+ E+  FS  L        D+  Y   +
Sbjct  19320  PAIIRGVPVPTAKWTTDGTEIKTDDH-----YTVETDSFSSVLTIKNCLRKDTGEY--QL  19372

Query  193    CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
               V+++ G+K           +  P PP    +  +   P +++++WQ P   +     + 
Sbjct  19373  TVSNAAGTKTVAVH-LTVLDV--PGPPTG-PINILDVTPEYMTISWQPPKD-DGGSPVIN  19427

Query  253    FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
              + +  +  R  T+        +    +     G  +V +++A+ + G G      P    
Sbjct  19428  YIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVG------PPLDS  19481

Query  313    TPWT-----ESRSPPAENEVSTPMQ  332
               P          SPP +  V+   +
Sbjct  19482  IPTVAKHKFSPPSPPGKPVVTDITE  19506


 Score = 51.7 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/260 (15%), Positives = 85/260 (33%), Gaps = 28/260 (11%)

Query  58     VHWVLRKPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVD  111
              + W                       L   +V  +D+G Y        G+   T+ + V 
Sbjct  21514  ITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL  21573

Query  112    VPPEEPQLSCFRKSPLSNVVCEWGPRS-TPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQ  169
                P  P     ++    +    W P            V+   + +++  + +      + 
Sbjct  21574  DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVV---EKRDAERKSWSTV---TT  21627

Query  170    ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITVT  225
              E  K S +++  E +   Y   +   +  G         +    ++    P P  ++   
Sbjct  21628  ECSKTSFRVSNLE-EGKSYFFRVFAENEYGI--GDPG--ETRDAVKASETPGPVVDLKAL  21682

Query  226    AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              A+ ++    ++ W+ P S +       + + +  E +K +   M K L       D   G
Sbjct  21683  AITKSS--CTIGWKKPRS-DGGSRITGYVVDFLTEENK-WQRVM-KSLSLQYSTKDLKEG  21737

Query  286    LRHVVQLRAQEEFGQGEWSE  305
                +  ++ A+ E G+G  SE
Sbjct  21738  KEYTFRVSAENENGEGTPSE  21757


 Score = 51.7 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/133 (23%), Positives = 51/133 (38%), Gaps = 11/133 (8%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ + + V S  S T   +      P PPANITV  V +    L  +W  P   N     
Sbjct  28045  TLTIQN-VLSAASMTFVVKVLD--SPGPPANITVREVTKETAML--SWDVPE--NDGGAP  28097

Query  251    LR-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              ++ + +  R    K + +      +    + +   G  +  ++  + EFG G     +  
Sbjct  28098  VKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVP---AET  28154

Query  310    AMGTPWTESRSPP  322
                G   TE  SPP
Sbjct  28155  KEGVKITEKPSPP  28167


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 58/366 (16%), Positives = 107/366 (29%), Gaps = 42/366 (11%)

Query  14     AAPGAALAPRRCPAQEVARGVL--TSLPGDSVTLTCPGVEPEDNATVH--WVLRKPAAGS  69
              AAP  A      P        L  + +  D+VTLT    + +  + +   WV R      
Sbjct  15660  AAPIIAKYQFDPP---GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTD  15716

Query  70     HPSRWAGM-GRRLLLRSVQLHDSGNYSCYRAGRPA--------GTVHLLVD------VPP  114
                 R   M  +    R   L +   Y                  T  +L+        PP
Sbjct  15717  KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPP  15776

Query  115    EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
               +P +    K+ L  V+    P        ++ ++      +             E    
Sbjct  15777  GKPTVKDIGKTSL--VLNWTKPEHDGGAKIESYVIEMLKTGTD------EWVRVAEGVPT  15828

Query  175    SCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQT--FQGCGILQPDPPANITVTAVARNP  231
              +  L     +   Y   +   +  G    S+          +  P PP  + V  + +N 
Sbjct  15829  TEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT  15888

Query  232    RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ  291
                L   W  P   +       + +  R  R K + T         C +     G  +V +
Sbjct  15889  ADL--KWTVPEK-DGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFR  15945

Query  292    LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANA  351
              + A+   GQ +++E     +      +  PP        +  +   K   ++ +    N 
Sbjct  15946  VAAENAIGQSDYTEIGDSVLAKDTFTTPGPP------YALTVVDVTKRHVDLKWEPPKND  15999

Query  352    TSLPVQ  357
                 P+Q
Sbjct  16000  GGRPIQ  16005


 Score = 51.0 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 46/142 (32%), Gaps = 8/142 (6%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              +   +  G         +     +P PP   + V+ V        ++W  P   +     
Sbjct  23323  LTATNPGGFAK-HIFNVKVLD--RPGPPEGPLAVSDV--TSEKCVLSWLPPLD-DGGAKI  23376

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + ++ R      +T    +       +     G  ++ ++ A  ++G GE  E S   
Sbjct  23377  DHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-SEPV  23435

Query  311    MGTPWTESRSPPAENEVSTPMQ  332
              +         PP   EV+T  +
Sbjct  23436  LAVDPYGPPDPPKNPEVTTITK  23457


 Score = 50.6 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/187 (15%), Positives = 56/187 (30%), Gaps = 18/187 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP +P +          +   W  P            + +K +NS           S   
Sbjct  29548  PPGKPVIY---NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPIS---  29601

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQP-DPPANITVTAVAR  229
                     A    +   Y   +   +S G S  S    F     + P DPP   T   +  
Sbjct  29602  --GREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLA--VSPVDPPG--TPDYIDV  29655

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRH  288
                  +++ W  P   +     + + +  + + S  +      D+ +    +     G R+
Sbjct  29656  TRETITLKWNPPLR-DGGSKIVAYSIE-KRQGSDRWVRCNFTDVSECQYTVTGLSPGDRY  29713

Query  289    VVQLRAQ  295
                ++ A+
Sbjct  29714  EFRIIAR  29720


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/163 (15%), Positives = 61/163 (37%), Gaps = 16/163 (10%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDP----HSWNS  246
              +  A+S G+  +           +P PP   + ++ +      +++ W+ P     S  +
Sbjct  28338  ITAANSSGTTKTF-INIIVLD--RPGPPTGPVAISDITEES--VTLKWEPPKYDGGSHVT  28392

Query  247    SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
              ++  L+     R   +  ++       +    +    +G  +  +++A+  FG  +  + 
Sbjct  28393  NYIVLK-----RETSTAVWSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDS  28447

Query  307    SPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
                  +  P+T +  PP+   VS   +   T    + +    SA
Sbjct  28448  VCVVVKLPYT-TPGPPSTPWVSNVTRESITVGWHEPVSNGGSA  28489


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/322 (13%), Positives = 87/322 (27%), Gaps = 50/322 (16%)

Query  139    TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
              T      A       +   +E                       G+ +  + ++      
Sbjct  31552  TGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGT---  31608

Query  199    GSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELR  256
                  S+T         +P PP   I +  +      ++++W+ P         L  + + 
Sbjct  31609  ---TSETIKVIILD--KPGPPTGPIKIDEIDATS--VTISWEPPE--LDGGAPLSGYVVE  31659

Query  257    YRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT  316
               R      +        +          G  +V ++ A   FG G + + S         
Sbjct  31660  QRDAHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRVAATNRFGIGSYLQ-SEVIECRSSI  31718

Query  317    ESRSPP-----------AENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP  365
                  PP                  P +    ++    I+ R    A      +   V + 
Sbjct  31719  SIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMT  31778

Query  366    TFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERP-RPTPVL  424
               +   G            ++   +   ++ A+    T            P RP +PT  +
Sbjct  31779  RYRSTG------------LIEGLEYEHRVTAINARGTGK----------PSRPSKPTVAM  31816

Query  425    VPLISPPVSPSSLGSDNTSSHN  446
               P I+PP  P +    +T+  +
Sbjct  31817  DP-IAPPGKPQNPRVTDTTRTS  31837


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 57/326 (17%), Positives = 98/326 (30%), Gaps = 31/326 (10%)

Query  33     GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA---AGSHPSRWAGMGRRLLLRSVQLH  89
                +T   G++  L    V      T+ W          G    + A     L+ +     
Sbjct  23258  DTITLKAGEAFKLEAD-VSGRPPPTMEWTKDGKELEGTGKLEIKIADFSTHLINKDSSRT  23316

Query  90     DSGNYSCYR---AGRPAGTVHLLVDVPPEEPQ--LSCFRKSPLSNVVCEWGPRSTPSLTT  144
              DSG Y        G      ++ V   P  P+  L+    +    V+    P        
Sbjct  23317  DSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKI  23376

Query  145    KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF--  202
                  +V+K + S         +      K +  L   E     YI  +   +  G     
Sbjct  23377  DH-YIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNE-----YIFRVMAVNKYGVGEPL  23430

Query  203    -SKT-QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAE  260
               S+        G   PDPP N  VT + ++   + V W  P S +     + + +  R +
Sbjct  23431  ESEPVLAVDPYG--PPDPPKNPEVTTITKDS--MVVCWGHPDS-DGGSEIINYIVERRDK  23485

Query  261    RSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
                + +     K L      +     G  +  ++ A+   G    S  SP           
Sbjct  23486  AGQRWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKP  23545

Query  320    SPPAENEVSTPMQALTTNKDDDNILF  345
               PP       P   L T++   +I +
Sbjct  23546  GPPG-----NPR-VLDTSRSSISIAW  23565


 Score = 49.4 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 53/162 (33%), Gaps = 26/162 (16%)

Query  189    IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
              I ++ + + V    S         I  P  P  +  + + ++   + +TW+ P   +   
Sbjct  15253  IYTLTLENPV-KSISGEINVNV--IAPPSAPKELKFSDITKDS--VHLTWEPPD--DDGG  15305

Query  249    YRLR-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                L  + +  R    KT+T  M         + D   G  ++ ++ A+ + G G      
Sbjct  15306  SPLTGYVVEKRDMSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPG------  15359

Query  308    PEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
                           P   +E        T     +N+ +RD  
Sbjct  15360  ------------EPAYTDEPVNMSAPATVPDPPENVKWRDRT  15389


 Score = 49.0 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 59/334 (18%), Positives = 104/334 (31%), Gaps = 41/334 (12%)

Query  32     RGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA-AGSHPSRWAGMGRRLLLRSVQL--  88
              R  LT   G+S  LT      +    + W   +        +        L L   +   
Sbjct  18614  RDKLTVRVGESFALT-GRYSGKPKPKIDWFKDEADVLEDDRTHIKTTPTTLALEKTKAKR  18672

Query  89     HDSGNYSCYRAGRPAGTVHLLVDV-------PPEEPQLSCFRKSPLSNVVCEWGPR-STP  140
               DSG Y C       G+      V       PP  P +  F +     +V  W P     
Sbjct  18673  SDSGKY-CVVVENSTGSRKGFCQVNVVDRPGPPVGPVI--FDEVTKEYMVISWKPPLDDG  18729

Query  141    SLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG  199
                  T  ++   + +    + +      +  S K +C++     +   YI  +   +  G
Sbjct  18730  GSEITNYII---EKKELGKDIWM---PVTSASAKTTCKVPK-LLEGKDYIFRIHAENLYG  18782

Query  200    SKFSKTQTFQGC---GILQ-PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
                 S              + PD P    VT V ++     VTW  P+          + L
Sbjct  18783  I--SDPLVSDSMKAKDRFRVPDAPEQPVVTEVTKDSAL--VTWNKPNDGGKPI--TNYIL  18836

Query  256    RYRAERSKTFTTWMVKDLQ--HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT  313
                R   SK +     + +       + D   G ++  ++ A+ E G G+ S  S      
Sbjct  18837  EKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFA-  18895

Query  314    PWTESRSPPAENEVSTPMQALTTNKDDDNILFRD  347
                   R P A+       +A+ T  +   + ++ 
Sbjct  18896  -----RDPIAKPSPPINPEAIDTTCNSVELTWQP  18924


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 53/137 (39%), Gaps = 9/137 (7%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ V ++ G K     TF    +  P PP  IT   V R     ++ W  P   +     
Sbjct  30216  TLTVENNSGKKS---ITFTVKVLDSPGPPGPITFKDVTRGSA--TLMWDAP-LLDGGARI  30269

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    +++     K  +    + +   G+ +  ++ A+ E+G GE  E     
Sbjct  30270  HHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPI  30329

Query  311    MGTPWTESRSPPAENEV  327
              + T   E  +PP   +V
Sbjct  30330  VAT---EQPAPPRRLDV  30343


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/281 (11%), Positives = 81/281 (29%), Gaps = 27/281 (10%)

Query  50     VEPEDNATVHWVLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSGNYSCYRAGRPAGTVH  107
              VE  + + + W + +    +   +   +  G   + R   ++  G       G P  ++ 
Sbjct  27709  VEKRETSRLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYG------VGEPLESMA  27762

Query  108    LLVDVP---PEEPQLSCFRKSPLSNVV-CEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQ  162
              +    P   P  P           ++  C   P +      +  ++  R+  +       
Sbjct  27763  VKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVN  27822

Query  163    EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPP  219
              +   Y    +    +          Y   +   ++ G      +         +  P PP
Sbjct  27823  KKPVYDLRVKSTGLREGCE------YEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPP  27876

Query  220    ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWMVKDLQHHCV  278
              +      V      +++ W  P         +  + + Y+      +   +         
Sbjct  27877  S--KPKIVDSGKTTITIGWVKP--LFDGGAPITGYTVEYKKSEETDWKVAIQSFRGTEYT  27932

Query  279    IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
              +    +G  +V ++R+  + G  + S+ S   +     E  
Sbjct  27933  MSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEP  27973


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/141 (18%), Positives = 50/141 (35%), Gaps = 6/141 (4%)

Query  196    SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              +++GS  S T   Q     +P PP    +         +++ W+ P   +       + +
Sbjct  28738  NAMGSA-SATIRVQILD--KPGPPGG-PIEFKTVTAEKITLLWRPPAD-DGGAKITHYIV  28792

Query  256    RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
                R      ++       +          G  +V ++RA  ++G GE  E S   +    
Sbjct  28793  EKRETSRVVWSMVAENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLE-SEPVVAKNA  28851

Query  316    TESRSPPAENEVSTPMQALTT  336
                +  PP+  EV+   +   T
Sbjct  28852  FVTPGPPSIPEVTKITKNSMT  28872


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 45/145 (31%), Gaps = 7/145 (5%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              +   +  G   +           +P PPA   +T V        +TW  P   +      
Sbjct  15552  IEAVNVCGRA-TAVVEVNVLD--KPGPPAAFDITDVTNES--CLLTWNPPRD-DGGSKIT  15605

Query  252    RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
               + +  +A  S  +          +           ++ ++ A+  +G GE  + +P   
Sbjct  15606  NYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAAPIIA  15665

Query  312    GTPWTESRSPPAENEVSTPMQALTT  336
                 + +   PP   E S   +   T
Sbjct  15666  KYQF-DPPGPPTRLEPSDITKDAVT  15689


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 43/111 (39%), Gaps = 7/111 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +   +S GSKF+     +   +  P P   + +  V  N +   + W DP   +     
Sbjct  16964  VITATNSCGSKFAA-VRVEVFDV--PGP--VLDLKPVVTNRKMCLLNWSDPAD-DGGSDI  17017

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                F +  +  +  T+    ++  +  C I     G  +  ++ A+ +FG G
Sbjct  17018  TGFIIERKDAKMHTWRQ-PIETERSKCDITGLIEGQEYKFRVIAKNKFGCG  17067


 Score = 47.1 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/257 (14%), Positives = 83/257 (32%), Gaps = 27/257 (11%)

Query  58     VHWVLRKPAAGSH-PSRWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLV-DV  112
              + W  +     +            L++  V  +D+G Y+     ++G+ + TV + V D 
Sbjct  31267  ITWSKKGIDLANRAIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDT  31326

Query  113    PPEEPQLS-CFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              P   P +S          +     P           ++  R+      +     C  S+ 
Sbjct  31327  PGPCPSVSVKEVSRDSVTIT-WEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKC--SKT  31383

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF----SKTQTFQGCGILQPDPPANITVTA  226
                + S  +     + + Y   +   +  G       S            P  P  + V  
Sbjct  31384  LYRISGLV-----EGTMYYFRVLPENIYGIGEPCETSDAVLVSEV----PLVPTKLEVVD  31434

Query  227    VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF-TTWMVKDLQHHCVIHDAWSG  285
              V ++   +++ W+ P  ++       + L      ++ +     +K       +     G
Sbjct  31435  VTKST--VTLAWEKP-LYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEG  31491

Query  286    LRHVVQLRAQEEFGQGE  302
               +++ ++RAQ E G  E
Sbjct  31492  EQYLFRVRAQNEKGVSE  31508


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 74/274 (27%), Gaps = 21/274 (8%)

Query  60     WVLRKP--AAGSHPS-RWAGMGRRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLV-DV  112
              W           H +         L +++    D+G Y       AG     VHL V DV
Sbjct  19333  WTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDV  19392

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
              P                +   W P      +     +V K                  + 
Sbjct  19393  PGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGV------VSAG  19446

Query  173    KFSCQLAVPEGDSS-FYIVSMCVASSVGSKFSKTQ--TFQGCGILQPDPPANITVTAVAR  229
                  +L VP       Y+  +   + +G         T        P PP    VT +  
Sbjct  19447  SSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITE  19506

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRH  288
              N    +V+W  P S +       + +  R E +  +       +      +   + G  +
Sbjct  19507  NAA--TVSWTLPKS-DGGSPITGYYVE-RREITGKWVRVNKTPIADLKFRVTGLYEGNTY  19562

Query  289    VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                ++ A+   G    S  S         +   PP
Sbjct  19563  EFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPP  19596


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 41/260 (16%), Positives = 81/260 (31%), Gaps = 43/260 (17%)

Query  58     VHWVLRKPAAGSHPSRW--AGMGRRLLLRSVQLHDSGNYSCYR---AGRPAGTVHLLVDV  112
              V W            +         L++ +    DSG YS      AG  A  V++ V  
Sbjct  20427  VTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLD  20486

Query  113    PPEEPQLSCFRKSPLSNVVC--EWGPRSTPSLT--TKAVLLVRKFQNSPAEDFQEPCQYS  168
               P  P              C   W P      +  T  ++   + + +  + +       
Sbjct  20487  TPG-PVADLKVSDVTKT-SCHVSWAPPENDGGSQVTHYIV---EKREAERKTWSTVTP--  20539

Query  169    QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK----------FSKTQTFQGCGILQPDP  218
               E +K S  +       + Y   +   +  G             S   +       +PDP
Sbjct  20540  -EVKKTSFNVT-NLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLS-------EPDP  20590

Query  219    PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAER--SKTFTTWMVKDLQH  275
              P  + VT + +N    ++ W  P        ++  + + YR E   +  +T + V     
Sbjct  20591  PRKLEVTEMTKNSA--TLAWLPP--LRDGGAKIDGYIISYREEDQPADRWTEYSVVK-DL  20645

Query  276    HCVIHDAWSGLRHVVQLRAQ  295
                ++     G ++  ++ A+
Sbjct  20646  SLIVTGLKEGKKYKFRVAAR  20665


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 62/176 (35%), Gaps = 28/176 (16%)

Query  147    VLLVRKFQNSPAEDFQEP---CQYSQESQK--FSCQLAVPEGDSSFYIV-----------  190
               +   K     A  + +P   C++ +   +   S  LA+ + D S  ++           
Sbjct  20698  TIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGY  20757

Query  191    -SMCVASSVGSKFSKTQTFQGCGILQPDPPA---NITVTAVARNPRWLSVTWQDPHSWNS  246
               S+   +S G   S TQ  +   +  P PP    +I+      +    S++W  P   + 
Sbjct  20758  YSLTAENSSG---SDTQKIKVTVMDAPGPPQPPFDIS----EIDADACSLSWHIPLE-DG  20809

Query  247    SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                    + +         + T +    +  C +     G  ++ ++RA+  FG  E
Sbjct  20810  GSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISE  20865


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 52/146 (36%), Gaps = 11/146 (8%)

Query  165    CQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFS--------KTQTFQGCGILQ  215
              C++++E Q  S +  +   ++ +  ++     +  G+           KT   +   I  
Sbjct  31957  CKWTKEGQDISKRAMIATSETHTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGS  32016

Query  216    PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
              P+ P    +       R + V+W+ P   +     L + L  R      + T   +    
Sbjct  32017  PNTPEG-PLEYDDIQARSVRVSWRPPAD-DGGADILGYILERREVPKAAWYTIDSRVRGT  32074

Query  276    HCVIHDAWSGLRHVVQLRAQEEFGQG  301
                V+      + +  ++ A+ +FG  
Sbjct  32075  SLVVKGLKENVEYHFRVSAENQFGIS  32100


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 42/115 (37%), Gaps = 7/115 (6%)

Query  188    YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
              YI+++   + VG   S T + +      P     + V  V  +   +++ W  P   +  
Sbjct  29131  YILTIE--NGVGQPKSSTVSVKVLD--TPAACQKLQVKHV--SLGTVTLLWDPPLI-DGG  29183

Query  248    FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                 + + +  R    +T++    K       + D         ++ A+ E G GE
Sbjct  29184  SPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIGE  29238


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 24/145 (17%), Positives = 53/145 (37%), Gaps = 9/145 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               M + +  G K S     +      P P  N+  T + ++   +++ W  P   +     
Sbjct  22635  VMTIENPAGKK-SGFVNVRVLD--TPGPVLNLRPTDITKDS--VTLHWDLPLI-DGGSRI  22688

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    K+++T   K  +    +     G  +  ++ A+ E+G GE +E +   
Sbjct  22689  TNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTEPV  22748

Query  311    MGTPWTESRSPPAENEVSTPMQALT  335
                   +E+  PP    +    +   
Sbjct  22749  RA---SEAPLPPDSLNIMDITKNTV  22770


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 27/200 (14%), Positives = 64/200 (32%), Gaps = 24/200 (12%)

Query  114    PEEPQLSCFRKSPLSNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              P+ P+++   K     +   W  P      + T   L   + +   A  +    + +   
Sbjct  20188  PDPPEVTKVSKEE---MTVVWNAPEYDGGKSITGYYL---EKKEKHAVRWVPVNKSAIPE  20241

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQT-FQGCGILQP-DPPANITVTAVA  228
              ++   Q  +P  +   Y   +   + VG    S           ++P  PP N  V  V 
Sbjct  20242  RRLKVQNLLPGHE---YQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKV--VD  20296

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT-----FTTWMVKD--LQHHCVIHD  281
                   +++ W  P  ++     + + +  R + +       +         ++    +  
Sbjct  20297  TTKSSITLAWGKP-VYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTS  20355

Query  282    AWSGLRHVVQLRAQEEFGQG  301
                    +  ++ AQ + G G
Sbjct  20356  LDENQEYEFRVCAQNQVGIG  20375


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 81/251 (32%), Gaps = 23/251 (9%)

Query  81     LLLRSVQL--HDSGNY---SCYRAGRPAGTVHLLVDVPPEEPQLSC-FRKSPLSNVVCEW  134
              L +   +    D+G Y   +   +G     ++++V   P  P            +V  +W
Sbjct  28321  LTINLKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKW  28380

Query  135    GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
               P      +     +V K + S A       + S    +   ++         Y   +  
Sbjct  28381  EPPKYDGGSHVTNYIVLKRETSTAVW----SEVSATVARTMIKVMKLTTGEE-YQFRIKA  28435

Query  195    ASSVGSKFSKTQTFQGCGILQ-----PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
               +  G           C +++     P PP+   V+ V R    ++V W +P S N    
Sbjct  28436  ENRFGISDHIDS---VCVVVKLPYTTPGPPSTPWVSNVTRES--ITVGWHEPVS-NGGSA  28489

Query  250    RLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
                 + L  +   S  +       +   H  +    +GL +  ++ A+   G G+ S  S 
Sbjct  28490  VTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSE  28549

Query  309    EAMGTPWTESR  319
                +     E  
Sbjct  28550  PVLAIDACEPP  28560


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 62/146 (42%), Gaps = 8/146 (5%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +C  +  G    KT       +  PDPP  + V+ V+R+   +++TW +P S      +
Sbjct  32889  VVCAKNRFGIDQ-KTVELDVADV--PDPPRGVKVSDVSRDS--VNLTWTEPAS--DGGSK  32941

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
              +   +  +   +      + +  +    + + +    +  ++ A+ +FG  + SE S E 
Sbjct  32942  VTNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPS-EP  33000

Query  311    MGTPWTESRSPPAENEVSTPMQALTT  336
                T   ++R+   ++EV    +  TT
Sbjct  33001  TVTKEDKTRAMNYDDEVDETREVTTT  33026


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 20/113 (18%), Positives = 41/113 (36%), Gaps = 9/113 (8%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              +   +  G K S T   +     +P PP   + ++ V       ++ W+ P         
Sbjct  24405  LKAKNVAGEK-SVTINVKVLD--RPGPPEGPVAISGVTAE--KCTLAWKPP--LQDGGSD  24457

Query  251    LRFELRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
              +   +  R E S+  +T          C +     G  ++ ++ A  ++G GE
Sbjct  24458  ITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGE  24510


 Score = 43.3 bits (100),  Expect = 0.006, Method: Composition-based stats.
 Identities = 23/189 (12%), Positives = 52/189 (28%), Gaps = 18/189 (10%)

Query  122    FRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
                    +     W  P           +     +    +  +             C++  
Sbjct  22369  ISNVTKNTATVSWKRPTDDGGSE----ITGYHVERREKKGLRWVRATKTPVSDLRCKVTG  22424

Query  181    PEGDSSFYIVSMCVASSVG----SKFSKTQTF-QGCGILQPDPPANITVTAVARNPRWLS  235
               + + + Y   +   +  G    S  S             P PP+N  VT   +     S
Sbjct  22425  LQ-EGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAY--PPGPPSNAHVTDTTKKSA--S  22479

Query  236    VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ--HHCVIHDAWSGLRHVVQLR  293
              + W  PH ++       + + ++      +              V+ D  +  ++  ++ 
Sbjct  22480  LAWGKPH-YDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRIS  22538

Query  294    AQEEFGQGE  302
              A  + G GE
Sbjct  22539  AINDAGVGE  22547


 Score = 43.3 bits (100),  Expect = 0.007, Method: Composition-based stats.
 Identities = 43/243 (18%), Positives = 80/243 (33%), Gaps = 39/243 (16%)

Query  215    QPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKD  272
              +P PPA  + +  +       S++W  P         + + +  + E S+  +T    + 
Sbjct  27671  KPGPPAGPLEINGLTAE--KCSLSWGRPQ--EDGGADIDYYIVEKRETSRLAWTICEAEL  27726

Query  273    LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES---RSPPAENEVST  329
                  C +     G  ++ ++    ++G GE      E+M     +     SPP   E+++
Sbjct  27727  RTTSCKVTKLLKGNEYIFRVTGVNKYGVGE----PLESMAVKALDPFTTPSPPTSLEITS  27782

Query  330    PMQ---------ALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLL  380
                +           T    D +    +     SL     +  P+    V           
Sbjct  27783  VTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVK----------  27832

Query  381    CIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSD  440
                +  LR    ++ R   E    +  P     LV       PV +P  SPP  P  + S 
Sbjct  27833  --STGLREGCEYEYRVFAENAAGLSLPSETSPLVRAED---PVFLP--SPPSKPKIVDSG  27885

Query  441    NTS  443
               T+
Sbjct  27886  KTT  27888


 Score = 42.1 bits (97),  Expect = 0.013, Method: Composition-based stats.
 Identities = 32/292 (11%), Positives = 78/292 (27%), Gaps = 28/292 (10%)

Query  60     WVLRKPAAGSHPSRWAGMGRR-LLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPE  115
              W                     L+++    +DSG Y      + G+    + + V   P 
Sbjct  31959  WTKEGQDISKRAMIATSETHTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPN  32018

Query  116    EPQLSCFRKS-PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
               P+           +V   W P +          ++ + +   A  +    +      + 
Sbjct  32019  TPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRV-----RG  32073

Query  175    SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA--------  226
              +  +     ++  Y   +   +  G               +P  P               
Sbjct  32074  TSLVVKGLKENVEYHFRVSAENQFGISKPLKSE-------EPVIPKTPLNPPEPPSNPPE  32126

Query  227    -VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWS  284
               +      +S++W  P   +       + +  +   +  +       +      +     
Sbjct  32127  VLDVTKSSVSLSWSRPKD-DGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVP  32185

Query  285    GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
                 +  ++ AQ + G  E S  S   +     +  S P E E+ +  +   T
Sbjct  32186  DAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVT  32237


 Score = 41.7 bits (96),  Expect = 0.016, Method: Composition-based stats.
 Identities = 41/244 (17%), Positives = 72/244 (30%), Gaps = 40/244 (16%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS---RWAGMGRRLLLRSVQLHDSGNYSC  96
             G  VTLTC  +       V W           +    +      L +    L  SG YSC
Sbjct  7077  GLPVTLTC-RLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSC  7135

Query  97    YRA---GRPAGTVHLLVDVPPE------EPQLSCFRKSPLSNVVC----------EWG--  135
               +   G  + T  L    P +      +P          ++  C           W   
Sbjct  7136  SASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKD  7195

Query  136   -----PRSTPSLTTKAVL-LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
                  P    ++T       +R  +    +  Q  CQ + +  K  C   +   +   +I
Sbjct  7196  NKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFI  7255

Query  190   VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV-ARNPRWLSVTWQDPHSWNSSF  248
               +  +        + ++ Q    +   P     +  V  RN   L  +W+   S+ +S 
Sbjct  7256  KKLDAS----KVAKQGESIQLECKISGSP----EIKVVWFRNDSELHESWKYNMSFVNSV  7307

Query  249   YRLR  252
               L 
Sbjct  7308  ALLT  7311


 Score = 41.3 bits (95),  Expect = 0.025, Method: Composition-based stats.
 Identities = 19/131 (15%), Positives = 45/131 (34%), Gaps = 7/131 (5%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              + + ++ G K   T T     I +P P    I V++V+       ++W +P   +     
Sbjct  30509  LTLENTAGVK---TFTITVVVIGRPGPVTGPIEVSSVSAES--CVLSWTEPKD-DGGTEI  30562

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R   +  +        +    +        +  ++ ++  FG  +  E  P  
Sbjct  30563  TNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESVPIV  30622

Query  311    MGTPWTESRSP  321
                 P+    +P
Sbjct  30623  AEHPFVPPSAP  30633


 Score = 40.9 bits (94),  Expect = 0.028, Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 99/347 (29%), Gaps = 36/347 (10%)

Query  16     PGAALAPRRCPAQEVAR---GVLTSLPGDSVTLTCPGVEPEDNATVHWVL-RKPAAGSHP  71
              P  A      P   +       +    G++  L    V  +   T+ W+   K    S  
Sbjct  25402  PITAKDEVELPRISMDPKFRDTIVVNAGETFRLEAD-VHGKPLPTIEWLRGDKEIEESAR  25460

Query  72     SRWAGMGRRLLLRSVQLH--DSGNYSCYRAGRPAGTV-HLLVDV-----PPEEPQLSCFR  123
                      + LL        D G Y    +         + V V     PPE P      
Sbjct  25461  CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGV  25520

Query  124    KSPLSNVVCEWGPR-STPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
               +    +   W P         +  V+  R+                 E    S ++   
Sbjct  25521  TAEKCTLA--WSPPLQDGGSDISHYVVEKRETSRLAWTVVAS------EVVTNSLKVTK-  25571

Query  182    EGDSSFYIVSMCVASSVGSKFSKTQTFQGCG--ILQPDPPANITVTAVARNPRWLSVTWQ  239
                + + YI  +   +  G                + P PP ++ VT +A++   ++V W 
Sbjct  25572  LLEGNKYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDS--MTVCWN  25629

Query  240    DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEF  298
               P S +     + + +  R      +     + +      +        +  ++ A+   
Sbjct  25630  RPDS-DGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAA  25688

Query  299    GQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILF  345
              G G        +  T + ++  P  +    T    + T K+   + +
Sbjct  25689  GVG------EPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAW  25729


 Score = 40.2 bits (92),  Expect = 0.052, Method: Composition-based stats.
 Identities = 44/309 (14%), Positives = 91/309 (29%), Gaps = 35/309 (11%)

Query  33     GVLTSLPGDSVTLTCP-GVEPEDNATVHWVL-RKPAAGSHPSRWAGMGR--RLLLRSVQL  88
               ++T   G  + L    G +PE    + W    K             G+    +++    
Sbjct  30844  DLVTIRAGSDLVLDAAVGGKPE--PKIIWTKGDKELDLCEKISLQYTGKRATAVIKYCDR  30901

Query  89     HDSGNYSCY----RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-  143
               DSG Y+         +    +  ++D P    +L+  R +     +    P+       
Sbjct  30902  SDSGKYTLTVKNASGTKSVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEI  30961

Query  144    TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG---S  200
              T  ++  R+         +  C         +  +      ++ Y   +   +  G    
Sbjct  30962  THYIVERRETSRLNWVIVEGEC-------LTASYVVTRLIKNNEYTFRVRAVNKYGLGVP  31014

Query  201    KFSKTQ----TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
                S+      +F      QP  P       V      + + W  P S +       + + 
Sbjct  31015  VESEPIVARNSFTIPS--QPGIPEE-----VGAGKEHIIIQWTKPES-DGGNEISNYLVD  31066

Query  257    YRAERSKTFTTWMVKDL--QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
               R ++S  +T      +       +     G  +  ++ A    G  E SE S       
Sbjct  31067  KREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE  31126

Query  315    WTESRSPPA  323
               + +  PP+
Sbjct  31127  PSYTPGPPS  31135


 Score = 40.2 bits (92),  Expect = 0.059, Method: Composition-based stats.
 Identities = 27/235 (11%), Positives = 64/235 (27%), Gaps = 27/235 (11%)

Query  209    QGCGILQPDPPAN----ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT  264
                  I+   PP+     I    +  +   +  +W  P   +       + +  R      
Sbjct  29436  FPITIITLGPPSKPKGPIRFDEIKADSAIM--SWDIPED-DGGGEITCYSIEKREASQTN  29492

Query  265    FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES----RS  320
              +        +    + +      +  ++RA+  +G  E     P A      +       
Sbjct  29493  WKMVCSSVARTTFKVSNLVKDSEYQFRVRAENRYGVSE-----PLASNIIVAKHQFRIPG  29547

Query  321    PPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLL  380
              PP +  +        +   D  + +   +  T   V+      +    V    ++     
Sbjct  29548  PPGKPVIYNVTSDGMSLTWDAPV-YDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYR  29606

Query  381    CIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPS  435
                 ++      +++ A      S           P  P    + V  + PP +P 
Sbjct  29607  ATGLIEGLDYQFRVYAENSAGLSS----------PSDPSKFTLAVSPVDPPGTPD  29651


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 34/230 (15%), Positives = 76/230 (33%), Gaps = 22/230 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP  P ++   K     ++ +W  P +      T   L  ++  +     + +  +   +
Sbjct  26296  PPGTPFVTSISKDQ---MLVQWHEPVNDGGSKVTGYHLEQKEKNSI---LWVKLNKIPIQ  26349

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ-P-DPPANITVTAVA  228
                KF     + EG    Y   +   + VG    K      C + + P DPP       + 
Sbjct  26350  DTKFK-TTGLDEGLE--YEFRVSAENIVGI--GKPSKVSECYVARDPCDPPGRPEAIVIT  26404

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLR  287
              RN   +++ W+ P  ++       + +  +      +      ++ +    +       R
Sbjct  26405  RNS--VTLKWKKP-VYDGGSKITGYIVEKKDLPDGRWMKASFTNVVETEFTVTGLVEDQR  26461

Query  288    HVVQLRAQEEFGQGEWSEWSPEAMG-TPWTESRSPPAENEVSTPMQALTT  336
              +  ++ A+       +SE S  +   T   E  +P A  +       +  
Sbjct  26462  YEFRVIARNAADN--FSEPSESSGAITARDEIDAPNASLDPKYRDVIIVH  26509


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 70/228 (31%), Gaps = 32/228 (14%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKP---AAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
             G SV L C  V      +V W L      ++    S +A     L L S++  D+G Y+C
Sbjct  7643  GASVVLEC-RVSGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTC  7701

Query  97    ---YRAGRPAGTVHLLVDVPP--EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
                  AG+   +  L V  PP  E+   S         +   +      +   K      
Sbjct  7702  VAANVAGQDESSAVLTVQEPPSFEQTPDSVEVLPG---MSLTFTSVIRGTPPFKVKWFKG  7758

Query  152   KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-------SK  204
               +    E      +      +         GD S       V +  GS          +
Sbjct  7759  SRELVSGEACTISLEDFVTELELLEVEPGQSGDYS-----CLVTNDAGSASCTTHLFVKE  7813

Query  205   TQTFQGC---GILQPDPPANITVTAVARNPRWLSVTW---QDPHSWNS  246
               TF        ++   P  I + A       +SV+W   + P S + 
Sbjct  7814  PATFVKRLADTSVETGSP--IVLEATYSGTPPISVSWMKNEYPLSQSP  7859


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 35/111 (32%), Gaps = 5/111 (5%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              S+   +  G +  KT       +  P  P  I   +         +TW  P   +     
Sbjct  18383  SLLAKNEGGERK-KTIIVDVLDV--PG-PVGIPFLSDNLTNDSCKLTWFSPED-DGGSPI  18437

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                + ++ R    + +T       + +  +     G  +  ++ A+   G G
Sbjct  18438  TNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMG  18488


 Score = 38.6 bits (88),  Expect = 0.17, Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 75/257 (29%), Gaps = 26/257 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP  P ++   K    ++V +W  P +          L RK +NS               
Sbjct  25214  PPGTPFVTAISK---ESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQ  25270

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
               K        E +   Y  ++                  C    P  P  I V       
Sbjct  25271  FKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCD--PPGTPEAIIVKRNE---  25325

Query  232    RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVV  290
                +++ W  P  ++       + +  R      +      + ++    +       R+  
Sbjct  25326  --ITLQWTKP-VYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEF  25382

Query  291    QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
              ++ A+           +  A+  P   +    A++EV  P  ++     D  ++   +A 
Sbjct  25383  RVIAKN----------AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV---NAG  25429

Query  351    ATSLPVQDSSSVPLPTF  367
               T     D    PLPT 
Sbjct  25430  ETFRLEADVHGKPLPTI  25446


 Score = 38.2 bits (87),  Expect = 0.19, Method: Composition-based stats.
 Identities = 28/180 (16%), Positives = 54/180 (30%), Gaps = 34/180 (19%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRK---PAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
             GD+V LT      ++   VHW  +    P+ G            L++ +V+  D G Y C
Sbjct  4265  GDTVHLTSSISNAKE---VHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTEDEGEYVC  4321

Query  97    YR---AGRPAGTVHLLVDVPPEEPQLSCFRKS------PLSNVVC-----------EWGP  136
                  +G+   +  L V      P +    +        L+   C            +  
Sbjct  4322  EASNDSGKAKTSAKLTVG-ERAAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRFQWFKA  4380

Query  137   RSTPS-------LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
                          ++  V  +   +    +  +  C+ S E    SC   +   ++    
Sbjct  4381  GREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPT  4440


 Score = 37.9 bits (86),  Expect = 0.24, Method: Composition-based stats.
 Identities = 23/136 (17%), Positives = 39/136 (29%), Gaps = 20/136 (15%)

Query  11    ALLAAPGAALAPRRCPAQEVARGV------LTSLPGDSVTLTCPGVEPEDNATVHWVLRK  64
              L+  P  A A        +          +T   G + T+TC    P  N    W    
Sbjct  9616  RLVCGPHIASAKLT----VIEPAWERHLQDVTLKEGQTCTMTCQFSVP--NVKSEWFRNG  9669

Query  65    PAAGSH---PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPP----EEP  117
                       +       +L +  V+  D G Y+C        +  L ++  P    +  
Sbjct  9670  RVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKH-EDLETSAELRIEAEPIQFTKRI  9728

Query  118   QLSCFRKSPLSNVVCE  133
             Q     +   +   CE
Sbjct  9729  QNIVVSEHQSATFECE  9744


 Score = 36.3 bits (82),  Expect = 0.90, Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 49/149 (33%), Gaps = 21/149 (14%)

Query  38    LPGDSVTLTCPGVEPEDNATVHWVLRKPAA---GSHPSRWAGMGRRLLLRSVQLHDSGNY  94
               G+S +  C  V       + W          G++          L +  V   D+G Y
Sbjct  8112  ALGESGSFKCH-VTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQY  8170

Query  95    SCYRA---GRPAGTVHLLVDVPP------EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK  145
             +CY +   G+ + +  L V  PP      ++ ++   ++   +   C             
Sbjct  8171  TCYASNVAGKDSCSAQLGVQEPPRFIKKLDQSRI--VKQDEYTRYEC-----KIGGSPEI  8223

Query  146   AVLLVR-KFQNSPAEDFQEPCQYSQESQK  173
              VL  + + +   +  F+   + S    +
Sbjct  8224  KVLWYKDEVEIQESSKFRMSFEDSVAILE  8252


 Score = 35.9 bits (81),  Expect = 1.0, Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 5/102 (5%)

Query  19    ALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG--  76
             AL  +  P+     G    LPG +V L     +     T+ W        S  S +    
Sbjct  5087  ALIVQEPPSFVTKPGSRDVLPGSAVCLK-SAFQGSAPLTIKWFKGDKELVSGGSCYITKE  5145

Query  77    -MGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEP  117
                  L L +V+  DSG Y+C +    AG+V    D+  +EP
Sbjct  5146  TSESSLELYAVKTSDSGTYTC-KVSNVAGSVECSADLFVKEP  5186


 Score = 35.6 bits (80),  Expect = 1.3, Method: Composition-based stats.
 Identities = 35/283 (12%), Positives = 80/283 (28%), Gaps = 45/283 (16%)

Query  90     DSGNYS---CYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS-TPSLTT-  144
              D+G Y+     + G    ++++ V   P   +         S+    W P          
Sbjct  16242  DAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPIL  16301

Query  145    KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSFYIVSMCVASSVGSKFS  203
                VL   + + +    +         S +      V +   +  Y   +   + +G    
Sbjct  16302  HYVL---ERREAGRRTYI-----PVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGE-  16352

Query  204    KTQTFQGCGILQPDP----------PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
                       I   +P             + V       + +++TW+ P  ++     + +
Sbjct  16353  --------YIELKNPVIAQDPKQPPDPPVDVEVHNPTAKAMTITWKPP-LYDGGSKIMGY  16403

Query  254    ELRYRAERSKTF---TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
               +    +    +      +V  L           G  +  ++RA+   G G        +
Sbjct  16404  IIEKITKGEDRWKRCNEHLVPVLT--YTAKGLEEGKEYQFRVRAENAAGIG------EPS  16455

Query  311    MGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATS  353
                TP T++  P    +V           D+  +    S +   
Sbjct  16456  RATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDATISGSPYP  16498


 Score = 35.6 bits (80),  Expect = 1.5, Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 53/202 (26%), Gaps = 37/202 (18%)

Query  24    RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA---GMGRR  80
               P            PG  V L    V      T+ W           +R          
Sbjct  5654  EPPYFVEKPQSQDVNPGTRVQLK-ALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTI  5712

Query  81    LLLRSVQLHDSGNYSCYRAGRPAGTV---HLLVDVPP---EEPQ-LSCFRKSPLSNVVC-  132
             L L S +  DSG Y C  +     T     + V  PP   ++P  +   R    +   C 
Sbjct  5713  LELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQFIKKPSPVLVLRNGQSTTFECQ  5772

Query  133   ---------EWGPRSTPSLTTK------------AVLLVRKFQNSPAEDFQEPCQYSQES  171
                       W      +  T             A   +   +   +  +   C+   ++
Sbjct  5773  VTGTPEIRVSWYL--DGNEITDLRKYGISFVDGLATFQISNARVENSGTYV--CEARNDA  5828

Query  172   QKFSCQLAVPEGDSSFYIVSMC  193
                SC + +   +   +I  + 
Sbjct  5829  GTASCSIELKVKEPPIFIRELE  5850


 Score = 35.2 bits (79),  Expect = 1.7, Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 58/209 (28%), Gaps = 45/209 (22%)

Query  19    ALAP-RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA--  75
             AL      P        L +  GDSV+L C      +  TV W        S P      
Sbjct  6959  ALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPE-ITVSWFKGDTKLRSTPEYRTYF  7017

Query  76    -GMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLV---DVPP---------EEPQ-  118
                   L+   V ++DSG Y+C      G  A      +    +PP         E+   
Sbjct  7018  TNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVG  7077

Query  119   ----LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
                 L+C         VC +            +L   +       D     +  Q     
Sbjct  7078  LPVTLTCRLNGSAPIQVCWYRDG--------VLLRDDENLQMSFVDNVATLKILQTDLSH  7129

Query  175   SCQLAVPEGDSSFYIVSMCVASSVGSKFS  203
             S Q +               ++ +G+  S
Sbjct  7130  SGQYSC------------SASNPLGTASS  7146


 Score = 35.2 bits (79),  Expect = 1.8, Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 74/225 (33%), Gaps = 22/225 (10%)

Query  90     DSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTK  145
               SG YS     +AG+      + V   P  P+          +    W  P        K
Sbjct  17674  HSGKYSITAKNKAGQKTANCRVKVMDAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIK  17733

Query  146    AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSFYIVSMCVASSVGS---K  201
                ++ +K  +  A     P          S    VP+      Y   +   +  G     
Sbjct  17734  GYVIEKKTIDGKAWTKVNP-------NCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPA  17786

Query  202    FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRA  259
               +  +T     I  PDPP  + +  + +N   + ++W+ P     +   + +   L +  
Sbjct  17787  ETIQRTTARDPIYPPDPPIKLKIGLITKNT--VHLSWKPPKNDGGSPVTHYIVECLAWDP  17844

Query  260    --ERSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEEFGQG  301
                ++ + +     +D++     + D   G  +  +++A  E G  
Sbjct  17845  TGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEAGVS  17889


 Score = 35.2 bits (79),  Expect = 1.8, Method: Composition-based stats.
 Identities = 17/82 (21%), Positives = 30/82 (37%), Gaps = 5/82 (6%)

Query  19    ALAPRRCPAQEVAR-GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS---RW  74
             AL     P   +     + +  G+ +TL C  V+      + W        S P+   ++
Sbjct  7900  ALVSVLEPPYFIEPLEHVEAAIGEPITLQCK-VDGTPEIRISWYKEHTKLRSAPAYKMQF  7958

Query  75    AGMGRRLLLRSVQLHDSGNYSC  96
                   L++  V   D G Y+C
Sbjct  7959  KNNVASLVINKVDHSDVGEYTC  7980


 Score = 34.8 bits (78),  Expect = 2.7, Method: Composition-based stats.
 Identities = 18/86 (21%), Positives = 26/86 (30%), Gaps = 6/86 (7%)

Query  26    PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS----HPSRWAGMGRRL  81
             P  ++    + ++ G+S  L C  V       V W        S      S        L
Sbjct  9041  PFFDIPLAPMDAVVGESADLECH-VTGTQPIKVTWAKDNREIRSGGNYQISYLENSAH-L  9098

Query  82    LLRSVQLHDSGNYSCYRAGRPAGTVH  107
              +  V   DSG Y+CY          
Sbjct  9099  TIVKVDKGDSGQYTCYAVNEVGKDSC  9124


> sp|O15394|NCAM2_HUMAN Neural cell adhesion molecule 2 OS=Homo 
sapiens OX=9606 GN=NCAM2 PE=1 SV=2
Length=837

 Score = 72.5 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 50/291 (17%), Positives = 104/291 (36%), Gaps = 29/291 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM---GRRLL  82
            P     + +  S  G+ + ++C  V+    A++HW   K    +  +        GR+++
Sbjct  401  PKFISNQTIYYSWEGNPINISCD-VKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMI  459

Query  83   LRSVQLHDS--GNYSCYRAGRPAGT----VHLLVDVPPEEPQLSCF---RKSPLSNVVCE  133
            L      D+  G Y+C             +  L DVP     +      + +   +    
Sbjct  460  LEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFN--  517

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
              P S   +          +Q    E   E  +  +     +  +      ++ Y + + 
Sbjct  518  -KPDSHGGVPI------HHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVA  570

Query  194  VASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
              +  G   +SK + FQ   + +P PP +I     +     LS+T QD    +     L 
Sbjct  571  AVNGKGQGDYSKIEIFQTLPVREPSPP-SIHGQPSSGKSFKLSITKQD----DGGAPILE  625

Query  253  FELRYRAERSK-TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
            + ++YR++  +  +    V+  + H ++      + + VQ+ A    G  E
Sbjct  626  YIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSE  676


 Score = 68.3 bits (165),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 47/297 (16%), Positives = 100/297 (34%), Gaps = 32/297 (11%)

Query  43   VTLTCPGVEPEDNATVHW--------VLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSG  92
            VTL C   E E    + W              +        G      L ++ V+L DSG
Sbjct  318  VTLVCD-AEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSG  376

Query  93   NYSCYRAGRPAGTV-HLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
             Y C  A R  G    + +D+      +S         +   W   +  +++        
Sbjct  377  RYDCEAASRIGGHQKSMYLDIEYAPKFIS------NQTIYYSWE-GNPINISCDVKSNPP  429

Query  152  KFQNSPAEDFQEPCQYSQESQKFSCQLA-----VPEGDSSFYIVSMCVASSVGSKFSKTQ  206
               +   +    P + +   + +S          P  D+ F   +    + +G++F +  
Sbjct  430  ASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYI  489

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
                  +  P  P  + +  +  +     V++  P S +       +++  +   S+ + 
Sbjct  490  -LALADV--PSSPYGVKIIEL--SQTTAKVSFNKPDS-HGGVPIHHYQVDVKEVASEIWK  543

Query  267  TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                  +Q   V+++      + +++ A    GQG++S+   E   T      SPP+
Sbjct  544  IVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSK--IEIFQTLPVREPSPPS  598


 Score = 41.3 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 31/210 (15%), Positives = 53/210 (25%), Gaps = 27/210 (13%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-GMGRRLLLRSVQLHDSGNYSCY-  97
            G+ +T +C      + A + W         +      G    L +R++   D G Y C  
Sbjct  225  GEEMTFSCRASGSPEPA-ISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRA  283

Query  98   --RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV--C----------EWGPRSTPSLT  143
              +AG       L V V P   QL          V   C           W         
Sbjct  284  TNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTF  343

Query  144  TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD------SSFYIVSMCV---  194
            T+    +        +               S +              S Y+        
Sbjct  344  TEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKF  403

Query  195  -ASSVGSKFSKTQTFQGCGILQPDPPANIT  223
             ++       +         ++ +PPA+I 
Sbjct  404  ISNQTIYYSWEGNPINISCDVKSNPPASIH  433


> sp|O09030|I13R1_MOUSE Interleukin-13 receptor subunit alpha-1 
OS=Mus musculus OX=10090 GN=Il13ra1 PE=2 SV=1
Length=424

 Score = 71.0 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 72/212 (34%), Gaps = 30/212 (14%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ-YSQESQKFSC  176
            +L C   + LS + C W P    S  T   L         +      C+   +E Q  +C
Sbjct  129  ELKCIWHN-LSYMKCSWLPGRNTSPDTHYTLYYWYSSLEKSR----QCENIYREGQHIAC  183

Query  177  QLAVPEGDSSF--YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL  234
               + + + SF    V + V  + G      +       ++PDPP    +  +      L
Sbjct  184  SFKLTKVEPSFEHQNVQIMVKDNAGKIRPSCKIVSLTSYVKPDPPH---IKHLLLKNGAL  240

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-------------CVIHD  281
             V W++P ++ S    L +E+     ++       V++ +                 +  
Sbjct  241  LVQWKNPQNFRSR--CLTYEVEVNNTQTDRHNILEVEEDKCQNSESDRNMEGTSCFQLPG  298

Query  282  AWSGLRHVVQLRAQEE----FGQGEWSEWSPE  309
              +   + V++R +           WS+WS  
Sbjct  299  VLADAVYTVRVRVKTNKLCFDDNKLWSDWSEA  330


> sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like 
protein Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 
PE=2 SV=3
Length=2074

 Score = 71.8 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 95/265 (36%), Gaps = 28/265 (11%)

Query  41    DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-  99
              +VTL C  V           +     G H S+    G  L++ S+QL D GNYSC    
Sbjct  1328  STVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGD-LIISSLQLADGGNYSCQVDN  1386

Query  100   --GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNS  156
               G    T  L+V VPP  P L     +  S+++  W    T +   T   L  R+   +
Sbjct  1387  GIGTDRLTHTLIVQVPPTAPVLYVTSAT-SSSILMHWKCGFTGNAPITGYTLFYRRANGN  1445

Query  157   PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP  216
               E        S E +   C         S Y + +   + VG+  + T          P
Sbjct  1446  TDEMQLSRHASSHELKGLMC--------GSTYQIHLSAQNKVGTSPTSTILHVRTQGQSP  1497

Query  217   DPPANITVTAVARNPRWLSV---TWQDPHSWNSSFYRLRFELRYRAER---SKTFTTW-M  269
               PA+  +  +A N   L V   +W  P +       L F L+YRA        +     
Sbjct  1498  GHPASTAL--LAPNSTSLLVRLHSW--PDNGCP---LLYFVLQYRAVTDDPDAEWVLVSN  1550

Query  270   VKDLQHHCVIHDAWSGLRHVVQLRA  294
                 Q   VI++      + +++ A
Sbjct  1551  ALKPQRRIVINNLQPSTLYQLRMEA  1575


 Score = 55.6 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 58/307 (19%), Positives = 105/307 (34%), Gaps = 35/307 (11%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR----------WAGMGRRLLLRSVQLH  89
             GD+  L C  V  +    + W+       +  +             G+   L +R+V   
Sbjct  819   GDTALLQC-AVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDAT  877

Query  90    DSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST-PSLTTK  145
             DSG Y C  +   G     V L V  PP  P +         +V  +W P++      TK
Sbjct  878   DSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTK  937

Query  146   AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
              ++  R+      + +Q   Q   +       +      ++ Y   +    S G   S  
Sbjct  938   YIVEFREADPLFVDQWQ---QIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAG--RSAP  992

Query  206   QTFQGCGILQPDP--PAN--ITVTAVARNPRWLSVTWQDP----HSWNSSFYRLRFELRY  257
                    I++ +P  PA   ++++A   +   L ++W  P       +   Y + ++L  
Sbjct  993   SQ---ELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSS  1049

Query  258   RAERSKTFTTWM--VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
                 +  FT+            ++       R+ V ++A  + G G  SE  P A  T  
Sbjct  1050  SGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSE--PTAAQTME  1107

Query  316   TESRSPP  322
                  PP
Sbjct  1108  DVPSRPP  1114


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 72/207 (35%), Gaps = 13/207 (6%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
             DVP   P+          ++   W P       T  +L   K    P  D  +P +   E
Sbjct  1108  DVPSRPPEDVRCAALSSQSLQVSWQPPPIYH--TNGLLQGYKLIFEPIIDDIQPSKDEVE  1165

Query  171   SQKFSCQLAVPEGDSSF--YIVSMCVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAV  227
             S+K +    V  G   +  Y + +   + +G    SK         + P+ PA+I V  V
Sbjct  1166  SRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDV-PEAPADIKV--V  1222

Query  228   ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF---TTWMVKDLQHHCVIHDAWS  284
             + + + L ++W  P+    +    ++ L  R    +         +   Q +        
Sbjct  1223  SSSSQSLYISWLPPN--EPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGLHP  1280

Query  285   GLRHVVQLRAQEEFGQGEWSEWSPEAM  311
              + +   + A    G+G+ S  S +  
Sbjct  1281  HMEYQFWVTASTRVGEGKSSRVSSQIT  1307


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 45/124 (36%), Gaps = 7/124 (6%)

Query  183   GDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
                + Y V +   + VG    S+    Q    +   PP ++   A+  + + L V+WQ P
Sbjct  1077  AKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAAL--SSQSLQVSWQPP  1134

Query  242   HSWNSSFYRLRFELRYRA---ERSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEE  297
               ++++     ++L +     +   +      +       V+        + +Q+ A   
Sbjct  1135  PIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTR  1194

Query  298   FGQG  301
              G G
Sbjct  1195  MGDG  1198


 Score = 37.5 bits (85),  Expect = 0.35, Method: Composition-based stats.
 Identities = 20/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLR-SVQLHDSGN  93
            +T++ G+++ L CP V       +HW            +       L +    +  DSG 
Sbjct  529  VTAVSGETLNLKCP-VAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGV  587

Query  94   YSCY---RAGRPAGTV-HLLVDVPP  114
            Y+C+   + G  A     + V VPP
Sbjct  588  YTCWARNKQGHSARRSGEVTVIVPP  612


> sp|Q95118|IL2RG_BOVIN Cytokine receptor common subunit gamma 
OS=Bos taurus OX=9913 GN=IL2RG PE=2 SV=1
Length=379

 Score = 70.6 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 75/203 (37%), Gaps = 22/203 (11%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ--ESQKF  174
            P++ CF  + +  + C W   S P       L    ++N   +D  + C +    E    
Sbjct  64   PKVQCFVFN-VEYMNCTWNSSSEPQ-PNNLTLHY-GYRNFNGDDKLQECGHYLFSEGITS  120

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSKFSKT-QTFQGCGILQPDPPANITVTAVARNPRW  233
             C       +   Y   +           +  Q  +   ++ P  P N+T+  ++     
Sbjct  121  GCWFGKK--EIRLYETFVVQLQDPREHRKQPKQMLKLQDLVIPWAPENLTLRNLSEF--Q  176

Query  234  LSVTWQDPHSWNSSFYR--LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ  291
            L ++W +       +    L   ++YR++R +++T   V D +H   +    +   +  +
Sbjct  177  LELSWSN------RYLDHCLEHLVQYRSDRDRSWTEQSV-DHRHSFSLPSVDAQKLYTFR  229

Query  292  LRAQEEFGQGE---WSEWSPEAM  311
            +R++     G    WS+WS    
Sbjct  230  VRSRYNPLCGSAQHWSDWSYPIH  252


> sp|O35136|NCAM2_MOUSE Neural cell adhesion molecule 2 OS=Mus 
musculus OX=10090 GN=Ncam2 PE=1 SV=1
Length=837

 Score = 71.4 bits (173),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 50/291 (17%), Positives = 104/291 (36%), Gaps = 29/291 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM---GRRLL  82
            P     + +  S  G+ + ++C  V     A++HW   K    +  +        GR+++
Sbjct  401  PKFVSNQTMYYSWEGNPINISCD-VTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKMI  459

Query  83   LRSVQLHDS--GNYSCYRAGRPAGT----VHLLVDVPPEEPQLSCF---RKSPLSNVVCE  133
            L      D+  G Y+C    R        +  L DVP     +      + +   +    
Sbjct  460  LEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFN--  517

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
              P S   +          +Q    E   E  +  +     +  +      ++ Y + + 
Sbjct  518  -KPESHGGVPI------HHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVA  570

Query  194  VASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
              +  G   +SK + FQ   + +P PP +I     +     +S+T QD    +     L 
Sbjct  571  AVNGKGQGDYSKIEIFQTLPVREPSPP-SIHGQPSSGKSFKISITKQD----DGGAPILE  625

Query  253  FELRYRAERSK-TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
            + ++YR++  +  +    V+  + H ++      + + VQ+ A    G  E
Sbjct  626  YIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSE  676


 Score = 69.5 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 50/297 (17%), Positives = 100/297 (34%), Gaps = 32/297 (11%)

Query  43   VTLTCPGVEPEDNATVHW--------VLRKPAAGSHPSRWAGMGRR--LLLRSVQLHDSG  92
            VTL C   E E    + W              +        G   R  L +R V+L DSG
Sbjct  318  VTLVCE-AEGEPVPEITWKRAIDGVMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSG  376

Query  93   NYSCYRAGRPAGTVH-LLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
             Y C  A R  G    + +D+      +S         +   W   +  +++        
Sbjct  377  RYDCEAASRIGGHQRSMHLDIEYAPKFVS------NQTMYYSWE-GNPINISCDVTANPP  429

Query  152  KFQNSPAEDFQEPCQYSQESQKFSCQLA-----VPEGDSSFYIVSMCVASSVGSKFSKTQ  206
               +   E    P + +   +  S          P  D+ F   +    + +G++F +  
Sbjct  430  ASIHWRREKLLLPAKNTTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGTRFQEYI  489

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
              +   +  P  P  + +  +  +     +++  P S +       +++  +   S+T+ 
Sbjct  490  -LELADV--PSSPHGVKIIEL--SQTTAKISFNKPES-HGGVPIHHYQVDVKEVASETWK  543

Query  267  TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                  +Q   V+        + +++ A    GQG++S+   E   T      SPP+
Sbjct  544  IVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSK--IEIFQTLPVREPSPPS  598


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 40/110 (36%), Gaps = 7/110 (6%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-GMGRRLLLRSVQLHDSGNYSCY-  97
            G+ +TLTC       + T+ W         +      G    L +R++   D G+Y C  
Sbjct  225  GEEMTLTC-KASGSPDPTISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVCKA  283

Query  98   --RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV--CEWGPRSTPSLT  143
              +AG       L V V P   QL     S   +V   CE      P +T
Sbjct  284  TNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEIT  333


> sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 
SV=4
Length=34350

 Score = 71.8 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 103/316 (33%), Gaps = 28/316 (9%)

Query  58     VHWVLRKPAAGSHPSRWAGMGRRLLL-RSVQLHDSGNY---SCYRAGRPAGTVHLLVDVP  113
              V W      +    S  +     LL+  +V   DSG Y       +G  +  V++ V   
Sbjct  22819  VKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDT  22878

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR-STPSLTT-KAVLLVRKFQNSPAEDFQEPC---QYS  168
              P  PQ    ++   ++V   W P            ++  R+            C    + 
Sbjct  22879  PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWK  22938

Query  169    QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
               +  +  C         + Y + +   ++   K S+          +P PP  IT+  V 
Sbjct  22939  VDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE----------RPLPPGKITLMDVT  22988

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              RN   +S++W+ P   +     L + +  + + S  + T     +     I     G  +
Sbjct  22989  RNS--VSLSWEKPEH-DGGSRILGYIVEMQTKGSDKWATCATVKV-TEATITGLIQGEEY  23044

Query  289    VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
                ++ AQ E G  +  + S   +     +   PPA   +      L       ++ F   
Sbjct  23045  SFRVSAQNEKGISDPRQLSVPVIA---KDLVIPPAFKLLFNTFTVLAGEDLKVDVPF--I  23099

Query  349    ANATSLPVQDSSSVPL  364
                 T        +VPL
Sbjct  23100  GRPTPAVTWHKDNVPL  23115


 Score = 71.0 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 57/300 (19%), Positives = 99/300 (33%), Gaps = 31/300 (10%)

Query  48     PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAG  104
              P V  + +      L KPA G   +    +   L L SV   DSG+Y+      +G  + 
Sbjct  20252  PTVSWKKDG----TLLKPAEGIKMAMQRNL-CTLELFSVNRKDSGDYTITAENSSGSKSA  20306

Query  105    TVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
              T+ L V   P  P      K      +  W P      +     +V K + S     Q  
Sbjct  20307  TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS  20366

Query  165    CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ-----P---  216
                        SC +     +   Y   +C  +  G        F    I +     P   
Sbjct  20367  ATVPIT----SCSVEK-LIEGHEYQFRICAENKYG--VGDPV-FTEPAIAKNPYDPPGRC  20418

Query  217    DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QH  275
              DPP    ++ + +    ++V+W+ P   +       + L  R  ++  +T    K + + 
Sbjct  20419  DPP---VISNITK--DHMTVSWKPPAD-DGGSPITGYLLEKRETQAVNWTKVNRKPIIER  20472

Query  276    HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
                       G  +  ++ A  + G G+ S+ S  A          PPA  +V    ++  
Sbjct  20473  TLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSV  20532


 Score = 70.2 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/332 (15%), Positives = 104/332 (31%), Gaps = 33/332 (10%)

Query  40     GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNY---SC  96
              G  +T+  P  +    A   W        +             +   +  D G Y     
Sbjct  13941  GKPLTMVVP-YDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQ  13999

Query  97     YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTT-KAVLL---VR  151
               + G+  G ++L V   P   +     ++    V   W  P +         V+    ++
Sbjct  14000  NKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIK  14059

Query  152    KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF----SKTQT  207
              +     A D  E C+++    +              Y+  +   + VG+           
Sbjct  14060  RKTWVLATDRAESCEFTVTGLQKG---------GVEYLFRVSARNRVGTGEPVETDNPVE  14110

Query  208    FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
               +    + P PP N+T+T V R    +S+TW+ P  ++       + +  R + S  + T
Sbjct  14111  ARSKYDV-PGPPLNVTITDVNRFG--VSLTWEPPE-YDGGAEITNYVIELRDKTSIRWDT  14166

Query  268    WMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
               M    +     + D   G  +  ++RAQ   G G        +  TP+ +   P     
Sbjct  14167  AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVG------KPSAATPFVKVADPIERPS  14220

Query  327    VSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
                  + +    +    + +         P+  
Sbjct  14221  PPVNLTSSDQTQSSVQLKWEPPLKDGGSPILG  14252


 Score = 67.5 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 53/298 (18%), Positives = 112/298 (38%), Gaps = 34/298 (11%)

Query  79     RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV----PPEEPQ-LSCFRKSPLSNVVCE  133
                ++    +   +G Y    +    GTV  ++DV     P++P           ++ V  
Sbjct  31612  HLVMKNVQRKTHAGKYKVQLS-NVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVIS  31670

Query  134    WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
              W P +    +     +V K +     ++Q     S      +C++ V   +++ Y   + 
Sbjct  31671  WKPPADDGGSWITNYVVEKCEAKEGAEWQLV---SSAISVTTCRI-VNLTENAGYYFRVS  31726

Query  194    VASSVGSKFSKTQTFQGCGILQ-----PDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
                ++ G   S         I++     P  P   T+TAV ++     V W+ P S +   
Sbjct  31727  AQNTFGI--SDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDS--CVVAWKPPAS-DGGA  31781

Query  249    YRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                  + L  R ++   + +   ++++     + +   GL +  +++ +   G+ EWSE S
Sbjct  31782  KIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEIS  31841

Query  308    PEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP  365
                   TP ++            P+QA    ++  N+  R  +NAT +        P+ 
Sbjct  31842  EPI--TPKSD-----------VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIV  31886


 Score = 67.1 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query  188    YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
              YI+++   +S G K   T   +      P PP N+TV  ++++  +  VTW+ P   +  
Sbjct  20691  YILTLE--NSCGKKE-YTIVVKVLD--TPGPPVNVTVKEISKDSAY--VTWEPP-IIDGG  20742

Query  248    FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                 + + ++ R    K+++T   +  +    + +   G  +  ++ A+ E+G G
Sbjct  20743  SPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIG  20796


 Score = 66.4 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 73/188 (39%), Gaps = 10/188 (5%)

Query  146    AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
              A +  RK   +  E  +     S+     S + A  E   ++    +CV++S GS  +  
Sbjct  26351  ATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY---ELCVSNSAGSI-TVP  26406

Query  206    QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
               T       +P PP  I +  V+ +   ++++W  P  ++       + +  +   S T+
Sbjct  26407  ITIIVLD--RPGPPGPIRIDEVSCDS--ITISWNPPE-YDGGCQISNYIVEKKETTSTTW  26461

Query  266    TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
                      +    I    +G  +  ++ A+  +G+  +SE S      P++    PP   
Sbjct  26462  HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFS-PPGPPGTP  26520

Query  326    EVSTPMQA  333
              +V    ++
Sbjct  26521  KVVHATKS  26528


 Score = 65.6 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 54/322 (17%), Positives = 100/322 (31%), Gaps = 23/322 (7%)

Query  13     LAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK---PAAGS  69
              L+ P  A      PA ++     T L G+ + +  P +     A V W            
Sbjct  23062  LSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPA-VTWHKDNVPLKQTTR  23120

Query  70     HPSRWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPEEPQ-LSCFRKS  125
                +        L ++     D G+Y       AG    T++++V   P  P       + 
Sbjct  23121  VNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEV  23180

Query  126    PLSNVVCEWGPR-STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD  184
                 ++   WGP       +     +V K   S           ++ + K     A     
Sbjct  23181  TADSITLSWGPPKYDGGSSIN-NYIVEKRDTSTTTWQIVSATVARTTIK-----ACRLKT  23234

Query  185    SSFYIVSMCVASSVGSKF---SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
                 Y   +   +  G      S+    Q    + P PP    VT  +R+   + V W +P
Sbjct  23235  GCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKV-PGPPGTPVVTLSSRDS--MEVQWNEP  23291

Query  242    HSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               S +     + + L  +   S  +       + Q          G+ +  ++ A+   G 
Sbjct  23292  IS-DGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGI  23350

Query  301    GEWSEWSPEAMGTPWTESRSPP  322
              G+ S+ S   +     +    P
Sbjct  23351  GKPSKVSECYVARDPCDPPGRP  23372


 Score = 62.9 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 55/146 (38%), Gaps = 6/146 (4%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              S+ + +  G K           +  P P +++ V+ V +      V+W  P + +     
Sbjct  19604  SLTLVNPAGEKA---VFVNVRVLDTPGPVSDLKVSDVTKTS--CHVSWAPPEN-DGGSQV  19657

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    KT++T   +  +    + +   G  +  ++ A  E+G G  ++     
Sbjct  19658  THYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPV  19717

Query  311    MGTPWTESRSPPAENEVSTPMQALTT  336
              + +       PP + EV+   +   T
Sbjct  19718  LASDPLSEPDPPRKLEVTEMTKNSAT  19743


 Score = 62.1 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 71/192 (37%), Gaps = 22/192 (11%)

Query  153    FQNSPAEDFQEPCQYSQESQKFSCQLAV-PEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
                    ED   P +   +      +L +         I S+ V +  GSK   T + +  
Sbjct  18176  KVTWKKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSK---TVSVKVL  18232

Query  212    GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
               + +P PP ++ V+ + ++  +L  TW++P   +       + +  R   S  ++     
Sbjct  18233  VLDKPGPPRDLEVSEIRKDSCYL--TWKEPLD-DGGSVITNYVVERRDVASAQWSPLSAT  18289

Query  272    DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM  331
                +          G +++ ++ A+ ++G+G            P+ E+  P    +   P+
Sbjct  18290  SKKKSHFAKHLNEGNQYLFRVAAENQYGRG------------PFVETPKPIKALD---PL  18334

Query  332    QALTTNKDDDNI  343
                    KD  ++
Sbjct  18335  HPPGPPKDLHHV  18346


 Score = 61.7 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/252 (14%), Positives = 84/252 (33%), Gaps = 21/252 (8%)

Query  58     VHWVLRKPAAGSHPSRWAGMGRR-LLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVP  113
              + W   +           G+    L + +   +D+G Y       +G  +  V + V   
Sbjct  24983  ITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDT  25042

Query  114    PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
              P  PQ    ++    +    W P            +     +      +     S +  K
Sbjct  25043  PGPPQNLAVKEVRKDSAFLVWEPPIIDG----GAKVKNYVIDKRESTRKAYANVSSKCSK  25098

Query  174    FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITVTAVAR  229
               S ++     + + Y   +   +  G         +    ++    P PP  +T+T V++
Sbjct  25099  TSFKVE-NLTEGAIYYFRVMAENEFGVG----VPVETVDAVKAAEPPSPPGKVTLTDVSQ  25153

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                   S+ W+ P   +     L + +  + + ++ ++    +    + V+    SG  + 
Sbjct  25154  TSA--SLMWEKPEH-DGGSRVLGYVVEMQPKGTEKWSIV-AESKVCNAVVTGLSSGQEYQ  25209

Query  290    VQLRAQEEFGQG  301
               +++A  E G+ 
Sbjct  25210  FRVKAYNEKGKS  25221


 Score = 61.7 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 57/330 (17%), Positives = 101/330 (31%), Gaps = 27/330 (8%)

Query  22     PRRCPAQEVAR-GVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRR  80
                + P  ++   GVLT   GD++ L   GV  +    V W   K A     S    +  R
Sbjct  19124  DLQKPVLDLKLSGVLTVKAGDTIRLE-AGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTR  19182

Query  81     -----LLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVC  132
                     L   +  D G Y       AG       + V   P   +              
Sbjct  19183  ADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTV  19242

Query  133    EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
               W P           +     +    +        +      +    + EG+   YI  +
Sbjct  19243  CWDPPEDDG---GCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNE--YIFRV  19297

Query  193    CVASSVGS---KFSKTQTFQGCGIL--QPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
                 + +G+     SK    +       +PDPP    VT V++    ++V W  P  ++  
Sbjct  19298  RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPE---VTKVSKEE--MTVVWNPPE-YDGG  19351

Query  248    FYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
                   + L  + + S  +       + +    + +      +  +++A+ E G GE S  
Sbjct  19352  KSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLP  19411

Query  307    SPEAMGTPWTESRSPPAENEVSTPMQALTT  336
              S   +     E   PP    V    +   T
Sbjct  19412  SRPVVAKDPIEPPGPPTNFRVVDTTKHSIT  19441


 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 96/299 (32%), Gaps = 25/299 (8%)

Query  73     RWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSN  129
                      L+L +V  +DSG Y+      +G  +  V + V   P  P      +    +
Sbjct  23917  DVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDS  23976

Query  130    VVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
              V   W P      +     +V K +       +          K S ++   +   S+Y 
Sbjct  23977  VSITWEPPLLDGGSKIKNYIVEKREA----TRKSYAAVVTNCHKNSWKIDQLQEGCSYYF  24032

Query  190    VSMCVASSVG----SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
                +   +  G    ++ +            P PP  ITV  V RN   +S++W  P   +
Sbjct  24033  -RVTAENEYGIGLPAQTADPIKVAEV----PQPPGKITVDDVTRNS--VSLSWTKPEH-D  24084

Query  246    SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                   +++ +  +A+ S+ ++    +      VI +   G  ++ ++ A  E G+ +   
Sbjct  24085  GGSKIIQYIVEMQAKHSEKWSEC-ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSD---  24140

Query  306    WSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPL  364
                P ++  P          +              D  I    S             +PL
Sbjct  24141  --PRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPL  24197


 Score = 61.0 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/245 (16%), Positives = 86/245 (35%), Gaps = 15/245 (6%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
              PP  P+++   K+ ++ V     P +          L  + ++  +  + +  + +    
Sbjct  27995  PPGIPEVTKITKNSMTVV--WSRPIADGGSDISGYFL--EKRDKKSLGWFKVLKETIRDT  28050

Query  173    KFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCG--ILQPDPPANITVTAVAR  229
              +          ++S Y   +C  ++ G   FS+   F      I  P PPA I +    +
Sbjct  28051  RQKVT---GLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK  28107

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL--QHHCVIHDAWSGLR  287
              +   +++ W  P  ++       + +  R    + +TT   K        V+ +   G+ 
Sbjct  28108  SS--ITLGWSKP-VYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVN  28164

Query  288    HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRD  347
              +  ++ A    GQGE  E +         E+     +  + T + A         I F+ 
Sbjct  28165  YYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKG  28224

Query  348    SANAT  352
                  T
Sbjct  28225  RPPPT  28229


 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 51/306 (17%), Positives = 99/306 (32%), Gaps = 30/306 (10%)

Query  58     VHWVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVP  113
              V W   +                 L++ +V   DSG Y+      +G     V++ V   
Sbjct  26066  VKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDS  26125

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR--STPSLTTKAVLLVRKFQNSPAEDFQEPCQYS---  168
              P  P     R+    +V   W P      +  T  ++  R+            C  +   
Sbjct  26126  PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFR  26185

Query  169    QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
               E+ +  C        S+ Y + +   ++   K S+           P PP  +T+  V 
Sbjct  26186  IENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP----------PLPPGRVTLVDVT  26235

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              RN    ++ W+ P S +       + +  + + S+ ++T           I    +G  +
Sbjct  26236  RNTA--TIKWEKPES-DGGSKITGYVVEMQTKGSEKWSTCTQVK-TLEATISGLTAGEEY  26291

Query  289    VVQLRAQEEFGQGEWSEWSPEAMGTPWTES--RSPPAENEVSTPMQALTTNKDDDNILFR  346
              V ++ A  E G+ +     P  +G P         P+              +   ++ F+
Sbjct  26292  VFRVAAVNEKGRSD-----PRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFK  26346

Query  347    DSANAT  352
                  AT
Sbjct  26347  GRPQAT  26352


 Score = 60.6 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/228 (17%), Positives = 77/228 (34%), Gaps = 18/228 (8%)

Query  136    PRSTPSLTTKAV---LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS-FYIVS  191
              P       T         +  +         P     E+ + S  + +PE   S     S
Sbjct  16758  PAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYS  16817

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              +   +  G K +     +   +  P PP ++ V+ + R      ++W+ P   +    R+
Sbjct  16818  ITAKNKAGQKTAN-CRVKVMDV--PGPPKDLKVSDITRGS--CRLSWKMPD--DDGGDRI  16870

Query  252    R-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
              + + +  R    K +T           V+ D  S  ++  ++RA+  FG G      P  
Sbjct  16871  KGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIG------PPV  16924

Query  311    MGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
                   T +R P    +    ++     K+  ++ ++   N    PV  
Sbjct  16925  ETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTH  16972


 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 45/349 (13%), Positives = 105/349 (30%), Gaps = 28/349 (8%)

Query  11     ALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH  70
               +L  P  A      P+ ++     +   G+ + +  P V       + WV         
Sbjct  25224  RVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIP-VIGRPRPNISWVKDGEPLKQT  25282

Query  71     PS---RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVP---PEEPQLSCFRK  124
                           L ++     D G Y+             L  +    P  P       
Sbjct  25283  TRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFD  25342

Query  125    SPLSNVVC-EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG  183
                 ++ V   W P +       +  +V K   +           S    + + ++   + 
Sbjct  25343  EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMV----SATVARTTIKITKLKT  25398

Query  184    DSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQ-PDPPANITVTAVARNPRWLSVTWQDP  241
                + Y   +   +  G      ++        + P PP    VT++++    + V W +P
Sbjct  25399  -GTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISK--DQMLVQWHEP  25455

Query  242    HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               + +     + + L  + + S  +       +Q           GL +  ++ A+   G 
Sbjct  25456  VN-DGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGI  25514

Query  301    GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
              G+ S+ S   +     +    P         +A+   +++  + ++  A
Sbjct  25515  GKPSKVSECFVARDPCDPPGRP---------EAIVITRNNVTLKWKKPA  25554


 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/268 (16%), Positives = 87/268 (32%), Gaps = 42/268 (16%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +   ++ GS  +   T       +P P  N+ +  V  +    +V W  P   +     
Sbjct  19202  VVTATNTAGSFVAY-ATVNVLD--KPGPVRNLKI--VDVSSDRCTVCWDPPE--DDGGCE  19254

Query  251    LRFELRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              ++  +  + E  +  ++T+    L     +     G  ++ ++RA+ + G G  +E  P 
Sbjct  19255  IQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPV  19314

Query  310    AMGTPWT--ESRSPP--------AENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDS  359
                 T +       PP            V  P +           L +   ++T     + 
Sbjct  19315  IAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNK  19374

Query  360    SSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLG-QLVPERP  418
              S++P     V                L     ++ R   E +  +  P      +V + P
Sbjct  19375  SAIPERRMKVQN--------------LLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDP  19420

Query  419    RPTPVLVPLISPPVSPSSLGSDNTSSHN  446
                       I PP  P++    +T+ H+
Sbjct  19421  ---------IEPPGPPTNFRVVDTTKHS  19439


 Score = 59.8 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/222 (17%), Positives = 74/222 (33%), Gaps = 23/222 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP+ P+++   K  +  VVC   P S         ++   + ++   + + +  + +   
Sbjct  22584  PPKNPEVTTITKDSM--VVCWGHPDSDGGSEIINYIV---ERRDKAGQRWIKCNKKTLTD  22638

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGC--GILQPDPPANITVTAVA  228
               ++         +   Y   +   ++ G S  S T  F      + +P PP N  V  + 
Sbjct  22639  LRYKVS---GLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRV--LD  22693

Query  229    RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW--MVKDLQHHCVIHDAWSGL  286
               +   +S+ W  P  ++       + +         +               I       
Sbjct  22694  TSRSSISIAWNKP-IYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQ  22752

Query  287    RHVVQLRAQEEFGQGEWSEWSPE-AMGTPWTESRSPPAENEV  327
               + +++ A    G GE     P    GTP  E R  P E E+
Sbjct  22753  EYKIRIYAMNSEGLGE-----PALVPGTPKAEDRMLPPEIEL  22789


 Score = 59.4 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 8/133 (6%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              + VA+ VG K   T + +   + +PDPP    V     +   ++++W  P    +   ++
Sbjct  24229  ITVANVVGQK---TASIEIVTLDKPDPPKG-PVKFDDVSAESITLSWNPP--LYTGGCQI  24282

Query  252    R-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + ++ R   +  +        +    +    +G  +  ++ A+  +GQ    E  P  
Sbjct  24283  TNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIV  24342

Query  311    MGTPWTESRSPPA  323
                 P+ E   PP 
Sbjct  24343  AQYPYKE-PGPPG  24354


 Score = 59.1 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 34/183 (19%), Positives = 63/183 (34%), Gaps = 11/183 (6%)

Query  152    KFQNSPAEDFQEPCQYSQESQKFSCQL-AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG  210
                     E+     +     QK +  +      D   YI+ +    +VG   S   T + 
Sbjct  25669  SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLS---NVGGTKSIPITVKV  25725

Query  211    CGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
                  +P PP   + VT V     +L   W  P   +       + +  R     ++T   
Sbjct  25726  LD--RPGPPEGPLKVTGVTAEKCYL--AWNPPLQ-DGGANISHYIIEKRETSRLSWTQVS  25780

Query  270    VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
               +    +  +     G  ++ ++ A  ++G GE  E  P     P+ +   PP+  EVS 
Sbjct  25781  TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPY-KPPGPPSTPEVSA  25839

Query  330    PMQ  332
                +
Sbjct  25840  ITK  25842


 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 60/152 (39%), Gaps = 10/152 (7%)

Query  173    KFSCQLAVPEGDSS---FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
                +C L +P+   S    Y  ++   +++G+  SK       G  +P PP    +   + 
Sbjct  17103  DDTCTLVIPQSRRSDTGLY--TITAVNNLGTA-SKEMRLNVLG--RPGPPVG-PIKFESV  17156

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
              +   ++++W  P   +       + +  R    KT+     +  +    I     G  +V
Sbjct  17157  SADQMTLSWFPPKD-DGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYV  17215

Query  290    VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
               ++ AQ ++G GE  +  PE     ++   +P
Sbjct  17216  FRIMAQNKYGIGEPLDSEPETARNLFSVPGAP  17247


 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 53/146 (36%), Gaps = 16/146 (11%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              + V+++ GSK           +  P PP    +  +   P  ++++WQ P   +     +
Sbjct  18510  ITVSNAAGSKTVAVH-LTVLDV--PGPPTG-PINILDVTPEHMTISWQPPKD-DGGSPVI  18564

Query  252    RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
               + +  +  R  T+        +    I     G  +V ++RA+ + G G      P   
Sbjct  18565  NYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVG------PPLD  18618

Query  312    GTPWT-----ESRSPPAENEVSTPMQ  332
               TP          SPP +  V+   +
Sbjct  18619  STPTVAKHKFSPPSPPGKPVVTDITE  18644


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 42/281 (15%), Positives = 87/281 (31%), Gaps = 37/281 (13%)

Query  57     TVHWVLRKPAAGSHPSRWAGMGR----------RLLLRSVQLHDSGNYSCYRAGRPAGTV  106
              T+ W    P    +                    L++   +  D+G Y+           
Sbjct  17074  TLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTAS  17133

Query  107    -HLLVDVP--PEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLT--TKAVLLVRKFQNSPAED  160
                + ++V   P  P     F       +   W P      +  T  V+   + + +  + 
Sbjct  17134  KEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVI---EKREANRKT  17190

Query  161    FQEPCQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKF---SKTQTFQGCGILQP  216
              +         S+   C   +P+      Y+  +   +  G      S+ +T +    + P
Sbjct  17191  WVH-----VSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV-P  17244

Query  217    DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH-  275
                P   TV++V RN   ++V W++P  ++       + L  +   SK +       ++  
Sbjct  17245  GAPDKPTVSSVTRNS--MTVNWEEPE-YDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM  17301

Query  276    ----HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
                     +     G  +  ++ A    G G  S  S  A  
Sbjct  17302  TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA  17342


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/240 (14%), Positives = 63/240 (26%), Gaps = 15/240 (6%)

Query  100    GRPAGTVHLLVDV---PPEEPQLSCFRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQN  155
              G P     +       PP  P            V   W  P            +  +  +
Sbjct  14793  GEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV--ERLD  14850

Query  156    SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG--SKFSKTQTFQGCGI  213
                 + +    +      K +        +   Y   +   +  G       T+       
Sbjct  14851  PDTDKWVRCNKMPV---KDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDP  14907

Query  214    LQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
              + P  PP   TV  V +    + + W  P   +       + +      +  +       
Sbjct  14908  IDPPWPPGKPTVKDVGKTS--VRLNWTKPEH-DGGAKIESYVIEMLKTGTDEWVRVAEGV  14964

Query  273    LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQ  332
                   ++     G  +  ++RA  + G+ E SE S   +        SPP   EV    +
Sbjct  14965  PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK  15024


 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 45/309 (15%), Positives = 94/309 (30%), Gaps = 45/309 (15%)

Query  15     APGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP---AAGSHP  71
              +    L     P        +T+  G++  L+C  V       + W         +  + 
Sbjct  31449  SIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVG-RPLPDIKWYRFGKELIQSRKYK  31507

Query  72     SRWAGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE-EPQLSCFRKSPL  127
                  G    L + + +  D G Y+C      G    +  LL+   P+  P      K   
Sbjct  31508  MSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEK-YY  31566

Query  128    SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
                V            T +  ++           F     + Q+  + S  + +   +   
Sbjct  31567  GAV----------GSTLRLHVMYIGRPVPAMTWF-----HGQKLLQNSENITIENTEHYT  31611

Query  188    YIV--SMCVASSVGSKFSKTQTFQ-----GCGIL---QPDPPAN-ITVTAVARNPRWLSV  236
              ++V  ++   +  G    +             +    +PD P   I + A+ +N     +
Sbjct  31612  HLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAV--I  31669

Query  237    TWQDPH----SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
              +W+ P     SW +++   + E    A+    +           C I +      +  ++
Sbjct  31670  SWKPPADDGGSWITNYVVEKCE----AKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRV  31725

Query  293    RAQEEFGQG  301
               AQ  FG  
Sbjct  31726  SAQNTFGIS  31734


 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/258 (14%), Positives = 78/258 (30%), Gaps = 23/258 (9%)

Query  58     VHWVLRKPAAGSHPS-RWAGMGRRLLLRSVQL--HDSGNYSCY---RAGRPAGTVHLLVD  111
              + W                    R+ L+  +    D G Y       +G   G+  + V 
Sbjct  18867  ITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVL  18926

Query  112    VPPEEPQLSCFRKSPLSNVVCEW-GPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQ  169
                P   Q          N    W  P        T  ++  RK                 
Sbjct  18927  DRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSI--------V  18978

Query  170    ESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPPANITVTA  226
               S      +      ++ Y   +C  + VG   +  +KT       I +P  P N+ +  
Sbjct  18979  ASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIAD  19038

Query  227    VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSG  285
                +   ++ + W+ P  ++     L + +  R + S  +       ++  H ++      
Sbjct  19039  KGKT--FVYLKWRRPD-YDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVEN  19095

Query  286    LRHVVQLRAQEEFGQGEW  303
                +  +++ + E G+ +W
Sbjct  19096  QIYEFRVQTKNEGGESDW  19113


 Score = 56.7 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/249 (14%), Positives = 65/249 (26%), Gaps = 17/249 (7%)

Query  60     WVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVDVPPE  115
              W                     L + +   +D+G Y+      +G  + T  + V   P 
Sbjct  29318  WSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPG  29377

Query  116    EPQLSCFRKSPLSNVVCEWG-PRSTPSLTTK-AVLLVRKFQNSPAEDFQEPCQYSQESQK  173
               P    F+     +    W  P           V+  R+      +   E C        
Sbjct  29378  PPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQ-----  29432

Query  174    FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
                        +   Y   +   +  G               QP PP  + V   +++   
Sbjct  29433  --IFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAV  29490

Query  234    LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
              L   W  P   +       + L  R + S  +        Q    +        +  +++
Sbjct  29491  L--AWLKPDH-DGGSRITGYLLEMRQKGSDFWVEAGHTK-QLTFTVERLVEKTEYEFRVK  29546

Query  294    AQEEFGQGE  302
              A+ + G  E
Sbjct  29547  AKNDAGYSE  29555


 Score = 56.4 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 43/260 (17%), Positives = 88/260 (34%), Gaps = 28/260 (11%)

Query  58     VHWVLRKPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLVD  111
              + W                       L   +V  +D+G Y        G+   T+ + V 
Sbjct  20652  ITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL  20711

Query  112    VPPEEPQLSCFRKSPLSNVVCEWGPRS-TPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQ  169
                P  P     ++    +    W P            V+     +++  + +      + 
Sbjct  20712  DTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ---KRDAERKSWSTV---TT  20765

Query  170    ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITVT  225
              E  K S ++A  E +   Y   +   +  G         +    ++    P P  ++ V 
Sbjct  20766  ECSKTSFRVANLE-EGKSYFFRVFAENEYGI--GDPG--ETRDAVKASQTPGPVVDLKVR  20820

Query  226    AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
              +V+++    S+ W+ PHS +     + + + +  E +K +   M K L       D   G
Sbjct  20821  SVSKSS--CSIGWKKPHS-DGGSRIIGYVVDFLTEENK-WQRVM-KSLSLQYSAKDLTEG  20875

Query  286    LRHVVQLRAQEEFGQGEWSE  305
                +  ++ A+ E G+G  SE
Sbjct  20876  KEYTFRVSAENENGEGTPSE  20895


 Score = 56.0 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/173 (16%), Positives = 59/173 (34%), Gaps = 16/173 (9%)

Query  136    PRSTPSLTTKAVLLVRKFQNSPA-----EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV  190
              P     L    +   +            +  +E    S+   + S   AV E   ++   
Sbjct  16346  PADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTY---  16402

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++  ++ +GS F +    +     +P PP N+ VT +     +L  TW  P     S   
Sbjct  16403  TVTASNRLGSVF-RNVHVEVYD--RPSPPRNLAVTDIKAESCYL--TWDAPLDNGGSEIT  16457

Query  251    LRFELRYR--AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                + +  R  + +   +       ++    I       ++  ++RA  ++G  
Sbjct  16458  -HYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGIS  16509


 Score = 56.0 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 44/327 (13%), Positives = 96/327 (29%), Gaps = 33/327 (10%)

Query  13     LAAPGAALAPRRCPAQEVARGVLTS------LPGDSVTLTCPGVEPEDNATVHWVLRKPA  66
              LA P  A          +   V  +        G  + +  P +      T+ W      
Sbjct  24144  LAVPIVA------KDLVIEPDVKPAFSSYSVQVGQDLKIEVP-ISGRPKPTITWTKDGLP  24196

Query  67     AGSHPSRWAGMG---RRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPEEPQ-L  119
                               L ++     D G Y        G+   ++ ++    P+ P+  
Sbjct  24197  LKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGP  24256

Query  120    SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA  179
                F      ++   W P            +V+K   +           S    + + ++ 
Sbjct  24257  VKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVV----SATVARTTLKVT  24312

Query  180    VPEGDSSFYIVSMCVASSVGSK---FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
                +   + Y   +   +  G      S     Q     +P PP     TA++++   + +
Sbjct  24313  KLKT-GTEYQFRIFAENRYGQSFALESDPIVAQYPYK-EPGPPGTPFATAISKDS--MVI  24368

Query  237    TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQ  295
               W +P + N     + + L  +   S  +T      +        +   G+ +  ++ A+
Sbjct  24369  QWHEPVN-NGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAE  24427

Query  296    EEFGQGEWSEWSPEAMGTPWTESRSPP  322
                 G G+ S+ S   +     +    P
Sbjct  24428  NIVGVGKASKNSECYVARDPCDPPGTP  24454


 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 52/158 (33%), Gaps = 6/158 (4%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               + + +S G    +T         +P PP    V         ++++W  P  ++     
Sbjct  23146  VVKLTNSAGEAI-ETLNVIVLD--KPGPPTG-PVKMDEVTADSITLSWGPP-KYDGGSSI  23200

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R   + T+        +         +G  +  ++ A+  +G+  +    P  
Sbjct  23201  NNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTV  23260

Query  311    MGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
                 P+ +   PP    V+   +     + ++ I    S
Sbjct  23261  AQYPF-KVPGPPGTPVVTLSSRDSMEVQWNEPISDGGS  23297


 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/143 (19%), Positives = 57/143 (40%), Gaps = 6/143 (4%)

Query  189    IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
              I ++ + + +GS    T +     I  P P  +I  + + ++     +TW+ P  ++   
Sbjct  15383  IYTITLENKLGSA---TASINVKVIGLPGPCKDIKASDITKSS--CKLTWEPPE-FDGGT  15436

Query  249    YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
                L + L  R    +T+   M  + +    + D      +  +++A  + G GE+ E   
Sbjct  15437  PILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKN  15496

Query  309    EAMGTPWTESRSPPAENEVSTPM  331
                +     +   PP + EV  P 
Sbjct  15497  PVIAQDPKQPPDPPVDVEVHNPT  15519


 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/154 (16%), Positives = 54/154 (35%), Gaps = 9/154 (6%)

Query  151    RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV-SMCVASSVGSKFSKTQTFQ  209
              +   +   +D +        S   S  L +           ++   +  G+K        
Sbjct  21337  KSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH-VKVT  21395

Query  210    GCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
                 +  P PP  + ++ V+      ++TW  P         ++  +  + E S+   T +
Sbjct  21396  VLDV--PGPPGPVEISNVSAEKA--TLTWTPP--LEDGGSPIKSYILEKRETSRLLWTVV  21449

Query  270    VKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
               +D+Q    V      G  ++ ++ A   +G+GE
Sbjct  21450  SEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE  21483


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 53/139 (38%), Gaps = 8/139 (6%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              +  ++  GSK S     +     +P PP   + VT V       S+TW  P     S   
Sbjct  24625  LRASNVAGSK-SFPVNVKVLD--RPGPPEGPVQVTGV--TSEKCSLTWSPPLQDGGSDIS  24679

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R      +T    + + +   +     G  +V ++ A  ++G GE  E +P  
Sbjct  24680  -HYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVL  24738

Query  311    MGTPWTESRSPPAENEVST  329
              M  P+     PP   EV+ 
Sbjct  24739  MKNPFV-LPGPPKSLEVTN  24756


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 51/155 (33%), Gaps = 8/155 (5%)

Query  147    VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ  206
               +  +K      +  +   + +  S   +    V      +    +   + VG       
Sbjct  22023  TVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYP---LTARNIVGEV-GDVI  22078

Query  207    TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
              T Q   I  P PP    +     +  +++ +W  P + +       + +  R   S T+ 
Sbjct  22079  TIQVHDI--PGPPTG-PIKFDEVSSDFVTFSWDPPEN-DGGVPISNYVVEMRQTDSTTWV  22134

Query  267    TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                    ++         +GL +  +++AQ  +G G
Sbjct  22135  ELATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVG  22169


 Score = 54.0 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/133 (22%), Positives = 50/133 (38%), Gaps = 11/133 (8%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ + + V S  S T   +      P PP NITV  V +    L  +W  P   N     
Sbjct  27183  TLTIQN-VLSAASLTLVVKVLD--TPGPPTNITVQDVTKESAVL--SWDVPE--NDGGAP  27235

Query  251    LR-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              ++ + +  R    K + +      +    + +   G  +  ++  + EFG G     +  
Sbjct  27236  VKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIP---AET  27292

Query  310    AMGTPWTESRSPP  322
                G   TE  SPP
Sbjct  27293  KEGVKITEKPSPP  27305


 Score = 54.0 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/266 (13%), Positives = 88/266 (33%), Gaps = 22/266 (8%)

Query  50     VEPEDNATVHWVLRKPAAGSHPSRWAGMGR--RLLLRSVQLHDSGNYSCYRAGRPAGTVH  107
              VE  + + ++WV+ +    +       + +    + R   ++  G      +        
Sbjct  30104  VERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNS  30163

Query  108    LLVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSP-AEDFQEP  164
                +  PP  P+      +   +++ +W  P S      +  ++  R+ ++       ++ 
Sbjct  30164  FTIPSPPGIPE---EVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDY  30220

Query  165    CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCG--ILQPDPPAN  221
                Y    +  S            Y   +   ++ G+   S+   F  C      P PP+ 
Sbjct  30221  VVYDTRLKVTSLMEGCD------YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSA  30274

Query  222    ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL--QHHCVI  279
                V    ++   +S+ W  P  ++     + + L  + + +  +               +
Sbjct  30275  PRVVDTTKHS--ISLAWTKP-MYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTV  30331

Query  280    HDAWSGLRHVVQLRAQEEFGQGEWSE  305
               D   G ++  ++ A    G  E+SE
Sbjct  30332  PDLKMGQKYSFRVAAVNVKGMSEYSE  30357


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 57/156 (37%), Gaps = 11/156 (7%)

Query  179    AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTW  238
                   D+  YI+ +   +S GSK S   T +      P PP N+ V  V ++  +L   W
Sbjct  25011  NCDRNDAGKYILKLE--NSSGSK-SAFVTVKVLD--TPGPPQNLAVKEVRKDSAFLV--W  25063

Query  239    QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
              + P   +       + +  R    K +     K  +    + +   G  +  ++ A+ EF
Sbjct  25064  EPP-IIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEF  25122

Query  299    GQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
              G G   E           E  SPP +  ++   Q  
Sbjct  25123  GVGVPVE---TVDAVKAAEPPSPPGKVTLTDVSQTS  25155


 Score = 53.7 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/281 (13%), Positives = 81/281 (29%), Gaps = 27/281 (10%)

Query  50     VEPEDNATVHWVLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSGNYSCYRAGRPAGTVH  107
              VE  + + + W + +        +   +  G   + R   ++  G       G P  +V 
Sbjct  26847  VEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYG------VGEPLESVA  26900

Query  108    LLVDVP---PEEPQLSCFRKSPLSNVV-CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE  163
              +    P   P  P           ++  C   P S         ++ R+ +NS       
Sbjct  26901  IKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVN  26960

Query  164    PCQ-YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPP  219
                  Y    +    +          Y   +   ++ G      +         +  P PP
Sbjct  26961  KKPVYDLRVKSTGLREGCE------YEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPP  27014

Query  220    ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWMVKDLQHHCV  278
              +      V      +++ W  P         +  + + Y+      + T +         
Sbjct  27015  S--KPKIVDSGKTTITIAWVKP--LFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYT  27070

Query  279    IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
              I    +G  +V ++++  + G  + S+ S   +     E  
Sbjct  27071  ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEP  27111


 Score = 52.9 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/163 (13%), Positives = 48/163 (29%), Gaps = 21/163 (13%)

Query  187    FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP-HSWN  245
               Y++ +     +        T        P PP N     + +        W+ P     
Sbjct  15705  LYMIKVENDHGIAKA---PCTVSVLD--TPGPPINFVFEDIRKTSVLC--KWEPPLDDGG  15757

Query  246    SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
              S       E + + +    +             +     G  ++ ++RA+  FG G    
Sbjct  15758  SEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPG----  15813

Query  306    WSPEAMGTP--WTESRSPPAENEVSTPMQALTTNKDDDNILFR  346
                P  +  P    +   PP       P + +  +   +++L +
Sbjct  15814  --PPCVSKPLVAKDPFGPP-----DAPDKPIVEDVTSNSMLVK  15849


 Score = 52.1 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 47/143 (33%), Gaps = 8/143 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFY  249
              ++   +  G         +     +P PP   + VT V        ++W  P   +    
Sbjct  22460  TLTATNPGGFAK-HIFNVKVLD--RPGPPEGPLAVTEV--TSEKCVLSWFPPLD-DGGAK  22513

Query  250    RLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
                 + ++ R      +T    +       +     G  ++ ++ A  ++G GE  E S  
Sbjct  22514  IDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-SEP  22572

Query  310    AMGTPWTESRSPPAENEVSTPMQ  332
               +         PP   EV+T  +
Sbjct  22573  VLAVNPYGPPDPPKNPEVTTITK  22595


 Score = 51.7 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 44/150 (29%), Gaps = 17/150 (11%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              +   +  G   +           +P PPA   +T V        +TW  P   +      
Sbjct  14690  IEAVNVCGRA-TAVVEVNVLD--KPGPPAAFDITDVTNES--CLLTWNPPRD-DGGSKIT  14743

Query  252    RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
               + +  RA  S+ +          +           ++ ++ A+  +G G          
Sbjct  14744  NYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVG------EPVQ  14797

Query  312    GTPWT-----ESRSPPAENEVSTPMQALTT  336
               +P T     +   PP   E S   +   T
Sbjct  14798  ASPITAKYQFDPPGPPTRLEPSDITKDAVT  14827


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 58/368 (16%), Positives = 106/368 (29%), Gaps = 46/368 (13%)

Query  14     AAPGAALAPRRCPAQEVARGVL--TSLPGDSVTLTCPGVEPEDNATVH--WVLRKPAAGS  69
              A+P  A      P        L  + +  D+VTLT    + +  + +   WV R      
Sbjct  14798  ASPITAKYQFDPP---GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTD  14854

Query  70     HPSRWAGM-GRRLLLRSVQLHDSGNYSCYRAGRPA--------GTVHLLVD------VPP  114
                 R   M  +    R   L +   Y                  T  +L+        PP
Sbjct  14855  KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPP  14914

Query  115    EEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTK-AVLLVRKFQNSPAEDFQEPCQYSQESQ  172
               +P +        ++V   W  P        +  V+ + K          E    +Q   
Sbjct  14915  GKPTVK---DVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLL  14971

Query  173    KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQT--FQGCGILQPDPPANITVTAVAR  229
                         +   Y   +   +  G    S+          +  P PP  + V  + +
Sbjct  14972  PG-------LMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK  15024

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
              N   L   W  P   +       + +  R  R K + T         C +     G  +V
Sbjct  15025  NTADL--KWTVPEK-DGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYV  15081

Query  290    VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
               ++ A+   GQ +++E     +      +  PP        +  +   K   ++ +    
Sbjct  15082  FRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPP------YALAVVDVTKRHVDLKWEPPK  15135

Query  350    NATSLPVQ  357
              N    P+Q
Sbjct  15136  NDGGRPIQ  15143


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 46/143 (32%), Gaps = 23/143 (16%)

Query  208    FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFT  266
                   I +P  P  +    + ++   + +TW+ P   +     L  + +  R    KT+T
Sbjct  14407  IDVNVIARPSAPKELKFGDITKDS--VHLTWEPPD--DDGGSPLTGYVVEKREVSRKTWT  14462

Query  267    TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
                M         + D   G  ++ ++ A+ + G G                   P   +E
Sbjct  14463  KVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPG------------------EPAYVDE  14504

Query  327    VSTPMQALTTNKDDDNILFRDSA  349
                      T     +N+ +RD  
Sbjct  14505  PVNMSTPATVPDPPENVKWRDRT  14527


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/163 (15%), Positives = 60/163 (37%), Gaps = 16/163 (10%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDP----HSWNS  246
              +  A+S G               +P PP   + ++ +      +++ W+ P     S  +
Sbjct  27476  ITAANSSG-TTKAFINIVVLD--RPGPPTGPVVISDITEES--VTLKWEPPKYDGGSQVT  27530

Query  247    SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
              ++  L+     R   +  +T       +    +    +G  +  +++A+  FG  +  + 
Sbjct  27531  NYILLK-----RETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDS  27585

Query  307    SPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
              +   +  P+T +  PP+   V+   +   T    + +    SA
Sbjct  27586  ACVTVKLPYT-TPGPPSTPWVTNVTRESITVGWHEPVSNGGSA  27627


 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/137 (22%), Positives = 54/137 (39%), Gaps = 9/137 (7%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              ++ V ++ GSK     TF    +  P PP  IT   V R     ++ W  P   +     
Sbjct  29354  TLTVENNSGSKS---ITFTVKVLDTPGPPGPITFKDVTRGSA--TLMWDAP-LLDGGARI  29407

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    +++     K  +    ++D   G+ +  ++ A  E+G GE  E     
Sbjct  29408  HHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPI  29467

Query  311    MGTPWTESRSPPAENEV  327
              + T   E  +PP   +V
Sbjct  29468  VAT---EQPAPPRRLDV  29481


 Score = 50.6 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 44/291 (15%), Positives = 92/291 (32%), Gaps = 31/291 (11%)

Query  58     VHWVLRKPAAGSH-PSRWAGMGRRLLLRSVQLHDSGNYS---CYRAGRPAGTVHLLV-DV  112
              + W  +     S            L++  V  +D+G Y+     ++G+ + TV + V D 
Sbjct  30405  ITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDT  30464

Query  113    PPEEPQLS-CFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              P   P +           +     P           ++  R+      +     C  S+ 
Sbjct  30465  PGPCPSVKVKEVSRDSVTIT-WEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKC--SKT  30521

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF----SKTQTFQGCGILQPDPPANITVTA  226
                + S  +     + + Y   +   +  G       S            P  PA + V  
Sbjct  30522  LYRISGLV-----EGTMYYFRVLPENIYGIGEPCETSDAVLVSEV----PLVPAKLEVVD  30572

Query  227    VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF-TTWMVKDLQHHCVIHDAWSG  285
              V ++   +++ W+ P  ++       + L      ++ +     +K       +     G
Sbjct  30573  VTKST--VTLAWEKP-LYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEG  30629

Query  286    LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
               +++ ++RAQ E G    SE           + R  P  + +ST  Q    
Sbjct  30630  EQYLFRIRAQNEKGV---SEPRETVTAVTVQDLRVLPTID-LSTMPQKTIH  30676


 Score = 49.8 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 57/187 (30%), Gaps = 18/187 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP +P +          +   W  P            + +K +NS           S   
Sbjct  28686  PPGKPVIY---NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPIS---  28739

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQP-DPPANITVTAVAR  229
                     A    +   Y   +   +S G S  S    F     + P DPP   T   +  
Sbjct  28740  --GREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLA--VSPVDPPG--TPDYIDV  28793

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRH  288
                  +++ W  P   +     + + +  + + ++ +      D+ +    +     G R+
Sbjct  28794  TRETITLKWNPPLR-DGGSKIVGYSIE-KRQGNERWVRCNFTDVSECQYTVTGLSPGDRY  28851

Query  289    VVQLRAQ  295
                ++ A+
Sbjct  28852  EFRIIAR  28858


 Score = 49.4 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 38/249 (15%), Positives = 77/249 (31%), Gaps = 20/249 (8%)

Query  81     LLLRSVQLHDSGNYSCYRAGRPAGTV-HLLVDVP--PEEPQLSCFRKSPLSNVVCEWGPR  137
              L++   +  D G Y+     R       + V+V   P  P+   F      +V   W P 
Sbjct  14379  LVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP  14438

Query  138    ST--PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
                   S  T  V+   + +    + + +         +F+    V   +   Y+  +C  
Sbjct  14439  DDDGGSPLTGYVV---EKREVSRKTWTK-VMDFVTDLEFTVPDLVQGKE---YLFKVCAR  14491

Query  196    SSVG----SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
              +  G    +   +         + PDPP N+       N  +L  TW  P + +      
Sbjct  14492  NKCGPGEPAYVDEPVNMSTPATV-PDPPENVKWRDRTANSIFL--TWDPPKN-DGGSRIK  14547

Query  252    RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
               + +      S  +        +    +     G  +  +++A    G  + S  + E  
Sbjct  14548  GYIVERCPRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQ  14607

Query  312    GTPWTESRS  320
                   E+  
Sbjct  14608  AVDTQEAPE  14616


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 41/261 (16%), Positives = 83/261 (32%), Gaps = 27/261 (10%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFY  249
              ++ + +  G   S+T         +P PP   I +  +      ++++W+ P        
Sbjct  30737  TLELKNVTG-TTSETIKVIILD--KPGPPTGPIKIDEIDATS--ITISWEPPE--LDGGA  30789

Query  250    RLR-FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
               L  + +  R      +        +          G  +V ++ A   FG G + + S 
Sbjct  30790  PLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQ-SE  30848

Query  309    EAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFL  368
                          PP   ++                + RD    T  P +D     +  ++
Sbjct  30849  VIECRSSIRIPGPPETLQIF--------------DVSRDGMTLTWYPPEDDGGSQVTGYI  30894

Query  369    VAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSL---GQLVPERPRPTPVLV  425
              V    +     + +  V      ++   L EG    H   ++   G   P RP    V +
Sbjct  30895  VERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAM  30954

Query  426    PLISPPVSPSSLGSDNTSSHN  446
                I+PP  P +    +T+  +
Sbjct  30955  DPIAPPGKPQNPRVTDTTRTS  30975


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 77/232 (33%), Gaps = 31/232 (13%)

Query  111    DVP--PEEPQLSCFRKSPLSNVVCEW-GPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQ  166
              DVP  P  P +   R     +V   W  P+ T     T   L  ++  +     ++   +
Sbjct  21101  DVPDAPPPPNIVDVRHD---SVSLTWTDPKKTGGSPITGYHLEFKERNSL---LWKRANK  21154

Query  167    YSQESQKFSCQLAVPEGDSSFYIVSMCVASS--VGSKFSKTQTFQGCGILQPDPPANITV  224
                   + F         +   Y   +   +   VG     ++       +  DPP    V
Sbjct  21155  TPIRMRDFKVT---GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPI--DPPGKPEV  21209

Query  225    TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF-TTWMVKDLQHHCVIHDAW  283
                + RN   +++ W +P  ++       + +  R   SK++     V   +    + D  
Sbjct  21210  INITRNS--VTLIWTEP-KYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLV  21266

Query  284    SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
               G ++  ++RA+   G          A+  P   + +   ++E   P   L 
Sbjct  21267  EGGKYEFRIRAKNTAG----------AISAPSESTETIICKDEYEAPTIVLD  21308


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 43/111 (39%), Gaps = 7/111 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +   +S GSKF+     +   +  P P   + +  V  N +   + W DP   +     
Sbjct  16102  VITATNSCGSKFAA-ARVEVFDV--PGP--VLDLKPVVTNRKMCLLNWSDPED-DGGSEI  16155

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                F +  +  +  T+    ++  +  C I     G  +  ++ A+ +FG G
Sbjct  16156  TGFIIERKDAKMHTWRQ-PIETERSKCDITGLLEGQEYKFRVIAKNKFGCG  16205


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/141 (17%), Positives = 49/141 (35%), Gaps = 6/141 (4%)

Query  196    SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              +++GS  S T   Q     +P PP    +         +++ W+ P   +       + +
Sbjct  27876  NAMGSA-SATIRVQILD--KPGPPGG-PIEFKTVTAEKITLLWRPPAD-DGGAKITHYIV  27930

Query  256    RYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
                R      ++       +          G  ++ ++RA  ++G GE  E S   +    
Sbjct  27931  EKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLE-SDSVVAKNA  27989

Query  316    TESRSPPAENEVSTPMQALTT  336
                +  PP   EV+   +   T
Sbjct  27990  FVTPGPPGIPEVTKITKNSMT  28010


 Score = 47.1 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 50/308 (16%), Positives = 92/308 (30%), Gaps = 32/308 (10%)

Query  48     PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR---AGRPAG  104
              P +E   +                 + A     L+ +     DSG Y+       G    
Sbjct  22418  PTMEWSKDGK-----ELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKH  22472

Query  105    TVHLLVDVPPEEPQ--LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
                ++ V   P  P+  L+    +    V+  + P            +V+K + S      
Sbjct  22473  IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDH-YIVQKRETSRLAWTN  22531

Query  163    EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP----DP  218
                 +      K +  L   E     YI  +   +  G         +    + P    DP
Sbjct  22532  VASEVQVTKLKVTKLLKGNE-----YIFRVMAVNKYGVGE--PLESEPVLAVNPYGPPDP  22584

Query  219    PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHC  277
              P N  VT + ++   + V W  P S +     + + +  R +  + +     K L     
Sbjct  22585  PKNPEVTTITKDS--MVVCWGHPDS-DGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRY  22641

Query  278    VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
               +     G  +  ++ A+   G    S  SP            PP       P   L T+
Sbjct  22642  KVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPG-----NPR-VLDTS  22695

Query  338    KDDDNILF  345
              +   +I +
Sbjct  22696  RSSISIAW  22703


 Score = 47.1 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/199 (13%), Positives = 67/199 (34%), Gaps = 22/199 (11%)

Query  114    PEEPQLSCFRKSPLSNVVCEWGPR-STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
              P+ P+++   K     +   W P       +     L +K ++S    +    + +   +
Sbjct  19326  PDPPEVTKVSKEE---MTVVWNPPEYDGGKSITGYFLEKKEKHSTR--WVPVNKSAIPER  19380

Query  173    KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQT-FQGCGILQP-DPPANITVTAVAR  229
              +   Q  +P+ +   Y   +   + +G    S           ++P  PP N  V    +
Sbjct  19381  RMKVQNLLPDHE---YQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTK  19437

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT-----FTTWMVKD--LQHHCVIHDA  282
              +   +++ W  P  ++     + + +  R + +       +         ++    +   
Sbjct  19438  HS--ITLGWGKP-VYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSL  19494

Query  283    WSGLRHVVQLRAQEEFGQG  301
                   +  ++ AQ + G G
Sbjct  19495  DENQEYEFRVCAQNQVGIG  19513


 Score = 46.7 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 43/241 (18%), Positives = 70/241 (29%), Gaps = 31/241 (13%)

Query  79     RRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
               +L +R     D G Y        G       + V   P  P    F     ++V+C+W 
Sbjct  15691  SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWE  15750

Query  136    PR-STPSLTT-KAVLLVRKFQNSPAEDFQ-----EPCQYSQESQKFSCQLAVPEGDSSFY  188
              P             L  +      +E          C+YS               +   Y
Sbjct  15751  PPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVT----------KLIEGKEY  15800

Query  189    IVSMCVASSVGS----KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW  244
              +  +   +  G                G   PD P    V  V  N     V W +P   
Sbjct  15801  LFRVRAENRFGPGPPCVSKPLVAKDPFG--PPDAPDKPIVEDVTSNSML--VKWNEPK--  15854

Query  245    NSSFYRLRFELRYRAERSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
              ++    L + L  R   S  ++      L      +     GL +V ++ A+   G G++
Sbjct  15855  DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKF  15914

Query  304    S  304
              S
Sbjct  15915  S  15915


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 75/276 (27%), Gaps = 25/276 (9%)

Query  60     WVLRKPAAGSHPS---RWAGMGRRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLV-DV  112
              W        +              L +++    D+G Y       AG     VHL V DV
Sbjct  18471  WTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDV  18530

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPR-STPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQE  170
              P               ++   W P            ++          +D ++       
Sbjct  18531  PGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIV--------EKQDTRKDTWGVVS  18582

Query  171    SQKFSCQLAVPEGDSS-FYIVSMCVASSVGSKFSKTQTFQGCG--ILQPDPPANITVTAV  227
              S     +L +P       Y+  +   + +G       T          P PP    VT +
Sbjct  18583  SGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDI  18642

Query  228    ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGL  286
                N    +V+W  P S       +      R E +  +       +      +   + G 
Sbjct  18643  TENAA--TVSWTLPKS--DGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGN  18698

Query  287    RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
               +  ++ A+   G  + S  S         +   PP
Sbjct  18699  TYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPP  18734


 Score = 46.7 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 55/140 (39%), Gaps = 10/140 (7%)

Query  166    QYSQESQKFSCQLAVPEG---DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANI  222
              +YS E+   S  L +P+    D+  YI+++   + VG   S T + +      P     +
Sbjct  28244  RYSIENTDSSSLLTIPQVTRNDTGKYILTIE--NGVGEPKSSTVSVKVLD--TPAACQKL  28299

Query  223    TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
               V  V+R    +++ W  P   +     + + +  R    +T++    K       + D 
Sbjct  28300  QVKHVSR--GTVTLLWDPPLI-DGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDL  28356

Query  283    WSGLRHVVQLRAQEEFGQGE  302
                      ++ A+ E G GE
Sbjct  28357  SEKTPFFFRVLAENEIGIGE  28376


 Score = 46.3 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 55/178 (31%), Gaps = 34/178 (19%)

Query  133    EWGPRSTPSLT--TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV  190
               W P      +  T  ++   + + +  + +        E +K S  +      + +Y  
Sbjct  19645  SWAPPENDGGSQVTHYIV---EKREADRKTWSTVTP---EVKKTSFHVTNLVPGNEYYF-  19697

Query  191    SMCVASSVGSK----------FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
               +   +  G             S   +       +PDPP  + VT + +N    ++ W  
Sbjct  19698  RVTAVNEYGPGVPTDVPKPVLASDPLS-------EPDPPRKLEVTEMTKNSA--TLAWLP  19748

Query  241    P---HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
              P          Y   +    +      +T + V       V+     G ++  ++ A+
Sbjct  19749  PLRDGGAKIDGYITSYREEEQPAD--RWTEYSVVK-DLSLVVTGLKEGKKYKFRVAAR  19803


 Score = 46.3 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 62/209 (30%), Gaps = 27/209 (13%)

Query  165    CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ-----------TFQGCGI  213
              C++++E Q  S         S  +   +   +  G   +                +   I
Sbjct  31095  CKWTKEGQDIS--KRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI  31152

Query  214    LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL  273
                P+ P    +       R + V+W+ P   +     L + L  R      + T   +  
Sbjct  31153  GSPNSPEG-PLEYDDIQVRSVRVSWRPPAD-DGGADILGYILERREVPKAAWYTIDSRVR  31210

Query  274    QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQA  333
                  V+      + +  ++ A+ +FG  +     P     P T           S P + 
Sbjct  31211  GTSLVVKGLKENVEYHFRVSAENQFGISK-----PLKSEEPVTPKTPLNPPEPPSNPPEV  31265

Query  334    LTTNKDDDNILFRDSANATSLPVQDSSSV  362
              L   K   ++ +       S P  D  S 
Sbjct  31266  LDVTKSSVSLSW-------SRPKDDGGSR  31287


 Score = 46.0 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 55/145 (38%), Gaps = 9/145 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               M + +  G K S     +      P P  N+  T + ++   +++ W  P   +     
Sbjct  21773  VMTIENPAGKK-SGFVNVRVLD--TPGPVLNLRPTDITKDS--VTLHWDLPLI-DGGSRI  21826

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R    K+++T   K  +    +     G  +  ++ A+ E+G GE +E +   
Sbjct  21827  TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPV  21886

Query  311    MGTPWTESRSPPAENEVSTPMQALT  335
                   +E+ SPP    +    ++  
Sbjct  21887  KA---SEAPSPPDSLNIMDITKSTV  21908


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/133 (17%), Positives = 45/133 (34%), Gaps = 7/133 (5%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              +   +  G   S T   +     +P PP   + ++ V       ++ W+ P   +     
Sbjct  23543  LKAKNVAGE-RSVTVNVKVLD--RPGPPEGPVVISGVTAE--KCTLAWKPPLQ-DGGSDI  23596

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
              + + +  R      +T          C +     G  +  ++ A  ++G GE  E  P  
Sbjct  23597  INYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVV  23656

Query  311    MGTPWTESRSPPA  323
                 P+    +P A
Sbjct  23657  AKNPFVVPDAPKA  23669


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 47/321 (15%), Positives = 94/321 (29%), Gaps = 35/321 (11%)

Query  33     GVLTSLPGDSVTLTCP-GVEPEDNATVHWVL-RKPAAGSHPSRWAGMGR--RLLLRSVQL  88
               ++T   G  + L    G +PE    + W    K             G+    +++    
Sbjct  29982  DLVTIRAGSDLVLDAAVGGKPE--PKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDR  30039

Query  89     HDSGNYSCY----RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-  143
               DSG Y+         +    +  ++D P    +L+  R +     +    P+       
Sbjct  30040  SDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI  30099

Query  144    TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS---  200
              T  ++  R+         +  C         S  +     ++  YI  +   +  G    
Sbjct  30100  THYIVERRETSRLNWVIVEGECPT------LSYVVTRLIKNNE-YIFRVRAVNKYGPGVP  30152

Query  201    KFSKTQ----TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
                S+      +F       P PP       V      + + W  P S +       + + 
Sbjct  30153  VESEPIVARNSFTI-----PSPPG--IPEEVGTGKEHIIIQWTKPES-DGGNEISNYLVD  30204

Query  257    YRAERSKTFTTWMVKDL--QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
               R ++S  +T      +       +     G  +  ++ A    G  E SE S       
Sbjct  30205  KREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE  30264

Query  315    WTESRSPPAENEVSTPMQALT  335
               + +  PP+   V    +   
Sbjct  30265  PSYTPGPPSAPRVVDTTKHSI  30285


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 53/306 (17%), Positives = 97/306 (32%), Gaps = 36/306 (12%)

Query  58     VHWVLRKPA-AGSHPSRWAGMGRRLLLRSVQL--HDSGNY---SCYRAGRPAGTVHLLVD  111
              V W   +        +        L L  ++    DSG Y        G   G   + V 
Sbjct  17777  VSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVV  17836

Query  112    VPPEEPQ--LSCFRKSPLSNVVCEWGPR-STPSLT-TKAVLLVRKFQNSPAEDFQEPCQY  167
                P  P   +S F +     +V  W P         T  ++   + +    + +      
Sbjct  17837  DRPGPPVGPVS-FDEVTKDYMVISWKPPLDDGGSKITNYII---EKKEVGKDVWM---PV  17889

Query  168    SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC---GILQ-PDPPANIT  223
              +  S K +C+++    +   YI  +   +  G   S              + PD P    
Sbjct  17890  TSASAKTTCKVSK-LLEGKDYIFRIHAENLYGI--SDPLVSDSMKAKDRFRVPDAPDQPI  17946

Query  224    VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ--HHCVIHD  281
              VT V ++     VTW  PH          + L  R   SK +       +       + D
Sbjct  17947  VTEVTKDSAL--VTWNKPHDGGKPI--TNYILEKRETMSKRWARVTKDPIHPYTKFRVPD  18002

Query  282    AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDD  341
                 G ++  ++ A+ E G G+ S  S           + P A+       +A+ T  +  
Sbjct  18003  LLEGCQYEFRVSAENEIGIGDPSPPSKPVFA------KDPIAKPSPPVNPEAIDTTCNSV  18056

Query  342    NILFRD  347
              ++ ++ 
Sbjct  18057  DLTWQP  18062


 Score = 44.4 bits (103),  Expect = 0.003, Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 83/251 (33%), Gaps = 23/251 (9%)

Query  81     LLLRSVQL--HDSGNY---SCYRAGRPAGTVHLLV---DVPPEEPQLSCFRKSPLSNVVC  132
              L +   +    D+G Y   +   +G     ++++V     PP  P +         +V  
Sbjct  27459  LTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVV--ISDITEESVTL  27516

Query  133    EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
              +W P      +     ++ K + S A       + S    +   ++         Y   +
Sbjct  27517  KWEPPKYDGGSQVTNYILLKRETSTAVWT----EVSATVARTMMKVMKLTTGEE-YQFRI  27571

Query  193    CVASSVGSKF---SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
                 +  G      S   T +      P PP+   VT V R    ++V W +P S N    
Sbjct  27572  KAENRFGISDHIDSACVTVKLPY-TTPGPPSTPWVTNVTRES--ITVGWHEPVS-NGGSA  27627

Query  250    RLRFELRYRAERSKTFTTWM-VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
               + + L  +   S  +     +     H  +    +GL +  ++ A+   G G+ S  S 
Sbjct  27628  VVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSE  27687

Query  309    EAMGTPWTESR  319
                +     E  
Sbjct  27688  PVLAIDACEPP  27698


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 40/282 (14%), Positives = 81/282 (29%), Gaps = 39/282 (14%)

Query  60     WVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVP-PEEP  117
              W     +     S +    G+    R    +++G  +       A    +  D+     P
Sbjct  20856  WQRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLP  20915

Query  118    QLSCFRKSPLSNV------------VCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
               L C+     SN                W     P L T   + V     +         
Sbjct  20916  DL-CYLAKENSNFRLKIPIKGKPAPSVSWKKGEDP-LATDTRVSVESSAVNTTL------  20967

Query  166    QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT  225
                              + D+  Y +++   +  G+K     T     + +P  P    + 
Sbjct  20968  ----------IVYDCQKSDAGKYTITL--KNVAGTKEG---TISIKVVGKPGIPTG-PIK  21011

Query  226    AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
                      +++ W  P   +       + L  R   +  + T      +    +     G
Sbjct  21012  FDEVTAEAMTLKWAPPKD-DGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEG  21070

Query  286    LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
              + +  ++ A+ ++G GE  +  P     P+    +PP  N V
Sbjct  21071  MEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIV  21112


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 26/176 (15%), Positives = 55/176 (31%), Gaps = 32/176 (18%)

Query  131    VCEWGPRSTPSLTTKAVLLVRKFQNSP----AEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
               C+W       + T + L V K  +S      +  ++   Y   + + S           
Sbjct  19856  TCKWKKGED-EVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQ-----  19909

Query  187    FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
                 + + V  + G                P PP +I+      +    S++W  P   + 
Sbjct  19910  --KIKVVVMDAPGP---------------PQPPFDIS----DIDADACSLSWHIPLE-DG  19947

Query  247    SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                    + +         + T +    +  C +     G  ++ ++RA+  FG  E
Sbjct  19948  GSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISE  20003


 Score = 44.0 bits (102),  Expect = 0.004, Method: Composition-based stats.
 Identities = 21/119 (18%), Positives = 49/119 (41%), Gaps = 7/119 (6%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +C  +  G    KT       +  PDPP  + V+ V+R+   +++TW +P S      +
Sbjct  32027  VVCAKNRFGIDQ-KTVELDVADV--PDPPRGVKVSDVSRDS--VNLTWTEPAS--DGGSK  32079

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              +   +  +   +      + +  +    + + +    +  ++ A+ +FG  + SE S  
Sbjct  32080  ITNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEP  32138


 Score = 43.3 bits (100),  Expect = 0.007, Method: Composition-based stats.
 Identities = 33/292 (11%), Positives = 77/292 (26%), Gaps = 28/292 (10%)

Query  60     WVLRKPAAGSHPSRWAGMGRR-LLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPE  115
              W                     L+++     DSG Y      + G+ A  + + V   P 
Sbjct  31097  WTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPN  31156

Query  116    EPQLSCFRKSPLSN-VVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
               P+            V   W P +          ++ + +   A  +    +      + 
Sbjct  31157  SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRV-----RG  31211

Query  175    SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA--------  226
              +  +     ++  Y   +   +  G               +P  P               
Sbjct  31212  TSLVVKGLKENVEYHFRVSAENQFGISKPLKSE-------EPVTPKTPLNPPEPPSNPPE  31264

Query  227    -VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWS  284
               +      +S++W  P   +       + +  +   +  +       +      +     
Sbjct  31265  VLDVTKSSVSLSWSRPKD-DGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVP  31323

Query  285    GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
                 +  ++ AQ + G  E S  S   +     +  S P E E+ +  +   T
Sbjct  31324  DAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVT  31375


 Score = 42.9 bits (99),  Expect = 0.008, Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 52/185 (28%), Gaps = 12/185 (6%)

Query  123    RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE  182
                   +     W           + +     +    +  +             C++   +
Sbjct  21508  SNVTKNTATVSWKRPVDDG---GSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQ  21564

Query  183    GDSSFYIVSMCVASSVGS---KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
               + S Y   +   +  G      +            P PP+N  VT   +     S+ W 
Sbjct  21565  -EGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSA--SLAWG  21621

Query  240    DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ--HHCVIHDAWSGLRHVVQLRAQEE  297
               PH ++       + + ++    + +              V+ D  +  ++  ++ A  +
Sbjct  21622  KPH-YDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND  21680

Query  298    FGQGE  302
               G GE
Sbjct  21681  AGVGE  21685


 Score = 42.5 bits (98),  Expect = 0.010, Method: Composition-based stats.
 Identities = 18/131 (14%), Positives = 47/131 (36%), Gaps = 7/131 (5%)

Query  192    MCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
              + + ++ G K   T +     I +P P    I V++V+       ++W +P     +   
Sbjct  29647  LTLENTAGVK---TFSVTVVVIGRPGPVTGPIEVSSVSAES--CVLSWGEPKDGGGTEIT  29701

Query  251    LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
                + +  R   +  +        +    +      + +  ++ ++  FG  +  E +P  
Sbjct  29702  -NYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPII  29760

Query  311    MGTPWTESRSP  321
                 P+    +P
Sbjct  29761  AEHPFVPPSAP  29771


 Score = 42.1 bits (97),  Expect = 0.015, Method: Composition-based stats.
 Identities = 39/199 (20%), Positives = 68/199 (34%), Gaps = 26/199 (13%)

Query  24    RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM-GRR--  80
               P+  V  G   ++P  +V      ++      + W        S P  + G+ G    
Sbjct  6255  EPPSFLVKPGRQQAIPDSTVEFK-AILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSF  6313

Query  81    LLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPP---EEPQLSCFRK-SPLSNVVCE  133
             L L SV    +G Y+C+     G  + T  LLV  PP   ++ + S   K    S + C 
Sbjct  6314  LNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLEC-  6372

Query  134   WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ-----------ESQKFSCQLAVPE  182
                +   S   + V    + +   ++ ++     S            +S  F C+   P 
Sbjct  6373  ---KIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPA  6429

Query  183   GDSSFYIVSMCVASSVGSK  201
             G +S     +     V S 
Sbjct  6430  GSTSCSTKVIVKEPPVFSS  6448


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 73/243 (30%), Gaps = 38/243 (16%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSH---PSRWAGMGRRLLLRSVQLHDSGNYSC  96
             G  VTLTC  +       V W              + +      L +    L  SG YSC
Sbjct  7116  GLPVTLTC-RLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSC  7174

Query  97    YRA---GRPAGTVHLLVDVPPE------EPQLSCFRKSPLSNVVC----------EWG--  135
               +   G  + +  L    P +      +P          ++  C           W   
Sbjct  7175  SASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKD  7234

Query  136   -----PRSTPSLTTKAVL-LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
                  P    ++T       +R  +    +  Q  CQ + +  K  C   +   +   ++
Sbjct  7235  NKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFV  7294

Query  190   VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
               +  +        + ++ Q    +   P   I V+   RN   L  +W+   S+ +S  
Sbjct  7295  KKLEAS----KVAKQGESIQLECKISGSP--EIKVSWF-RNDSELHESWKYNMSFINSVA  7347

Query  250   RLR  252
              L 
Sbjct  7348  LLT  7350


 Score = 40.9 bits (94),  Expect = 0.033, Method: Composition-based stats.
 Identities = 49/348 (14%), Positives = 100/348 (29%), Gaps = 36/348 (10%)

Query  16     PGAALAPRRCPAQEVAR---GVLTSLPGDSVTLTCPGVEPEDNATVHWVL-RKPAAGSHP  71
              P  A      P   +       +    G++  L    V  +   T+ W+   K    S  
Sbjct  24540  PITAKDEVELPRISMDPKFRDTIVVNAGETFRLEAD-VHGKPLPTIEWLRGDKEIEESAR  24598

Query  72     SRWAGMGRRLLLRSVQLH--DSGNYSCYRAGRPAGTV-HLLVDV-----PPEEPQLSCFR  123
                      + LL        D G Y    +         + V V     PPE P      
Sbjct  24599  CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGV  24658

Query  124    KSPLSNVVCEWGPR-STPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
               S   ++   W P         +  V+  R+                 E    S ++   
Sbjct  24659  TSEKCSLT--WSPPLQDGGSDISHYVVEKRETSRLAWTVVAS------EVVTNSLKVTK-  24709

Query  182    EGDSSFYIVSMCVASSVGSKFSKTQT--FQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
                + + Y+  +   +  G                + P PP ++ VT +A++   ++V W 
Sbjct  24710  LLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDS--MTVCWN  24767

Query  240    DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEF  298
               P S +     + + +  R      +     + +      +        +  ++ A+   
Sbjct  24768  RPDS-DGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAA  24826

Query  299    GQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFR  346
              G G        +  T + ++  P  +    T    + T K+   + + 
Sbjct  24827  GVG------EPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWG  24868


 Score = 40.2 bits (92),  Expect = 0.050, Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 42/136 (31%), Gaps = 20/136 (15%)

Query  11    ALLAAPGAALAPRRCPAQEVARGV------LTSLPGDSVTLTCPGVEPEDNATVHWVLRK  64
              L+  P  A A        +          +T   G + T+TC    P  N    W    
Sbjct  9655  RLVCGPHIASAKLT----VIEPAWERHLQDVTLKEGQTCTMTCQFSVP--NVKSEWFRNG  9708

Query  65    P---AAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPP----EEP  117
                   G H +       +L +  V+  D G Y+C +      +  L ++  P    +  
Sbjct  9709  RILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTC-KYEDLETSAELRIEAEPIQFTKRI  9767

Query  118   QLSCFRKSPLSNVVCE  133
             Q     +   +   CE
Sbjct  9768  QNIVVSEHQSATFECE  9783


 Score = 39.4 bits (90),  Expect = 0.095, Method: Composition-based stats.
 Identities = 36/226 (16%), Positives = 64/226 (28%), Gaps = 41/226 (18%)

Query  3     AVGCALLAALLAAPGAALAPRRCPAQEVARGVLTS-LPGDSVTLTCPGVEPEDNATVHWV  61
             +  C+    +          R  P+           LPG+S  L C  ++      V W 
Sbjct  4651  SSSCSATVTV----------REPPSFVKKVDPSYLMLPGESARLHCK-LKGSPVIQVTWF  4699

Query  62    LRKPAAGSHPSRW---AGMGRRLLLRSVQLHDSGNYSCYR---AGRPAGTVHLLVDVPPE  115
                       +           L +  V++ DSG+YSC      G  + +  +++  PP 
Sbjct  4700  KNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPS  4759

Query  116   -----EPQ---------LSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNS----  156
                  EP          L C            W         + K  L  +K        
Sbjct  4760  FIKTLEPADIVRGTNALLQCEVS-GTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIF  4818

Query  157   ---PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG  199
                 A+  +  C  + E  K  C       +   ++  +    ++G
Sbjct  4819  SFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALG  4864


 Score = 38.6 bits (88),  Expect = 0.17, Method: Composition-based stats.
 Identities = 28/143 (20%), Positives = 42/143 (29%), Gaps = 25/143 (17%)

Query  19    ALAP-RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK---PAAGSHPSRW  74
             AL      P        L +  GDSV+L C      +  TV W            + + +
Sbjct  6998  ALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPE-ITVSWYKGDTKLRPTPEYRTYF  7056

Query  75    AGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLV------DVPP---------EEPQ-  118
                   L+   V ++DSG Y+C             V       +PP         E+   
Sbjct  7057  TNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVG  7116

Query  119   ----LSCFRKSPLSNVVCEWGPR  137
                 L+C         VC +   
Sbjct  7117  LPVTLTCRLNGSAPIQVCWYRDG  7139


 Score = 38.6 bits (88),  Expect = 0.18, Method: Composition-based stats.
 Identities = 30/203 (15%), Positives = 51/203 (25%), Gaps = 31/203 (15%)

Query  20    LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA---G  76
             L     P        + S     V L C  V+ +   TV W                   
Sbjct  4565  LIIIDKPHFIKELEPVQSAINKKVHLECQ-VDEDRKVTVTWSKDGQKLPPGKDYKICFED  4623

Query  77    MGRRLLLRSVQLHDSGNYSCYRAGRPAGTVH------------------LLVDVPPEEPQ  118
                 L +   +L DSG Y C  +     +                      + +P E  +
Sbjct  4624  KIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESAR  4683

Query  119   LSCFRKSPLSNVVCEW--GPRSTPSLTTKAVLLVRKFQNSPAEDFQ------EPCQYSQE  170
             L C  K     +   W    +      T  +  V         D +        C+   +
Sbjct  4684  LHCKLKGSPV-IQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVND  4742

Query  171   SQKFSCQLAVPEGDSSFYIVSMC  193
                 SC   +   +   +I ++ 
Sbjct  4743  VGSDSCSTEIVIKEPPSFIKTLE  4765


 Score = 38.2 bits (87),  Expect = 0.19, Method: Composition-based stats.
 Identities = 20/126 (16%), Positives = 45/126 (36%), Gaps = 11/126 (9%)

Query  215    QPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL  273
              +P PPA  + +  +       S++W  P   +       + +  R      +T    +  
Sbjct  26809  KPGPPAGPLEINGLTAE--KCSLSWGRPQE-DGGADIDYYIVEKRETSHLAWTICEGELQ  26865

Query  274    QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES---RSPPAENEVSTP  330
                 C +     G  ++ ++    ++G GE      E++     +     SPP   E+++ 
Sbjct  26866  MTSCKVTKLLKGNEYIFRVTGVNKYGVGE----PLESVAIKALDPFTVPSPPTSLEITSV  26921

Query  331    MQALTT  336
               +   T
Sbjct  26922  TKESMT  26927


 Score = 37.9 bits (86),  Expect = 0.29, Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 75/229 (33%), Gaps = 20/229 (9%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYSQE  170
              PP  P ++   K     ++ +W  P +          L  ++  +     + +  +   +
Sbjct  25434  PPGTPFVTSISKDQ---MLVQWHEPVNDGGTKIIGYHLEQKEKNSI---LWVKLNKTPIQ  25487

Query  171    SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP-DPPANITVTAVAR  229
                KF     + EG    + VS      +G     ++ F       P DPP       + R
Sbjct  25488  DTKFK-TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD---PCDPPGRPEAIVITR  25543

Query  230    NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWSGLRH  288
              N   +++ W+ P  ++       + +  +      +      ++ +    +       R+
Sbjct  25544  NN--VTLKWKKPA-YDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRY  25600

Query  289    VVQLRAQEEFGQGEWSEWSPEAMG-TPWTESRSPPAENEVSTPMQALTT  336
                ++ A+     G +SE S  +   T   E  +P A  +       +  
Sbjct  25601  EFRVIAR--NAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVH  25647


 Score = 37.1 bits (84),  Expect = 0.48, Method: Composition-based stats.
 Identities = 19/84 (23%), Positives = 30/84 (36%), Gaps = 7/84 (8%)

Query  38    LPGDSVTLTCPGVEPEDNATVHWVLRKPAA---GSHPSRWAGMGRRLLLRSVQLHDSGNY  94
               G+S T  C  V       + W          G++          L +  V   D+G Y
Sbjct  8151  ALGESGTFKCH-VTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQY  8209

Query  95    SCYRA---GRPAGTVHLLVDVPPE  115
             +CY +   G+ + +  L V  PP 
Sbjct  8210  TCYASNIAGKDSCSAQLGVQEPPR  8233


 Score = 37.1 bits (84),  Expect = 0.48, Method: Composition-based stats.
 Identities = 10/88 (11%), Positives = 25/88 (28%), Gaps = 4/88 (5%)

Query  216    PDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ  274
              P  P   I    +  +   L  +W  P           + +  R      +        +
Sbjct  28584  PSKPKGPIRFDEIKADSVIL--SWDVPEDNGGGEITC-YSIEKRETSQTNWKMVCSSVAR  28640

Query  275    HHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                  + +      +  ++RA+  +G  +
Sbjct  28641  TTFKVPNLVKDAEYQFRVRAENRYGVSQ  28668


 Score = 36.7 bits (83),  Expect = 0.58, Method: Composition-based stats.
 Identities = 24/152 (16%), Positives = 47/152 (31%), Gaps = 17/152 (11%)

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDP---P---ANITVTAVARNPRWLSVTWQDPHSW  244
              S+   +  G +  KT       +  P P   P    N+T  +         +TW  P   
Sbjct  17521  SLLAKNEAGERK-KTIIVDVLDV--PGPVGTPFLAHNLTNES-------CKLTWFSPED-  17569

Query  245    NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              +       + +  R    + +T       + +  +     G  +  ++ A+   G G + 
Sbjct  17570  DGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFV  17629

Query  305    EWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
              E S   +          P + EV    +   T
Sbjct  17630  ETSEALVIREPITVPERPEDLEVKEVTKNTVT  17661


 Score = 36.3 bits (82),  Expect = 0.72, Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 75/257 (29%), Gaps = 26/257 (10%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
              PP  P  +   K    ++V +W  P +          L RK +NS               
Sbjct  24352  PPGTPFATAISKD---SMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQ  24408

Query  172    QKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
               K        E +   Y  ++                  C     DPP   T   +    
Sbjct  24409  FKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPC-----DPPG--TPEPIMVKR  24461

Query  232    RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVV  290
                +++ W  P  ++       + +  R      +      + ++    +       R+  
Sbjct  24462  NEITLQWTKP-VYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEF  24520

Query  291    QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
              ++ A+           +  A+  P   +    A++EV  P  ++     D  ++   +A 
Sbjct  24521  RVIAKN----------AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV---NAG  24567

Query  351    ATSLPVQDSSSVPLPTF  367
               T     D    PLPT 
Sbjct  24568  ETFRLEADVHGKPLPTI  24584


 Score = 35.9 bits (81),  Expect = 0.99, Method: Composition-based stats.
 Identities = 31/235 (13%), Positives = 76/235 (32%), Gaps = 22/235 (9%)

Query  73     RWAGMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSN  129
                A     +++   +   +G YS     +AG+      + V   P  P+          +
Sbjct  16795  ETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGS  16854

Query  130    VVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSF  187
                  W  P        K  ++  + +    + + +           S    VP+      
Sbjct  16855  CRLSWKMPDDDGGDRIKGYVI--EKRTIDGKAWTKVNPD-----CGSTTFVVPDLLSEQQ  16907

Query  188    YIVSMCVASSVGS---KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP--H  242
              Y   +   +  G      +  +T     I  PDPP  + +  + +N   + ++W+ P   
Sbjct  16908  YFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNT--VHLSWKPPKND  16965

Query  243    SWNSSFYRLRFELRYRAE--RSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRA  294
                +   + +   L +     + + +     +D++     + D   G  +  +++A
Sbjct  16966  GGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKA  17020


 Score = 35.2 bits (79),  Expect = 2.0, Method: Composition-based stats.
 Identities = 37/283 (13%), Positives = 81/283 (29%), Gaps = 45/283 (16%)

Query  90     DSGNYS---CYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS-TPSLTT-  144
              D+G Y+     + G    ++++ V   P   +         S+    W P          
Sbjct  15380  DAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPIL  15439

Query  145    KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSFYIVSMCVASSVGSKFS  203
                VL   + + +    +         S +      V +   +  Y   +   + VG    
Sbjct  15440  HYVL---ERREAGRRTYI-----PVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGE-  15490

Query  204    KTQTFQGCGILQPDP----------PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
                       I   +P             + V         +++TW+ P  ++     + +
Sbjct  15491  --------YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPP-LYDGGSKIMGY  15541

Query  254    ELRYRAERSKTF---TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
               +   A+  + +      +V  L           G  +  ++RA+   G       S  +
Sbjct  15542  IIEKIAKGEERWKRCNEHLVPILT--YTAKGLEEGKEYQFRVRAENAAGI------SEPS  15593

Query  311    MGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATS  353
                TP T++  P    +V           D+  +    S +   
Sbjct  15594  RATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYP  15636


> sp|Q3UH53|SDK1_MOUSE Protein sidekick-1 OS=Mus musculus OX=10090 
GN=Sdk1 PE=1 SV=1
Length=2193

 Score = 71.8 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 57/325 (18%), Positives = 103/325 (32%), Gaps = 23/325 (7%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPS  72
            A+    +  R              + G + TL C    +P  +    W        +  S
Sbjct  546  ASAMLTVWNRTSIVH--PPEDRVVIKGTTATLCCGATHDPRTSLRYVWKKDNVVITASSS  603

Query  73   RWAGMGR--RLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQ--LSCFRKS  125
                + +   L++      D G+Y+C      G  + T  L V   P  PQ  L+    +
Sbjct  604  SRIVVEKDGSLVISQTWSGDIGDYTCEIISEGGSDSRTARLEVIELPHPPQNLLASLSPA  663

Query  126  PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
               +V   W      +      ++     NSP +            +     ++      
Sbjct  664  RSHSVTLSWVRPFDGNSPVLYYIVQVSENNSPWKVHLSN----VGPEMTGVTVSGLTPAR  719

Query  186  SFYIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHS  243
            + Y   +C  + VG     ++T            PP NI  +   R  + + V WQ P  
Sbjct  720  T-YQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVAS--GRTNQSIMVQWQPPPE  776

Query  244  WNSSFYRLRFELRYRAERSKTFTTW--MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
               +     + LRYR            +     ++C++ D     ++ +Q+ A    G G
Sbjct  777  TEHNGVLRGYILRYRLAGLPGEHQQRNISSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLG  836

Query  302  EWSEWSPEAM--GTPWTESRSPPAE  324
             +S    E    G P    ++  AE
Sbjct  837  VFSRAVTEYTLQGVPTAPPQNVQAE  861


 Score = 59.1 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 54/326 (17%), Positives = 103/326 (32%), Gaps = 40/326 (12%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW----AGMGRRLLLRSVQLHDSGNYS  95
            G +  L C  V       + W        S   R           L +  V + D+GNY+
Sbjct  476  GMTAVLRCE-VSGAPKPAITWKRGNHILASGSVRIPRFMLLESGGLRIAPVFIQDAGNYT  534

Query  96   CYR--AGRPAGTVHLL-------VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
            CY            +L       +  PPE+  +    K   + + C  G    P  + + 
Sbjct  535  CYAANTEASVNASAMLTVWNRTSIVHPPEDRVVI---KGTTATLCC--GATHDPRTSLRY  589

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ  206
            V        + +   +   +    S   S   +   GD +      C   S G   S+T 
Sbjct  590  VWKKDNVVITASSSSRIVVE-KDGSLVISQTWSGDIGDYT------CEIISEGGSDSRTA  642

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
              +   +  P PP N+  +        ++++W  P   NS    L + ++  +E +  + 
Sbjct  643  RLEVIEL--PHPPQNLLASLSPARSHSVTLSWVRPFDGNSP--VLYYIVQV-SENNSPWK  697

Query  267  TW--MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAE  324
                 V        +        +  ++ A  + G+G++S  +  +      E  S P +
Sbjct  698  VHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYS--TETSRLMLPEEPPSAPPK  755

Query  325  NEVSTPMQALTTNKDDDNILFRDSAN  350
            N V     A         + ++    
Sbjct  756  NIV-----ASGRTNQSIMVQWQPPPE  776


 Score = 54.0 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 59/324 (18%), Positives = 101/324 (31%), Gaps = 26/324 (8%)

Query  81    LLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP  140
             L +++     +G +S    GR   +V      P   P+         + ++  W   S P
Sbjct  1232  LRMQAFNAIGAGPWSELVRGRTRESV------PSAAPENVSAEAVSSTQILLTW--ASVP  1283

Query  141   SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS  200
                   ++L  K      +   EP  +          L         Y + +   + +G+
Sbjct  1284  EQDQNGLILGYKVLYCAKDLDPEPRSHVVRGNHTQSALLAGLRKFVVYELQVLAFTRIGN  1343

Query  201   -KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA  259
                S     +      P PP  + +         + + WQ P     +   L +++ YR 
Sbjct  1344  GVPSSPLILERTKDDTPGPP--VRLVFPEVRLTAVRIVWQPPE--EPNGVILGYQIAYRL  1399

Query  260   ERSK--TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT-  316
                   TFTT  V          +      ++ +L A+   G GE      EA       
Sbjct  1400  ASGSPHTFTTVEVGATVRQFTATELAPESAYIFRLSAKTRQGWGE----PLEATVITTEK  1455

Query  317   -ESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP--TFLVAGGS  373
              E  +PP E  V    QA  T +         S  A+ +         LP   +     S
Sbjct  1456  RERPAPPRELLVP---QAEVTARSLRLQWVPGSDGASPIRYFTVQVRELPGGEWQTYSSS  1512

Query  374   LAFGTLLCIAIVLRFKKTWKLRAL  397
             ++     C    LR   ++KLR  
Sbjct  1513  ISHEATACAVERLRPFTSYKLRLK  1536


 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 48/243 (20%), Positives = 76/243 (31%), Gaps = 32/243 (13%)

Query  106   VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
             V  L DVP E P          S+V+ +W P    SL    +L   +      E      
Sbjct  1553  VTTLQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESL--NGLLQGYRIYYRELESETGMS  1610

Query  166   QYSQESQKFSCQLAVPEGDSSF----------------------YIVSMCVASSVG-SKF  202
                +  +  S   A     SSF                      Y V M   + +G S  
Sbjct  1611  PEPKTLKSPSALRAELTAQSSFKTVNSSSSLTTYELTHLKKYRRYEVIMTAYNIIGESPA  1670

Query  203   SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS  262
             S               P N+ VT +      L VTW  P   + +     +++ Y    S
Sbjct  1671  SVPVEVFVGEAAPAMAPQNVQVTPLTA--SQLEVTWDPPPPESQNGNIQGYKVYYWEADS  1728

Query  263   K--TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
             +  T    ++   +    I D  S  ++++ + A    G G  S+      G     +  
Sbjct  1729  RNETEKMKVLFLPEPVVKIKDLTSHTKYLISISAFNAAGDGPKSD---PCQGRTHQAAPG  1785

Query  321   PPA  323
             PP+
Sbjct  1786  PPS  1788


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/205 (14%), Positives = 63/205 (31%), Gaps = 34/205 (17%)

Query  114   PEEPQ--LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
             P  P+  L    +    ++  +W P S  +   +    V+  +    E        S E+
Sbjct  1459  PAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRY-FTVQVRELPGGEWQTYSSSISHEA  1517

Query  172   QKFSCQLAVPEGDSSFYIVSMCVASSVGSK--FSKTQTFQGCGILQPDPPANITVTAVAR  229
                +C +       + Y + +   + +G     ++T+       +  +PP +++ T    
Sbjct  1518  --TACAVER-LRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQDVPGEPPGSVSATPHTT  1574

Query  230   NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT------------------------F  265
             +   + + WQ P   + +     + + YR   S+T                        F
Sbjct  1575  SS--VLIQWQPPRDESLNGLLQGYRIYYRELESETGMSPEPKTLKSPSALRAELTAQSSF  1632

Query  266   TTWMVKDLQHHCVIHDAWSGLRHVV  290
              T           +       R+ V
Sbjct  1633  KTVNSSSSLTTYELTHLKKYRRYEV  1657


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 34/231 (15%), Positives = 67/231 (29%), Gaps = 22/231 (10%)

Query  133   EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
              W P      +    +   K     A+   E  +                   + Y++S+
Sbjct  1703  TWDPPPPE--SQNGNIQGYKVYYWEADSRNETEKMKVLFLPEPVVKIKDLTSHTKYLISI  1760

Query  193   CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                ++ G                P PP+ +  + +      L+V+W +P + N       
Sbjct  1761  SAFNAAGDGPKSDPCQGRTHQAAPGPPSFLAFSEI--TSTTLNVSWGEPSAAN--GILQG  1816

Query  253   FELRYRAERSKTFTTWMVK-----DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             + + Y         + +V      + Q    + D   G+ +  +++A+            
Sbjct  1817  YRVVYEPLAPVQGVSKVVTVDVKGNWQRWLKVRDLTKGVTYFFRVQARTIAYG-------  1869

Query  308   PEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
             PE            PAE    +P   L T    +  L     NA + P   
Sbjct  1870  PELQANVTAG----PAEGSPGSPRNVLVTKSASELTLQWTEGNAGTTPTTG  1916


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 59/341 (17%), Positives = 108/341 (32%), Gaps = 27/341 (8%)

Query  102   PAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPA  158
                +  +   VPP+    P           +   ++ P      T     +V     +  
Sbjct  1037  VTTSSTISSGVPPDLPGAPSNLVISNISPRSATLQFRPGYDGK-TAICRWIVEGQVGAIG  1095

Query  159   EDFQEPCQYSQESQKFSCQLAVP-EGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQP  216
             ++ +    Y +E++  +  L +P     + Y   M   + VG S FS++          P
Sbjct  1096  DEEEWVTLYEEENEPDAQMLEIPNLTPYTHYRFRMRQVNIVGPSPFSQSSRVIQTLQAPP  1155

Query  217   D-PPANITVTAVARNPRWLSVTWQD-PHSWNSS-----FYRLRFELRYRAERSKTFTTWM  269
             D  P ++TV   +     L + W   P S  +       YR+++    +   S      +
Sbjct  1156  DVAPTSLTVRTASETS--LRLRWVPLPDSQYNGNPESVGYRVKYWRSDQP--SSALAQVV  1211

Query  270   VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW--SPEAMGTPWTESRSPPAENEV  327
                L+    I +      + ++++A    G G WSE          P     +  AE   
Sbjct  1212  SDRLERELTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSAAPENVSAEAVS  1271

Query  328   ST---PMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAI  384
             ST      A    +D + ++        +  +      P P   V  G+     LL    
Sbjct  1272  STQILLTWASVPEQDQNGLILGYKVLYCAKDLD-----PEPRSHVVRGNHTQSALLAGLR  1326

Query  385   VLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLV  425
                  +   L   + G      P  L +   + P P   LV
Sbjct  1327  KFVVYELQVLAFTRIGNGVPSSPLILERTKDDTPGPPVRLV  1367


> sp|Q90W79|CNTN5_CHICK Contactin-5 OS=Gallus gallus OX=9031 GN=CNTN5 
PE=1 SV=1
Length=1027

 Score = 71.0 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/318 (16%), Positives = 96/318 (30%), Gaps = 22/318 (7%)

Query  5    GCALLAALLAAPGAALAPRRCPA-QEVARGVLTSLPGDSVTLTCPGV-EPEDNATVHWVL  62
             C  +    +A   A    + P   E+    +    G+S+ L+C  + +   + T +W L
Sbjct  477  SCRGVNVFGSAEIVASVSVKEPTRIELTPKKIELTVGESIVLSCKALHDSTLDVTFYWTL  536

Query  63   RKPAAGSHPSRWA-------GMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDV  112
                                     L++R++ L  +G Y C     A   +    LLV  
Sbjct  537  NGQPIDFDKEDGHFESIKAQASSADLMIRNILLMHAGRYGCRVQTAADAVSDETELLVRG  596

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK-AVLLVRKFQNSPAEDFQEPCQYSQES  171
            PP  P +    +   +     W P +          L  R   +   +   +        
Sbjct  597  PPGPPGVVIVEEITDTTATLSWSPGADNHSPISLYNLQARSPFSLGWQT-VKTVPDVISG  655

Query  172  QKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQP-DPPANITVTAVAR  229
               S  +AV       Y   +   + +G+   S            P  PPAN  V+  + 
Sbjct  656  DMESA-MAVELNPWVEYEFRVVATNKIGTGDPSAPSRMIRTNEAVPKTPPAN--VSGRSG  712

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSGL  286
                L + W+       +     + + +R   ++ +   MV        I+         
Sbjct  713  RRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSDASKFIYRDESVPPLT  772

Query  287  RHVVQLRAQEEFGQGEWS  304
               V++      G G +S
Sbjct  773  PFEVKVGVYNNKGDGPFS  790


> sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus 
OX=10116 GN=Ephb1 PE=1 SV=2
Length=984

 Score = 71.0 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 76/221 (34%), Gaps = 46/221 (21%)

Query  115  EEPQLSCFRKSP----------LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
            + P+++C                ++++ EW P             +   +          
Sbjct  313  DPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSR  372

Query  165  CQYSQE-----SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            C  + E          C++++    + + Y   +   + V SK              P P
Sbjct  373  CDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKS-------------PFP  419

Query  219  PANITVT---------------AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
            P +++V                 V+   R ++++W  P     +   L +E+RY  +   
Sbjct  420  PQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQ--PNGIILDYEIRYYEKEHN  477

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  478  EFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens 
OX=9606 GN=EPHB1 PE=1 SV=1
Length=984

 Score = 70.6 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 76/221 (34%), Gaps = 46/221 (21%)

Query  115  EEPQLSCFRKSP----------LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
            + P+++C                ++++ EW P             +   +          
Sbjct  313  DPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSR  372

Query  165  CQYSQE-----SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            C  + E          C++++    + + Y   +   + V SK              P P
Sbjct  373  CDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKS-------------PFP  419

Query  219  PANITVT---------------AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
            P +++V                 V+   R ++++W  P     +   L +E+RY  +   
Sbjct  420  PQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQ--PNGIILDYEIRYYEKEHN  477

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  478  EFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus 
OX=10090 GN=Ephb1 PE=1 SV=1
Length=984

 Score = 70.6 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 76/221 (34%), Gaps = 46/221 (21%)

Query  115  EEPQLSCFRKSP----------LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
            + P+++C                ++++ EW P             +   +          
Sbjct  313  DPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSR  372

Query  165  CQYSQE-----SQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
            C  + E          C++++    + + Y   +   + V SK              P P
Sbjct  373  CDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKS-------------PFP  419

Query  219  PANITVT---------------AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
            P +++V                 V+   R ++++W  P     +   L +E+RY  +   
Sbjct  420  PQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQ--PNGIILDYEIRYYEKEHN  477

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             F + M +   +   I     G+ +VVQ+RA+   G G++S
Sbjct  478  EFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFS  518


> sp|P78552|I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 
OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
Length=427

 Score = 69.5 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 75/213 (35%), Gaps = 31/213 (15%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ-YSQESQKFSC  176
            +L C   + LS + C W P    S  T   L         + +    C+   +E Q F C
Sbjct  131  ELQCIWHN-LSYMKCSWLPGRNTSPDTNYTLYYWHR----SLEKIHQCENIFREGQYFGC  185

Query  177  QLA---VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
                  V +     + V + V  + G              ++PDPP    +  ++ +   
Sbjct  186  SFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPH---IKNLSFHNDD  242

Query  234  LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-------------CVIH  280
            L V W++P ++ S    L +E+     +++T   + V++ +                ++ 
Sbjct  243  LYVQWENPQNFISR--CLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP  300

Query  281  DAWSGLRHVVQLRAQEE----FGQGEWSEWSPE  309
                   + V++R +           WS WS E
Sbjct  301  GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQE  333


> sp|Q2EY14|PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga 
PE=2 SV=1
Length=1149

 Score = 70.2 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/287 (18%), Positives = 88/287 (31%), Gaps = 19/287 (7%)

Query  49   GVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGT  105
              E      + W+       S   R      +L++  +   D G Y C      G     
Sbjct  336  TAEGFPTPQITWLKNGEPVRS-NGRIKMYNSKLVINQIIPEDDGIYQCEAENIQGSVLAM  394

Query  106  VHLLV---DVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDF  161
              L+V   D  P  P+         S +V  W  P           +   K +    E++
Sbjct  395  ARLIVVMSDNRPSAPRNIRADTVSSSAIVLAWDRPAYNSEKVIAYSVHYMKAEGLNNEEY  454

Query  162  QEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPA  220
            Q            +  +         Y   +     +G+   S          L+  P  
Sbjct  455  Q-----IVIGNDTTRYIIDDLEAGRNYTFYIVAYMPMGASRMSDHV---IQHTLEDVPLR  506

Query  221  NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH  280
               ++  +R+P  + V+WQ      S      + L YR     T T   +   + H ++ 
Sbjct  507  APELSLTSRSPSDIQVSWQPLSHKLSRGRVSAYRLSYRTSSDGTLTQLELSAHKTHQLLE  566

Query  281  DAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
                   +++++ A    G GE S WS  +  TP   S   P   E+
Sbjct  567  GLQPDTTYLLRIAAATAVGWGEPSAWS--SHRTPKASSTKVPLAPEL  611


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 54/357 (15%), Positives = 107/357 (30%), Gaps = 41/357 (11%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
            A L   P  +    + P        LT     +  L C          + W      +  
Sbjct  206  ATLTVTPAMSPRAPQRPRIIAGPQNLTVPAHSTALLEC-MASGNPRPLISWSRADHKSID  264

Query  70   -HPSRWAGMGRRLLLRSVQLHDSGNYSCYRA-----GRPAGTVHLLVDVPP---EEPQLS  120
             H ++  G G  L++  V    +G Y C               ++ V  PP   E P+  
Sbjct  265  VHKTKVLGNGN-LIISDVNPQHAGIYFCRATTPGTRNYTIAAANITVLAPPSLVEWPESV  323

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
               ++  +  VC           T  +  ++       E  +   +    + K      +
Sbjct  324  TRPRAGTARFVCT-----AEGFPTPQITWLK-----NGEPVRSNGRIKMYNSKLVINQII  373

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            PE D    I      +  GS  +  +        +P  P NI    V  +   + + W  
Sbjct  374  PEDDG---IYQCEAENIQGSVLAMARLIVVMSDNRPSAPRNIRADTV--SSSAIVLAWDR  428

Query  241  PHSWNSSFYRLRFELRY---RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE  297
            P    +S   + + + Y       ++ +    + +     +I D  +G  +   + A   
Sbjct  429  PA--YNSEKVIAYSVHYMKAEGLNNEEYQIV-IGNDTTRYIIDDLEAGRNYTFYIVAYMP  485

Query  298  FGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
             G    S+          T    P    E+S   ++ +    D  + ++  ++  S 
Sbjct  486  MGASRMSD-----HVIQHTLEDVPLRAPELSLTSRSPS----DIQVSWQPLSHKLSR  533


 Score = 41.7 bits (96),  Expect = 0.016, Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 38/89 (43%), Gaps = 6/89 (7%)

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNSS---FYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P  + VT +  +     V+W+ P   +++    Y + +  R RA  +  +     +    
Sbjct  810  PVGVKVTLIEGDSAL--VSWKAPDDRSAAAVTHYTVLYATR-RAWAAGDWQMLQREGSIT  866

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              ++ +   G  ++VQ+ A  + G G +S
Sbjct  867  MALLENLQPGQVYLVQVSASNQMGDGPFS  895


 Score = 37.1 bits (84),  Expect = 0.44, Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 76/278 (27%), Gaps = 22/278 (8%)

Query  55   NATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGN-----YSCYRAGRPAGTVHLL  109
            + T+  +                    LLR       G      +S +R  + + T    
Sbjct  548  DGTLTQLELSAHKTHQLLEGLQPDTTYLLRIAAATAVGWGEPSAWSSHRTPKASST----  603

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYS  168
                P  P+L     +  + V   W   +  S       L   +   S A   Q P  + 
Sbjct  604  --KVPLAPELQLESLN-CTTVTLRWHLPAGSSSGLQGFKLSYHEEGQSEAAQAQIP-PHH  659

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
            ++                     M          S          L P PP    V A +
Sbjct  660  RQHTIGGLDPRKKYHIKLLAFSFMGDGYQADQTISTPGCVSVRDRLVPPPPPPHHVYAHS  719

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM-VKDLQHHCVIHDAWSGLR  287
             +   + + W  P    +S   L + +R      +  +  + ++      ++ D      
Sbjct  720  NSSSSVFLHWARPA--FTSAQTLNYTVRCNPVGLQNASLVLYLQTAAQSLLVTDLEPNTN  777

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGT--PWTESRSPPA  323
            +   +R   +      S WSP    T  P   SR+P  
Sbjct  778  YEFAVRLHVDLLS---SPWSPVVYQTTLPEAPSRAPVG  812


> sp|Q9EQS9|IGDC4_MOUSE Immunoglobulin superfamily DCC subclass 
member 4 OS=Mus musculus OX=10090 GN=Igdcc4 PE=2 SV=1
Length=1252

 Score = 70.2 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 64/352 (18%), Positives = 113/352 (32%), Gaps = 24/352 (7%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK-PAAG  68
                A   A L     PA   A   L+     +    C     E    +HW+    P   
Sbjct  318  TRDFATAAAELRVLAAPAISQAPEALSRTRASTARFVC-RASGEPRPALHWLHDGIPLRP  376

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLV----DVPPEEPQLSC  121
            +   +  G G  L++  + L D+G Y C     AG       L V     +P    +++ 
Sbjct  377  NGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGTACAAAPLAVVVREGLPSAPTRVTA  436

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
               S  S +V    P           L  +K +     ++Q          +        
Sbjct  437  TPLSSSSVLVAWERPELHSEQIIGFSLHYQKARGVDNVEYQFAVNNDTTELQVR-----D  491

Query  182  EGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
               ++ Y   +   S +G S+ S          +   P A   +T  + NP  + V W  
Sbjct  492  LEPNTDYEFYVVAYSQLGASRTSSPALVHTLDDV---PSAAPQLTLSSPNPSDIRVAWLP  548

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
              S  S+   L++++ Y   +     +  V   +    ++       + V++ A    G 
Sbjct  549  LPSSLSNGQVLKYKIEYGLGKEDQVFSTEVPGNETQLTLNSLQPNKVYRVRISAGTGAGY  608

Query  301  GEWSEWSPEAMGTP----WTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
            G  S+W      TP     +     PAE +V   M++L  +        + S
Sbjct  609  GVPSQWMQ--HRTPGVHNQSHVPFAPAELKVRAKMESLVVSWQPPPHPTQIS  658


 Score = 37.5 bits (85),  Expect = 0.32, Method: Composition-based stats.
 Identities = 17/91 (19%), Positives = 35/91 (38%), Gaps = 7/91 (8%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSS---FYRLRFELRYRAERSKTFTTWMVKDLQ  274
            PP+++ ++ +   P  + + W  P   N     +  L      + E    +T    +   
Sbjct  849  PPSDLRLSPL--TPSTVRLHWCPPTEPNGEIVEYLILYSNNHTQPEH--QWTLLTTEGNI  904

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                +H   S  R+  ++ A+ E G G +S 
Sbjct  905  FSAEVHGLESDTRYFFKMGARTEVGPGPFSR  935


> sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus OX=9031 
GN=SDK1 PE=1 SV=1
Length=2169

 Score = 69.8 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 61/346 (18%), Positives = 106/346 (31%), Gaps = 34/346 (10%)

Query  25   CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR----WAGMGRR  80
             PA        T   G +  LTC  V       + W        S   +           
Sbjct  431  KPAFIQPPEDTTVTEGMTAMLTCE-VSGAPKPAISWKKGNQILASGSVQIPRFVLLESGG  489

Query  81   LLLRSVQLHDSGNYSCY---RAGRPAGTVHLLV---DVPPEEPQLSCFRKSPLSNVVCEW  134
            L +  V L D+GNY+C+     G     V L V         P+ S   K   + + CE 
Sbjct  490  LQITPVFLQDAGNYTCHAVNSEGALNAFVMLTVWNRTFIVHPPENSTVIKGTTATLRCE-  548

Query  135  GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
                 P ++ + V        +P+   +   +        S   +   GD +      C 
Sbjct  549  -ATHDPRISIRYVWKKDSVVINPSSSSRITVEKDGTLL-ISQTWSGDIGDYT------CE  600

Query  195  ASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
              S G   S+    +   +  P  P N+  T  +   R + ++W  P   NS       E
Sbjct  601  VISFGGNDSRMARLEVIEL--PHSPQNLLATLNSSYSRSVVLSWVRPFDGNSPVLYYMVE  658

Query  255  LRYRAERSKTFTTW--MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
            L   +E +  +      +        +        +  ++ A  + G+G++S  S  +  
Sbjct  659  L---SENNSPWKVHLSNLDPKMTSVTVSGLTPARTYQFRVCAVNQVGKGQYS--SETSRL  713

Query  313  TPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
                E  S P +N V     A         + ++    +    V  
Sbjct  714  MLPEEPPSAPPKNIV-----ASGRTNQSIMVQWQPPPESEHNGVLH  754


 Score = 62.9 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 57/296 (19%), Positives = 94/296 (32%), Gaps = 32/296 (11%)

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
               L +++     +G ++     R   +V      P   P+         + ++  W   +
Sbjct  1200  YELQIQAFNAIGAGPWNEVVGVRTRESV------PSAPPENVSAEAVSSTQILLTW--SA  1251

Query  139   TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF-SCQLAVPEGDSSFYIVSMCVASS  197
              P      ++L  K      +   EP   +       SC L+        Y + +   + 
Sbjct  1252  VPESEQNGLILGYKILYKAKDLDSEPRSQTVRGNHTQSCLLSGLRKY-VLYEIRVLAFTR  1310

Query  198   VGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
             +G    S     +      P PP  +    V      + + WQ P     +   L +++ 
Sbjct  1311  IGDGVPSSPVLTERTKDDAPGPPIRLVFPEVRLTS--VRIVWQPPE--EPNGIILGYQIA  1366

Query  257   YRAERSK--TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
             YR   S    FTT  V          D      ++ +  A+   G   W E   EA    
Sbjct  1367  YRLASSSPNKFTTVEVGSTVRQFTATDLTPESAYIFRTSAKTRQG---WGE-PLEATVIT  1422

Query  315   WTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLP-VQDSSSVPLPTFLV  369
              TE R  PA      P Q LTT + D +     S     +P    SS +   T  V
Sbjct  1423  -TEKRERPA------PPQQLTTPQSDVS---SRSLQLHWVPGSDGSSPIRYFTVQV  1468


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/201 (16%), Positives = 62/201 (31%), Gaps = 13/201 (6%)

Query  134   WGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
             W P   P  +     +  R   +SP +        +          A      S YI   
Sbjct  1350  WQPPEEPNGIILGYQIAYRLASSSPNKFTTVEVGSTVRQ-----FTATDLTPESAYIFRT  1404

Query  193   CVASSVGSKFSKTQTFQGCGIL-QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
                +  G       T        +P PP  +T      + R L + W      +S     
Sbjct  1405  SAKTRQGWGEPLEATVITTEKRERPAPPQQLTTPQSDVSSRSLQLHWVPGSDGSSPIRY-  1463

Query  252   RFELRYRAERSKTFTTW--MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              F ++ R   +  + T+   +      C+I        + ++++A  + G  ++S  +  
Sbjct  1464  -FTVQVRELPNGDWQTYSSSISHEATSCIIESLNPFTSYKLRVKATNDIGDSDYS--AET  1520

Query  310   AMGTPWTESRSPPAENEVSTP  330
                T   +    P  + + TP
Sbjct  1521  EAVTTLQDVPDEPPSSVLVTP  1541


 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/183 (15%), Positives = 56/183 (31%), Gaps = 32/183 (17%)

Query  134   WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
             W P S  S   +    V+  +    +        S E+   SC +       + Y + + 
Sbjct  1451  WVPGSDGSSPIRY-FTVQVRELPNGDWQTYSSSISHEA--TSCIIESLN-PFTSYKLRVK  1506

Query  194   VASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
               + +G     ++T+       +  +PP+++ VT    +   + V WQ P + + +   L
Sbjct  1507  ATNDIGDSDYSAETEAVTTLQDVPDEPPSSVLVTPHTTSS--VLVQWQPPKAESLNGLLL  1564

Query  252   RFELRYRAER------------------------SKTFTTWMVKDLQHHCVIHDAWSGLR  287
              + + YR                             +F T           +       R
Sbjct  1565  GYRIYYRELDYDAGSATESKAVKNPSALRAELTPQSSFKTVNSSSALTTYELTQLKKYKR  1624

Query  288   HVV  290
             + V
Sbjct  1625  YEV  1627


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 80/238 (34%), Gaps = 21/238 (9%)

Query  98    RAGRPAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQ  154
             +      +  +   VPPE    P           +   ++ P      +     +V    
Sbjct  1003  KGSGWVTSSTISSGVPPELPGAPSNLVISNISPRSATLQFRPGYDGKTSI-CKWIVEGQV  1061

Query  155   NSPAEDFQEPCQYSQESQKFSCQLAVP-EGDSSFYIVSMCVASSVGSKF-SKTQTFQGCG  212
                 E+ +    +  +++  +  L VP     + Y   M   + VG+   S+        
Sbjct  1062  GVLGEEEEWVSLHEVDNEPDAQMLEVPNLTPYTHYRFRMRQVNVVGASPLSQPSRVIQTL  1121

Query  213   ILQPD-PPANITVTAVARNPRWLSVTWQD-PHSWNSS-----FYRLRFE-LRYRAERSKT  264
                PD  P +++V   + +   L + W   P +  +       YR++F  +  +      
Sbjct  1122  QAPPDVAPGSVSVRTASESS--LRMRWVPLPDTQYNGNPESVGYRIKFWRVDLQP---SA  1176

Query  265   FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                 +   L+  C I D      + +Q++A    G G W+E     + T  +   +PP
Sbjct  1177  LLKVISDRLERECTIQDLEEWTEYELQIQAFNAIGAGPWNE--VVGVRTRESVPSAPP  1232


 Score = 43.3 bits (100),  Expect = 0.006, Method: Composition-based stats.
 Identities = 35/235 (15%), Positives = 72/235 (31%), Gaps = 19/235 (8%)

Query  99    AGRPAGT-VHLLVD--VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
                P  T V + V    P   PQ         S +   W P   P+ +    +   K   
Sbjct  1636  GESPTSTPVEVFVGEAAPAMAPQNIQVNSLSASQLELTWDP--PPADSQNGNIQGYKIYY  1693

Query  156   SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                +   +  +    S       +      + Y+V +   ++ G       +        
Sbjct  1694  WEGDVQNDTEKVKVFSSLRQLSASKNLTSHTRYLVCISAFNAAGDGPRSRPSAGRTHQAA  1753

Query  216   PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWMVK---  271
             P  P+ +  + +      L+V+W +P + N     L+ + + Y         + +V    
Sbjct  1754  PSAPSFLVFSEI--TSTTLNVSWGEPTAANG---VLQGYRVVYEPLAPVQGVSKVVTVDI  1808

Query  272   --DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAE  324
               + Q    + D   G+ ++ +++A+         E        P   S   P E
Sbjct  1809  KGNWQRWLKVRDLTKGMTYLFRVQARTIAYG---PELQANVTAGPAEGSPGSPHE  1860


 Score = 40.2 bits (92),  Expect = 0.044, Method: Composition-based stats.
 Identities = 36/244 (15%), Positives = 62/244 (25%), Gaps = 16/244 (7%)

Query  58   VHWVLRKPAAGSHPSRWAGMGRRLLLRS--VQLHDSGNYSCYRAGRPAGTVHLLVDVPPE  115
            VH     P   S         R    R   V     G YS          + L  + P  
Sbjct  668  VHLSNLDPKMTSVTVSGLTPARTYQFRVCAVNQVGKGQYSSET-----SRLMLPEEPPSA  722

Query  116  EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKF  174
             P+          +++ +W P   P      VL              +   +    ++  
Sbjct  723  PPKNIVASGRTNQSIMVQWQP--PPESEHNGVLHGYILRYRLAGLPGEYQYKNITSAEIN  780

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL  234
             C +      + + I       +    FS+  T      +   PP N+ V AV  N   +
Sbjct  781  YCLVTDLIIWTQYEIQVASYNGAGLGAFSRPVTEYTLQGVPTAPPQNVQVEAV--NSTTI  838

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW----MVKDLQHHCVIHDAWSGLRHVV  290
               W  P     +     ++L      +    T           H   I +      +  
Sbjct  839  QFLWSPPPQQFINGINQGYKLLAWPVDAPGSVTVVTIAPDFHGVHSGCITNLKKYTTYYT  898

Query  291  QLRA  294
             +  
Sbjct  899  SVLC  902


> sp|P30530|UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo 
sapiens OX=9606 GN=AXL PE=1 SV=4
Length=894

 Score = 69.5 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 71/448 (16%), Positives = 121/448 (27%), Gaps = 83/448 (19%)

Query  24   RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK-------------PAAGSH  70
                     G +T   G + TL C      +   VHW+                P     
Sbjct  33   EESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDE  92

Query  71   PSRWAGMGRRLLLRSVQLHDSGNYSC-----YRAGRPAGTVHLLVDVPP--EEPQLSCFR  123
               W  +  +L + S+QL D+G Y C     ++          L  +P   EEP+     
Sbjct  93   QDDWIVV-SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVA  151

Query  124  KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG  183
             +   N+ C+      P      + L      + A                +   +    
Sbjct  152  ANTPFNLSCQ---AQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSC---  205

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHS  243
                        ++ G   S+T T        P  P N+ +  V+R P  L V W     
Sbjct  206  ---------EAHNAKGVTTSRTATITVL----PQQPRNLHL--VSRQPTELEVAWTP---  247

Query  244  WNSSFYRLRFE------------LRY-RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
              S  Y L               ++    +  +   T       H   +        + +
Sbjct  248  GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHI  307

Query  291  QLRAQEEFGQGEWSEW------------SPEAMGTPWTESRSPPAENEVSTPMQALTTNK  338
            ++      G   W+ W             PE +      S++     E   P+Q      
Sbjct  308  RVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGY  367

Query  339  DDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWK----L  394
                 L     +   + +       +   L   GS++  T+   A        W     L
Sbjct  368  R----LAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPL  423

Query  395  RALKEGKTSMHPPYSLGQLVPERPRPTP  422
             A + G+        + QLV E   P  
Sbjct  424  EAWRPGQAQP-----VHQLVKEPSTPAF  446


> sp|O00533|NCHL1_HUMAN Neural cell adhesion molecule L1-like protein 
OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
Length=1208

 Score = 69.5 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 84/255 (33%), Gaps = 21/255 (8%)

Query  58   VHWVLRKPA---AGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR-----AGRPAGTVHLL  109
            + W     A    G+   R    G  L + +V L D G Y C       +      V +L
Sbjct  550  LSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVL  609

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
             DV P+ P+     +    +V   W   +       + +     +    ++     +   
Sbjct  610  -DV-PDPPENLHLSERQNRSVRLTWEAGADH----NSNISEYIVEFEGNKEEPGRWEELT  663

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPD-PPANITVTAV  227
              Q     + +P      Y   +   + VG S+ S+           PD  P NI V A 
Sbjct  664  RVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDHHETPPAAPDRNPQNIRVQAS  723

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCVIHDAWSGL  286
                    + W+   S   +   L + + ++ + +   +    V +     +    ++  
Sbjct  724  QPKEMI--IKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTLRVMTPAVYA--  779

Query  287  RHVVQLRAQEEFGQG  301
             + V+++A  + G G
Sbjct  780  PYDVKVQAINQLGSG  794


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 52/309 (17%), Positives = 94/309 (30%), Gaps = 52/309 (17%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR-RLLLRSVQLHDSGN  93
              ++ G S  L C        A V W   +        R+       L +      D+G+
Sbjct  433  YATVVGYSAFLHCE-FFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAGS  491

Query  94   YSCYRA---GRPAGTVHL------LVDVPPEEP--------QLSCFRKSPLSNVVCEWGP  136
            YSC+     G+ A T +L       + V P+ P        +L C  K            
Sbjct  492  YSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKC-----------  540

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                 L     L   K      E F+               L +         +  C A 
Sbjct  541  --DSHLKHSLKLSWSK----DGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAH  594

Query  197  SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            +     +         +  PDPP N+ ++   R  R + +TW+     + +     + + 
Sbjct  595  TALDSAADITQVTVLDV--PDPPENLHLS--ERQNRSVRLTWE--AGADHNSNISEYIVE  648

Query  257  YRAERSK--TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
            +   + +   +        +   VI      +R+  ++ A  E G+ + S+        P
Sbjct  649  FEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQ--------P  700

Query  315  WTESRSPPA  323
                 +PPA
Sbjct  701  SDHHETPPA  709


 Score = 39.4 bits (90),  Expect = 0.079, Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 39/104 (38%), Gaps = 7/104 (7%)

Query  36   TSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
            T L G+ + L C   E      V W                 G+ L + +V   D GNY 
Sbjct  251  TILKGEILLLEC-FAEGLPTPQVDWNKIGGDLPKGRETKENYGKTLKIENVSYQDKGNYR  309

Query  96   CYRAGRPAGTV---HLLVDVPP---EEPQLSCFRKSPLSNVVCE  133
            C  +          H++V+ PP   ++PQ + +       ++CE
Sbjct  310  CTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCE  353


> sp|O97394|SDK_DROME Protein sidekick OS=Drosophila melanogaster 
OX=7227 GN=sdk PE=1 SV=2
Length=2224

 Score = 69.8 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 56/296 (19%), Positives = 105/296 (35%), Gaps = 27/296 (9%)

Query  36   TSLPGDSVTLTCP-GVEPEDNATVHWVLRKPA-AGSHPSRWAGMGR--RLLLRSVQLHDS  91
            T L G + TL C    +P     + W     +      S+  G+    +L +++V+  D 
Sbjct  556  TVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLEIQAVRASDV  615

Query  92   GNYSC---YRAGRPAGTVHLLVDVPPEEP-QLSCFRKSPLS--NVVCEWGPRSTPSLTTK  145
            G+Y+C      G       L V   P  P  +   R       ++   W P    +    
Sbjct  616  GSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPI-  674

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQ-----ESQKFSCQLAVPEGDS----SFYIVSMCVAS  196
            +  ++++ + S  E F  P          E    S        ++    + Y   +   +
Sbjct  675  SKFIIQRREVSELEKFVGPVPDPLLNWITELSNVSADQRWILLENLKAATVYQFRVSAVN  734

Query  197  SVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
             VG    S+           P  PP     +A  R+   +   WQ P   + +   L + 
Sbjct  735  RVGEGSPSEPSNVVELPQEAPSGPPVGFVGSA--RSMSEIITQWQPPLEEHRNGQILGYI  792

Query  255  LRYR--AERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
            LRYR     +  ++   + +  Q + +I +  +   ++VQ+ A    G G ++E S
Sbjct  793  LRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGS  848


 Score = 57.9 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 69/367 (19%), Positives = 120/367 (33%), Gaps = 70/367 (19%)

Query  21   APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--AGMG  78
                 P  E+    +T+L G   T++C  V    N  + W+  +       SR      G
Sbjct  450  VKTSAPIMELPPQNVTALDGKDATISCRAVGSP-NPNITWIYNETQLVDISSRVQILESG  508

Query  79   RRLLLRSVQLHDSGNYSCYR---AGRPAGTVHLLVDV------PPEEP--------QLSC  121
              LL+ +++  D+G Y C R   AG   G  +L V V      PP +          L C
Sbjct  509  D-LLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQC  567

Query  122  -FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
                 P      +W        +T      R    +  +   +  + S +   ++C +  
Sbjct  568  KVSSDPSVPYNIDWY--REGQSSTPISNSQRIGVQADGQLEIQAVRAS-DVGSYACVVTS  624

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA-RNPRWLSVTWQ  239
            P G+ +         ++  S            I  P PP+N+ V  +     R ++V+W 
Sbjct  625  PGGNETR--------AARLSV-----------IELPFPPSNVKVERLPEPQQRSINVSWT  665

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD--------------LQHHCVIHDAWSG  285
                 NS     +F ++ R           V D               Q   ++ +  + 
Sbjct  666  PGFDGNSPIS--KFIIQRREVSELEKFVGPVPDPLLNWITELSNVSADQRWILLENLKAA  723

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP--------AENEVSTPMQALTTN  337
              +  ++ A    G+G  SE S   +  P      PP        + +E+ T  Q     
Sbjct  724  TVYQFRVSAVNRVGEGSPSEPS-NVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEE  782

Query  338  KDDDNIL  344
              +  IL
Sbjct  783  HRNGQIL  789


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 37/229 (16%), Positives = 65/229 (28%), Gaps = 25/229 (11%)

Query  112   VPPEEPQLSCFRKSPLSNVVCEWGP-------RSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
             VP  EP+         + V   W P                 ++        P   ++E 
Sbjct  1678  VPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWEEE  1737

Query  165   CQY-SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANI  222
              +  S  +   S        +   Y + +   +  G    S   T +    + P  P  +
Sbjct  1738  IEVVSATATSHSLVFLDKFTE---YRIQLLAFNPAGDGPRSAPITVKTLPGV-PSAP--L  1791

Query  223   TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA--ERSKTFTTWMVKDLQHHCVIH  280
              +       + L VTW  P   N     L + + Y    E  K       K       + 
Sbjct  1792  HLRFSDITMQSLEVTWDPPKFLNGEI--LGYLVTYETTEENEKFSKQVKQKVSNTTLRVQ  1849

Query  281   DAWSGLRHVVQLRAQE--EFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
             +    + +   +RAQ   ++G G     S      P   S   P +  +
Sbjct  1850  NLEEEVTYTFTVRAQTSVDYGPGI----SENVTTGPQDGSPVAPRDLIL  1894


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 57/202 (28%), Gaps = 16/202 (8%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTP---SLTTKAVLLVRKFQNSPAEDF------  161
              VP   P          +   C W P +      +     +   + +    E        
Sbjct  855   GVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRM  914

Query  162   -QEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
                P        + +  L   E  + + I  +C         S          + PD   
Sbjct  915   KTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDV-PDEVT  973

Query  221   NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCVI  279
              +    V  + R + V W  P +  S+     + +RY+ +    T  ++ +        +
Sbjct  974   GLHFDDV--SDRSVKVLWAPPRA--SNGILTGYTVRYQVKDRPDTLKSFNLTADDTELTV  1029

Query  280   HDAWSGLRHVVQLRAQEEFGQG  301
             +   +   +  ++ A    G G
Sbjct  1030  NQLQATTHYWFEIVAWTRVGSG  1051


> sp|P40321|IL2RG_CANLF Cytokine receptor common subunit gamma 
OS=Canis lupus familiaris OX=9615 GN=IL2RG PE=2 SV=1
Length=373

 Score = 68.3 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 80/209 (38%), Gaps = 15/209 (7%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P++ CF  + +  + C W   S P   T   L          +D  + C +   S++ + 
Sbjct  58   PEVQCFVFN-VEYMNCTWNSSSEPR-PTNLTLHYWYKN--SNDDKVQECGHYLFSREVTA  113

Query  177  QLAVPEGDSSFYIV-SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
               + + +   Y    + +      +   TQ  +   ++ P  P N+T+  ++     L 
Sbjct  114  GCWLQKEEIHLYETFVVQLRDPREPRRQSTQKLKLQNLVIPWAPENLTLHNLSE--SQLE  171

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            ++W +        + L   ++YR++  +++T   V D ++   +        +  ++R++
Sbjct  172  LSWSN----RHLDHCLEHVVQYRSDWDRSWTEQSV-DHRNSFSLPSVDGQKFYTFRVRSR  226

Query  296  EEFGQGE---WSEWSPEAMGTPWTESRSP  321
                 G    WSEWS        T   +P
Sbjct  227  YNPLCGSAQRWSEWSHPIHWGSNTSKENP  255


> sp|P31785|IL2RG_HUMAN Cytokine receptor common subunit gamma 
OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
Length=369

 Score = 68.3 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 78/209 (37%), Gaps = 15/209 (7%)

Query  117  PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            P++ CF  + +  + C W   S P   T   L      +    D  + C +   S++ + 
Sbjct  58   PEVQCFVFN-VEYMNCTWNSSSEPQ-PTNLTLHYWYKNSDN--DKVQKCSHYLFSEEITS  113

Query  177  QLAVPEGDSSFY-IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
               + + +   Y    + +      +   TQ  +   ++ P  P N+T+  ++     L 
Sbjct  114  GCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSE--SQLE  171

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            + W +        + L   ++YR +   ++T   V D +H   +       R+  ++R++
Sbjct  172  LNWNN----RFLNHCLEHLVQYRTDWDHSWTEQSV-DYRHKFSLPSVDGQKRYTFRVRSR  226

Query  296  EEFGQGE---WSEWSPEAMGTPWTESRSP  321
                 G    WSEWS        T   +P
Sbjct  227  FNPLCGSAQHWSEWSHPIHWGSNTSKENP  255


> sp|Q9MYZ9|EPOR_PIG Erythropoietin receptor OS=Sus scrofa OX=9823 
GN=EPOR PE=2 SV=1
Length=509

 Score = 68.7 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/204 (19%), Positives = 72/204 (35%), Gaps = 8/204 (4%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSL-TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            +L CF +  L ++VC W    +  +         +                ++ S +F C
Sbjct  49   ELLCFTER-LEDLVCFWEEAGSAGVGPEDYSFSYQLEGEPWKPCHLHQGPTARGSVRFWC  107

Query  177  QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
             L   +  S   +       S G+     +      ++  DPPA + +   A     + +
Sbjct  108  SLPTADTSSFVPLELRVTEVSSGAPR-YHRIIHINEVVLLDPPAGL-LARRAEESGHVVL  165

Query  237  TWQDPHSWNSSFYRLRFELRYRAERSKTFTT-WMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
             W  P     +   +R+E+    E +        + D +  CV+ +   G R+   +RA+
Sbjct  166  RWLPPPGAPMASL-IRYEVNISTENAAGGVQRVEILDGRTECVLSNLRGGTRYTFMVRAR  224

Query  296  --EEFGQGEWSEWSPEAMGTPWTE  317
              E    G WS WS  A     ++
Sbjct  225  MAEPSFGGFWSAWSEPASLLTASD  248


> sp|P11627|L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus 
musculus OX=10090 GN=L1cam PE=1 SV=1
Length=1260

 Score = 69.1 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 51/280 (18%), Positives = 102/280 (36%), Gaps = 32/280 (11%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRKPAA---GSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
            G  VT TC    +P   A++ W          G     +   G+ L+++S+   D GNYS
Sbjct  531  GARVTFTCQASFDPSLQASITWRGDGRDLQERGDSDKYFIEDGK-LVIQSLDYSDQGNYS  589

Query  96   C---YRAGRPAGTVHLL-VDVPPEEP--QLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVL  148
            C              LL V  P   P  +LS       S V   W P    +    K  +
Sbjct  590  CVASTELDEVESRAQLLVVGSPGPVPHLELSDRHLLKQSQVHLSWSPAEDHNSPIEKYDI  649

Query  149  LVRKFQNSPAEDF---QEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
                 + +P + F   + P   +  + K S  +         Y   +   +  G      
Sbjct  650  EFEDKEMAPEKWFSLGKVPGNQTSTTLKLSPYVH--------YTFRVTAINKYGPGEPSP  701

Query  206  QTFQGCGILQPD--PPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS  262
             +     ++ P+  P  N + V         + +TW+     + +  ++++ +++R +  
Sbjct  702  VS---ESVVTPEAAPEKNPVDVRGEGNETNNMVITWKPLRWMDWNAPQIQYRVQWRPQGK  758

Query  263  -KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
             +T+    V D     V+ +  + + + ++++A    G+G
Sbjct  759  QETWRKQTVSD--PFLVVSNTSTFVPYEIKVQAVNNQGKG  796


 Score = 56.0 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 52/371 (14%), Positives = 109/371 (29%), Gaps = 62/371 (17%)

Query  12   LLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHP  71
            LLA     +                ++ G +  L C         +V W+  +       
Sbjct  412  LLANAYIYVVQLPARILTKDNQTYMAVEGSTAYLLCKAFGAP-VPSVQWLDEEGTTVLQD  470

Query  72   SRWAGMGR-RLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEE-------PQLSCFR  123
             R+       L +R +Q +D+G Y C  A      V +L ++  +E       P+ +  +
Sbjct  471  ERFFPYANGTLSIRDLQANDTGRYFCQAA-NDQNNVTILANLQVKEATQITQGPRSAIEK  529

Query  124  KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP----------CQYSQESQK  173
            K       C+      PSL                 D  +                +   
Sbjct  530  KGARVTFTCQ--ASFDPSLQASITWRGDGRDLQERGDSDKYFIEDGKLVIQSLDYSDQGN  587

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN-PR  232
            +SC  +    +       +   + +    S            P P  ++ ++        
Sbjct  588  YSCVASTELDE-------VESRAQLLVVGS------------PGPVPHLELSDRHLLKQS  628

Query  233  WLSVTWQDPHSWNSSFYRLRFELRYRAER---SKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
             + ++W      NS     ++++ +  +     K F+   V   Q    +      + + 
Sbjct  629  QVHLSWSPAEDHNSPIE--KYDIEFEDKEMAPEKWFSLGKVPGNQTSTTLK-LSPYVHYT  685

Query  290  VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA-----------ENEVSTPMQALTTN-  337
             ++ A  ++G GE S  S E++ TP       P                  P++ +  N 
Sbjct  686  FRVTAINKYGPGEPSPVS-ESVVTPEAAPEKNPVDVRGEGNETNNMVITWKPLRWMDWNA  744

Query  338  -KDDDNILFRD  347
             +    + +R 
Sbjct  745  PQIQYRVQWRP  755


> sp|O09127|EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus 
OX=10090 GN=Epha8 PE=1 SV=2
Length=1004

 Score = 69.1 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 72/212 (34%), Gaps = 13/212 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC-------  165
            PP  P ++       ++V  EW P   P   +         +   A    E C       
Sbjct  327  PPSAP-VNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSHCEACGSGTRFV  385

Query  166  QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPDPPANIT  223
                   + S  +A      + Y   +   + V +   + ++     I   Q  P   + 
Sbjct  386  PQQTSLAQASLLVANLLAHMN-YSFWIEAVNGVSNLSPEPRSAAVVNITTNQAAPSQVVV  444

Query  224  VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAW  283
            +         +S+ WQ+P     +   L +E++Y  +  +  +   +K +     +    
Sbjct  445  IRQERAGQTSVSLLWQEPEQ--PNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLK  502

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
             G R+V Q+RA+   G G +S+      G P 
Sbjct  503  PGTRYVFQVRARTSAGCGRFSQAMEVETGKPR  534


> sp|Q967D7|TUTL_DROME Protein turtle OS=Drosophila melanogaster 
OX=7227 GN=tutl PE=1 SV=2
Length=1531

 Score = 69.1 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 54/325 (17%), Positives = 105/325 (32%), Gaps = 54/325 (17%)

Query  14   AAPGAALAPRRCPAQEVARGVLTS-LPGDSVTLTCPGVEPEDN--ATVHWVLRKPA--AG  68
            A+    +  R+ PA  V    L     GDSV + C  +E E     T+ W  ++      
Sbjct  524  ASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTE  583

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG----TVHLLVDVPPEEPQLSCFRK  124
            S  +R    G  + + +++  D G Y C  +   A     T  ++    P  P     + 
Sbjct  584  SQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKA  643

Query  125  SPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP-EG  183
            +  S +  +W P  +     K    +        E      Q    +   S Q+ +    
Sbjct  644  TESS-ITLQWLPGYSGGSEYKQDYTI-----WFREAGVNDWQTISVTPSGSTQVTINGLA  697

Query  184  DSSFYIVSMCVASSVG------------------------SKFSKTQTFQGC----GILQ  215
              + Y   +   + +G                        +      +F          +
Sbjct  698  SGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEAGPK  757

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM---VKD  272
            P PP N++VT V+       +TWQ P     +     + ++YR      + T     ++ 
Sbjct  758  PGPPRNVSVTEVSNG---FLITWQSP--LERAHIVKFYTIKYRT--DAQWKTLNRGQIRP  810

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEE  297
             +   ++ +   G  +  ++ A  E
Sbjct  811  EETQYLVKNLVGGRTYYFRVLANSE  835


 Score = 41.3 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 45/127 (35%), Gaps = 25/127 (20%)

Query  29   EVARGVLTSLPGDSVTLTC---PGVEPEDNATVHWVLR-KPAAGSHPSRWAGMGRRLLLR  84
                 ++    GDS+ L C       PE    + W     P   S        G  L + 
Sbjct  257  VTPEDIIYVNLGDSIILNCQADGTPTPE----ILWYKDANPVDPSPTVGIFNDGTELRIS  312

Query  85   SVQLHDSGNYSCYR---AGRPAGTVHLLVD------VPP-EEPQL-------SCFRKSPL  127
            +++  D G Y+C      G+ + T  +++       VPP  + +L       SC  K+  
Sbjct  313  TIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMP  372

Query  128  SNVVCEW  134
             NV   W
Sbjct  373  GNVTVRW  379


 Score = 38.6 bits (88),  Expect = 0.15, Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 34/99 (34%), Gaps = 16/99 (16%)

Query  27   AQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS-  85
               V     T L G+ V  +C       N TV W       GS     A +  R+ +R  
Sbjct  346  VIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWY----REGSPVREVAALETRVTIRKD  401

Query  86   -------VQLHDSGNYSCYRA---GRPAGTV-HLLVDVP  113
                   ++  DSG Y C      G P     +L V+ P
Sbjct  402  GSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYP  440


> sp|Q9R044|NPHN_RAT Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 
PE=1 SV=2
Length=1252

 Score = 68.7 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 51/298 (17%), Positives = 88/298 (30%), Gaps = 25/298 (8%)

Query  40    GDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPSRWA-----GMGRRLLLRSVQLHDSGN  93
             G SV + C     P       W                    G   RL +R  +L  +G 
Sbjct  768   GGSVDIVCTVDANPILPEMFSWERLGEEEEDLNLDDMEKVSKGSTGRLRIRQAKLSQAGA  827

Query  94    YSCYRAG----RPAGTVHLLVDVPP--EEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
             Y C           G V L+V   P  ++P  L+    +  S        R+        
Sbjct  828   YQCIVDNGVAPAARGLVRLVVRFAPQVDQPTPLTKVAAAGDSTSSATLHCRARGVPNIDF  887

Query  147   VLLVRKFQNSPAEDFQEPCQYSQESQKFS--CQLAVPEGDSSFYIVSMCVASSVGSKFSK  204
                         +D +       +    S    +A       + +      +++G   S 
Sbjct  888   TWTKNG-VPLDLQDPRYTEHRYHQGVVHSSLLTIANVSAAQDYALFKCTATNALG---SD  943

Query  205   TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT  264
                 Q   I +PDPP  + V +++ +   L   W+            RF++RY A  +  
Sbjct  944   HTNIQLVSISRPDPPLGLKVVSISPHSVGLE--WKP---GFDGGLPQRFQIRYEALETPG  998

Query  265   FTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
             F    V   Q     +       R+ + L A    G    ++   +   T     ++P
Sbjct  999   FLHVDVLPTQATTFTLTGLKPSTRYRIWLLASNALGDSGLTDKGIQVSVTTPGPDQAP  1056


> sp|Q2KL21|EPOR_CANLF Erythropoietin receptor OS=Canis lupus familiaris 
OX=9615 GN=EPOR PE=2 SV=1
Length=508

 Score = 67.9 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 42/213 (20%), Positives = 76/213 (36%), Gaps = 9/213 (4%)

Query  108  LLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL-TTKAVLLVRKFQNSPAEDFQEPCQ  166
            LL    PEE  L CF +  L ++VC W   ++  +         +               
Sbjct  41   LLAARAPEE--LLCFTER-LEDLVCFWEEAASAGVGPDNYSFFYQLEGEPWKTCSLHQAP  97

Query  167  YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA  226
             ++ + +F C L   +  S   +     A S G      +      ++  DPPA + +  
Sbjct  98   TTRGAVRFWCSLPTADTSSFVPLELRATAVSSG-ALLYRRIIHINEVVLLDPPAGL-LAR  155

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL  286
             A     + + W  P     +   +R+E+      +       + D +  CV+ +   G 
Sbjct  156  RADEGGHVVLRWLPPPGAPVASL-IRYEVNISGSVAGGSQKVEILDGRTECVLSNLRGGT  214

Query  287  RHVVQLRAQ--EEFGQGEWSEWSPEAMGTPWTE  317
            R+   +RA+  E    G WS WS  A     ++
Sbjct  215  RYTFMVRARMAEPSFGGFWSAWSEPASLLTASD  247


> sp|Q6WG24|IL4RA_HORSE Interleukin-4 receptor subunit alpha OS=Equus 
caballus OX=9796 GN=IL4R PE=2 SV=2
Length=809

 Score = 67.5 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 77/217 (35%), Gaps = 17/217 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC-  176
            +L+      +S   CEW      +    A L +    N    D       ++E +   C 
Sbjct  30   RLTACFSDYISASTCEWKMDRPTN--CSAQLRLSYQLNDEFSDNLTCIPENREDEVCVCR  87

Query  177  QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
             L         Y + +   + +    S    F+    ++P  P N+TV A+  +  WL +
Sbjct  88   MLMDNIVSEDVYELDLWAGNQLLWNSS----FKPSRHVKPRAPQNLTVHAI--SHTWL-L  140

Query  237  TWQDPHSWNSS-FYRLRFELRYRAERSKT-FTTWMVK--DLQHHCVIHDAWSGLRHVVQL  292
            TW +P+   +  +  L + +    E   T F  + V   D           S   +  ++
Sbjct  141  TWSNPYPLKNHLWSELTYLVNISKEDDPTDFKIYNVTYMDPTLRVTASTLKSRATYSARV  200

Query  293  RAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
            +A+ +     WSEWSP    T W      P E  +  
Sbjct  201  KARAQNYNSTWSEWSP---STTWHNYYEQPLEQRLPL  234


> sp|P13596|NCAM1_RAT Neural cell adhesion molecule 1 OS=Rattus 
norvegicus OX=10116 GN=Ncam1 PE=1 SV=1
Length=858

 Score = 67.5 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 53/352 (15%), Positives = 111/352 (32%), Gaps = 70/352 (20%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS------------------RWAGMGRRLL  82
            + VTLTC     +   ++ W        S                     R       L 
Sbjct  324  EQVTLTCE-ASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLT  382

Query  83   LRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE-------------EPQLSCFRKSP  126
            L+S+Q  D+G Y C  +   G+ + +++L V   P+             +  ++C   + 
Sbjct  383  LKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAY  442

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
             S  +  +              L+     S  + +  P     E    S        ++ 
Sbjct  443  PSATISWFRDGQ----------LLPSSNYSNIKIYNTPSASYLEVTPDS--------END  484

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
            F   +    + +G +  +        ++Q D P++ ++  V        V + +P +   
Sbjct  485  FGNYNCTAVNRIGQESLEFI------LVQADTPSSPSIDRVEPYSSTAQVQFDEPEA-TG  537

Query  247  SFYRLRFELRYR----AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                L+++  ++          +      +++    I       R+ V+L A    G GE
Sbjct  538  GVPILKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGLGE  597

Query  303  WSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
             S  + E    P  E  +P  E ++         N    N++ +D   +   
Sbjct  598  ISA-ATEFKTQPVREPSAPKLEGQMG-----EDGNSIKVNLIKQDDGGSPIR  643


 Score = 46.0 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 61/370 (16%), Positives = 116/370 (31%), Gaps = 58/370 (16%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG-----MGRR  80
            P  +    V T   G+ V +TC  V    +AT+ W        S                
Sbjct  417  PKLQGPVAVYTWE-GNQVNITCE-VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASY  474

Query  81   LLLRSVQLHDSGNYSCYRAGRPAGTVH--LLVDVP-PEEPQLSCFRKSPLSNVVCEWG-P  136
            L +     +D GNY+C    R        +LV    P  P +    +   S    ++  P
Sbjct  475  LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSID-RVEPYSSTAQVQFDEP  533

Query  137  RSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
             +T  +     L  + ++++   E +      ++E+        +     + Y V +   
Sbjct  534  EATGGVPI---LKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAAL  590

Query  196  SSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
            +  G    S    F+   + +P  P          N   +++  QD    +       + 
Sbjct  591  NGKGLGEISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQD----DGGSPIRHYL  646

Query  255  LRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
            ++YRA  S+      +     H ++        + V + A+ + G+      S  A    
Sbjct  647  VKYRALASEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGK------SKAAH---  697

Query  315  WTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSL  374
                                         +FR SA  T++P   S +  L T  + G  +
Sbjct  698  ----------------------------FVFRTSAQPTAIPANGSPTAGLSTGAIVGILI  729

Query  375  AFGTLLCIAI  384
                LL + +
Sbjct  730  VIFVLLLVVM  739


> sp|Q07303|EPOR_RAT Erythropoietin receptor OS=Rattus norvegicus 
OX=10116 GN=Epor PE=2 SV=1
Length=507

 Score = 66.8 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/207 (19%), Positives = 71/207 (34%), Gaps = 16/207 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
            +L CF +  L ++VC W   +   +        +    S            + S +F C 
Sbjct  49   ELLCFTQR-LEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCS  107

Query  178  LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
            L   +  S   +  + V  + GS     +      ++  D PA + +   A     + + 
Sbjct  108  LPTADTSSFVPLE-LQVTEASGSPR-YHRIIHINEVVLLDAPAGL-LARRAEEGSHVVLR  164

Query  238  WQDPHSWNSSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
            W  P         +   +RY        R+       V + +  CV+ +   G R+   +
Sbjct  165  WLPPPGA-----PMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAV  219

Query  293  RAQ--EEFGQGEWSEWSPEAMGTPWTE  317
            RA+  E    G WS WS  A     ++
Sbjct  220  RARMAEPSFSGFWSAWSEPASLLTASD  246


> sp|P70232|NCHL1_MOUSE Neural cell adhesion molecule L1-like protein 
OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
Length=1209

 Score = 67.1 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/254 (15%), Positives = 77/254 (30%), Gaps = 19/254 (7%)

Query  58   VHWVLRKPA---AGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVH----LLV  110
            + W     A    G+   R    G  L + ++   D G YSC        T       ++
Sbjct  550  LSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDSTSEKTQVTVL  609

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
             V P+ P      +    +V   W           + +     +     +     +    
Sbjct  610  GV-PDPPGNLHLSERQNRSVRLSWEAGDDH----NSKISEYIVEFEGNREEPGKWEELTR  664

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDP-PANITVTAVA  228
             Q     + +       Y   +   + VG S  S            PD  P NI V A  
Sbjct  665  VQGEETDVVLSLAPYVRYQFRVTAVNEVGRSHASLPSDHHETPPAAPDKNPQNIRVQASQ  724

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCVIHDAWSGLR  287
                   + W+   S   +   L +++ ++ + +   +   +V +     +    ++   
Sbjct  725  PKEMI--IKWEPLKSMEQNGPGLEYKVSWKPQGAPEEWEEEIVTNHTLRVMTPTVYA--P  780

Query  288  HVVQLRAQEEFGQG  301
            + V+++A  + G  
Sbjct  781  YDVKVQAINQLGSS  794


 Score = 56.4 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 51/333 (15%), Positives = 95/333 (29%), Gaps = 55/333 (17%)

Query  35   LTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR-RLLLRSVQLHDSGN  93
              ++ G S  L C        ATV W +          R+       L +      D+G+
Sbjct  433  YATVVGYSAFLHCE-YFASPKATVVWEVADETHPLEGDRYHTHENGTLEIYRTTEEDAGS  491

Query  94   YSCYRA---GRPAGTVHL------LVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT  144
            YSC+     G+   T +L       + V P+ P++    KS +  + CE           
Sbjct  492  YSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIP---KSHVLELYCE--------SQC  540

Query  145  KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSK  204
             + L      +   +           ++     +       S    ++          S 
Sbjct  541  DSHLKHSLKLSWSKDG---EAFEMNGTEDGRIVIDGAYLTIS----NITAEDQGVYSCSA  593

Query  205  TQTFQGCG-------ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
              +            +  PDPP N+ ++   R  R + ++W+     NS       E   
Sbjct  594  QTSLDSTSEKTQVTVLGVPDPPGNLHLS--ERQNRSVRLSWEAGDDHNSKISEYIVEFEG  651

Query  258  RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
              E    +        +   V+      +R+  ++ A  E G+             P   
Sbjct  652  NREEPGKWEELTRVQGEETDVVLSLAPYVRYQFRVTAVNEVGRSH--------ASLPSDH  703

Query  318  SRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
              +PPA         A   N  +  +       
Sbjct  704  HETPPA---------APDKNPQNIRVQASQPKE  727


> sp|P40238|TPOR_HUMAN Thrombopoietin receptor OS=Homo sapiens 
OX=9606 GN=MPL PE=1 SV=1
Length=635

 Score = 66.4 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/213 (21%), Positives = 71/213 (33%), Gaps = 25/213 (12%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS----------PAEDFQEPCQYS  168
            L CF    L NV C+W  +   S                           E+ ++     
Sbjct  289  LQCFT-LDLKNVTCQWQQQDHASSQ---GFFYHSRARCCPRDRYPIWENCEEEEKTNPGL  344

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT-QTFQGCGILQPDPPANITVTAV  227
            Q  Q   C       + S   + + V ++ G+  S     F     ++  P  N+    +
Sbjct  345  QTPQFSRCHF--KSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVR-LPTPNLHWREI  401

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
              +   L + WQ P SW +      ++LRY  E  + +       L       +     R
Sbjct  402  --SSGHLELEWQHPSSWAAQ--ETCYQLRYTGEGHQDWKVLEP-PLGARGGTLELRPRSR  456

Query  288  HVVQLRAQEE--FGQGEWSEWSPEAMGTPWTES  318
            + +QLRA+      QG WS WS        TE+
Sbjct  457  YRLQLRARLNGPTYQGPWSSWSDPTRVETATET  489


> sp|P31836|NCAM1_BOVIN Neural cell adhesion molecule 1 OS=Bos 
taurus OX=9913 GN=NCAM1 PE=1 SV=1
Length=853

 Score = 66.4 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 51/326 (16%), Positives = 103/326 (32%), Gaps = 65/326 (20%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS------------------RWAGMGRRLL  82
            + VTLTC     +   ++ W        S                     R       L 
Sbjct  322  EQVTLTCE-ASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLT  380

Query  83   LRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE-------------EPQLSCFRKSP  126
            L+S+Q  D+G Y C  +   G+ + +++L V   P+             +  ++C   + 
Sbjct  381  LKSIQYTDAGEYVCTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAY  440

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
             S  +  +              L+     S  + +  P     E    S        ++ 
Sbjct  441  PSATISWFRDGQ----------LLPSSNYSNIKIYNTPSASYLEVTPDS--------END  482

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
            F   +    + +G +  +        ++Q D P++ ++  V        V + +P +   
Sbjct  483  FGNYNCTAVNRIGQESLEFV------LVQADTPSSPSIDQVEPYSSTAQVQFDEPEA-TG  535

Query  247  SFYRLRFELRYRA----ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                L+++  +RA         +       ++    I        + V+L A    G GE
Sbjct  536  GVPILKYKAEWRAMGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGE  595

Query  303  WSEWSPEAMGTPWTESRSPPAENEVS  328
             S  + E    P  E  +P  E ++ 
Sbjct  596  ISA-ASEFKTQPVREPSAPKLEGQMG  620


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 47/289 (16%), Positives = 90/289 (31%), Gaps = 25/289 (9%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG-----MGRR  80
            P  +    V T   G+ V +TC  V    +AT+ W        S                
Sbjct  415  PKLQGPVAVYTWE-GNQVNITCE-VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASY  472

Query  81   LLLRSVQLHDSGNYSCYR----AGRPAGTVHLLVDVP--PEEPQLSCFRKSPLSNVVCEW  134
            L +     +D GNY+C             V +  D P  P   Q+  +  +         
Sbjct  473  LEVTPDSENDFGNYNCTAVNRIGQESLEFVLVQADTPSSPSIDQVEPYSSTAQVQFD---  529

Query  135  GPRSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
             P +T  +     L  + +++    E +      ++E+        V     + Y V + 
Sbjct  530  EPEATGGVPI---LKYKAEWRAMGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLA  586

Query  194  VASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
              +  G    S    F+   + +P  P          N   + +  QD    +       
Sbjct  587  ALNGKGLGEISAASEFKTQPVREPSAPKLEGQMGEDGNSIKVKLIKQD----DGGSPIRH  642

Query  253  FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
            + ++YRA  S+      +     H ++        + V + A+ + G+ 
Sbjct  643  YLVKYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKS  691


> sp|P16871|IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL7R PE=1 SV=3
Length=459

 Score = 65.6 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/122 (20%), Positives = 49/122 (40%), Gaps = 4/122 (3%)

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              VG K    +      I++P+ P +++V        ++ VT+   H        L  ++
Sbjct  109  VKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFV-VTFNTSHLQKKYVKVLMHDV  167

Query  256  RYR-AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ-EEFGQGEWSEWSPE-AMG  312
             YR  +    +T   +   +   +         + +++R+  + + +G WSEWSP     
Sbjct  168  AYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFR  227

Query  313  TP  314
            TP
Sbjct  228  TP  229


> sp|O60500|NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 
PE=1 SV=1
Length=1241

 Score = 66.4 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 60/379 (16%), Positives = 109/379 (29%), Gaps = 60/379 (16%)

Query  40    GDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPSRWA-----GMGRRLLLRSVQLHDSGN  93
             G SV + C     P      +W                    G   RL +   +L  +G 
Sbjct  754   GGSVDIVCTVDANPILPGMFNWERLGEDEEDQSLDDMEKISRGPTGRLRIHHAKLAQAGA  813

Query  94    YSCYRAGRP----AGTVHLLVDVPP--EEPQ-LSCFR----KSPLSNVVCEWGPRSTPSL  142
             Y C             + L+V   P  E P  L+        +  + + C         +
Sbjct  814   YQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHC-----RARGV  868

Query  143   TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFS--CQLAVPEGDSSFYIVSMCVASSVGS  200
                     +       +D +       +    S    +A       + + +    +++G 
Sbjct  869   PNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALG-  927

Query  201   KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAE  260
               S     Q   I +PDPP+ + V ++  +   L   W+            RF +RY A 
Sbjct  928   --SDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLE--WKP---GFDGGLPQRFCIRYEAL  980

Query  261   RSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
              +  F    V   Q     +       R+ V               W   +     +   
Sbjct  981   GTPGFHYVDVVPPQATTFTLTGLQPSTRYRV---------------WLLASNALGDSGLA  1025

Query  320   SPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTL  379
                 +  ++TP     + + +D +     +  + LP+       LP     GG L     
Sbjct  1026  DKGTQLPITTPGLHQPSGEPEDQLPTEPPSGPSGLPL-------LPVLFALGGLLLLSNA  1078

Query  380   LCIAIVLRFKKTWKLRALK  398
              C+  VL     W+ R  +
Sbjct  1079  SCVGGVL-----WQRRLRR  1092


> sp|Q8VHK6|I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus 
norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
Length=385

 Score = 65.2 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 52/171 (30%), Gaps = 13/171 (8%)

Query  132  CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI--  189
            C W P  T    T   +           D    C    +  + +    +   DSS Y   
Sbjct  151  CSWKPGKTVHSDTNYTMFFWY----EGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDF  206

Query  190  -VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
             + +  +S +    S    FQ   I++P PP  + ++    N   + + W  P       
Sbjct  207  FIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISV--ENSIDIRMKWSTPGGPIPPS  264

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
                +E+  R E   ++ +    D     +   A         +R +    
Sbjct  265  -CYTYEIVVR-EDDISWES--ATDKNDMKLKRRANESEDLCFFVRCKINIY  311


 Score = 48.7 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/143 (17%), Positives = 54/143 (38%), Gaps = 10/143 (7%)

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF-YRLRFELRYRAERSKTFTTWMVKD  272
            ++ +PP +  +        +L + W+ P   ++    +L +EL+YR   S ++ T + ++
Sbjct  26   IKVNPPQDFEI-LDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRN  84

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGE--WSEWSPEAMGTPWTESRSPPAENEVSTP  330
            L +     D   G+   ++    E    G    S W+  + G     S     ++     
Sbjct  85   LIYK-DGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQD-----  138

Query  331  MQALTTNKDDDNILFRDSANATS  353
            M+ +  N       ++      S
Sbjct  139  MKCIYYNWQYLVCSWKPGKTVHS  161


> sp|P16170|NCA11_XENLA Neural cell adhesion molecule 1-A OS=Xenopus 
laevis OX=8355 GN=ncam1-a PE=2 SV=1
Length=1088

 Score = 66.0 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 65/366 (18%), Positives = 122/366 (33%), Gaps = 51/366 (14%)

Query  7    ALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA  66
             +L  + A P             V            +TLTC     +   ++ W      
Sbjct  294  TILLKVYAKPKITYVE---NKTAVELD--------EITLTCE-ASGDPIPSITWRTAVRN  341

Query  67   AGSHPSRWAGMG--------RRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE  115
              S  +   G            L L+ +Q  D+G Y C  +   G     ++  V   P+
Sbjct  342  ISSEATTLDGHIVVKEHIRMSALTLKDIQYTDAGEYFCIASNPIGVDMQAMYFEVQYAPK  401

Query  116  E--PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
               P +    +    N+ CE       +    AV   R  Q  P+ +F     YS     
Sbjct  402  IRGPVVVYTWEGNPVNITCE-----VFAHPRAAVTWFRDGQLLPSSNFSNIKIYS---GP  453

Query  174  FSCQLAV-PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPR  232
             S  L V P+ ++ F   +    +++G +FS+        ++Q D P++  +  V     
Sbjct  454  TSSSLEVNPDSENDFGNYNCTAINTIGHEFSEFI------LVQADTPSSPAIRKVEPYSS  507

Query  233  WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK----DLQHHCVIHDAWSGLRH  288
             + + + +P S       L+++  +R    + + T        + +    +        +
Sbjct  508  TVMIVFDEPDS-TGGVPILKYKAEWRVIGHEKWHTKYYDAKEVNAESIITVMGLKPETSY  566

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
            +V+L A    G G+ S  S E    P  E  +P     +     +   N    +IL +D 
Sbjct  567  MVKLSAMNGKGLGD-STPSQEFTTQPVREPSAPKLVGHL-----SEDGNSIKVDILKQDD  620

Query  349  ANATSL  354
              +   
Sbjct  621  GGSPIR  626


 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 49/282 (17%), Positives = 92/282 (33%), Gaps = 21/282 (7%)

Query  32   RGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG-----MGRRLLLRSV  86
              V+ +  G+ V +TC  V     A V W        S                L +   
Sbjct  405  PVVVYTWEGNPVNITCE-VFAHPRAAVTWFRDGQLLPSSNFSNIKIYSGPTSSSLEVNPD  463

Query  87   QLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSL  142
              +D GNY+C      G       L+    P  P +    +   S V+  +  P ST  +
Sbjct  464  SENDFGNYNCTAINTIGHEFSEFILVQADTPSSPAIRK-VEPYSSTVMIVFDEPDSTGGV  522

Query  143  TTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
                 L  + +++    E +      ++E    S    +     + Y+V +   +  G  
Sbjct  523  PI---LKYKAEWRVIGHEKWHTKYYDAKEVNAESIITVMGLKPETSYMVKLSAMNGKGLG  579

Query  202  FSKTQT-FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAE  260
             S     F    + +P  P  +   +   N   + +  QD    +       + + YRA 
Sbjct  580  DSTPSQEFTTQPVREPSAPKLVGHLSEDGNSIKVDILKQD----DGGSPIRHYLVNYRAL  635

Query  261  RSKTFTTWMVKDLQHHCVIHDAWS-GLRHVVQLRAQEEFGQG  301
             +  +   M      H V+  A    + + V + A+ + G+ 
Sbjct  636  NALEWKPEMRVPSNSHHVMLKALEWNVDYEVIVVAENQQGKS  677


> sp|Q2VWP7|PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG 
PE=2 SV=1
Length=1150

 Score = 66.0 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 45/305 (15%), Positives = 93/305 (30%), Gaps = 25/305 (8%)

Query  58   VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP  114
            + W+       S   R      +L++  +   D   Y C      G       L V +  
Sbjct  358  MSWLKNGRKIHS-NGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSE  416

Query  115  EEP----QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
            + P     +     S  + ++    P           +   K +    E++Q        
Sbjct  417  DRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQV-----VI  471

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVAR  229
                +  +      +S Y   +     +G+   S   T      +   PP    ++  +R
Sbjct  472  GNDTTHYIIDDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPE---ISLTSR  528

Query  230  NPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
            +P  + ++W   P  +      L + L +R     +     +    H  ++        +
Sbjct  529  SPTDILISWLPIPAKYRRGQVVL-YRLSFRLSTENSIQVLELPGTTHEYLLEGLKPDSVY  587

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
            +V++ A    G GE S W   +  TP   S   P   E+         N    ++ ++  
Sbjct  588  LVRITAATRVGLGESSVW--TSHRTPKATSVKAPKSPELHL----EPLNCTTISVRWQQD  641

Query  349  ANATS  353
               T+
Sbjct  642  VEDTA  646


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 48/332 (14%), Positives = 96/332 (29%), Gaps = 33/332 (10%)

Query  7    ALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA  66
            ++ A+L   P         P        +T+    +V L C          + W      
Sbjct  216  SMEASLTVIPAKESKSFHTPTIIAGPQNITTSLHQTVVLEC-MATGNPKPIISWSRLDHK  274

Query  67   AGSH-PSRWAGMGRRLLLRSVQLHDSGNYSCYRA-----GRPAGTVHLLVDVPP---EEP  117
            +     +R  G G  L++  V+L  +G Y C                L V  PP   E P
Sbjct  275  SIDVFNTRVLGNGN-LMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWP  333

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
            +     ++  +  VC+    +    + K   L    +       +            S  
Sbjct  334  ESLTRPRAGTARFVCQ----AEGIPSPKMSWLKNGRKIHSNGRIKMY---------NSKL  380

Query  178  LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
            +          I      +S GS  S+ +        +P  P N+    +  +   + + 
Sbjct  381  VINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPSAPYNVHAETM--SSSAILLA  438

Query  238  WQDPHSWNSSFYRLRFELRYRAER--SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            W+ P   +     + + + Y      +      ++ +   H +I D      +   + A 
Sbjct  439  WERPLYNSDK--VIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLEPASNYTFYIVAY  496

Query  296  EEFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
               G  + S+           +    P E  +
Sbjct  497  MPMGASQMSD---HVTQNTLEDVPLRPPEISL  525


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 32/191 (17%), Positives = 61/191 (32%), Gaps = 26/191 (14%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY---RAERSKTFTTWMVKDLQ  274
            PP  + VT +        V+W+ P          R+ + Y   +A  +  +     +   
Sbjct  822  PPVGVKVTLIE--DDTALVSWKPPD--GPETVVTRYTILYASRKAWIAGEWQVLHREGAI  877

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
               ++ +  +G  ++V++ A  E G+G +S  S E    P   S S           +  
Sbjct  878  TMALLENLVAGNVYIVKISASNEVGEGPFSN-SVELAVLPKETSES---------NQRPK  927

Query  335  TTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKL  394
              +  D  +                    +    V  G      L+C+ I++   K  K 
Sbjct  928  RLDSADAKVYSG---------YYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKARKS  978

Query  395  RALKEGKTSMH  405
             A K  +    
Sbjct  979  SASKTAQNGTQ  989


> sp|Q38IC7|IL7RA_MACFA Interleukin-7 receptor subunit alpha OS=Macaca 
fascicularis OX=9541 GN=IL7R PE=2 SV=1
Length=459

 Score = 64.8 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 54/135 (40%), Gaps = 6/135 (4%)

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              VG K    +      I++P+ P +++V        ++ VT+   H        L  ++
Sbjct  109  VKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFV-VTFNTSHLQKKYVKVLMHDV  167

Query  256  RYR-AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ-EEFGQGEWSEWSPE-AMG  312
             YR  +    +    +   +   +  +      + +++R+  + + +G WSEWSP     
Sbjct  168  AYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFR  227

Query  313  TPWTESRSPPAENEV  327
            TP  E  + P E + 
Sbjct  228  TP--EINNSPGEMDP  240


> sp|P13590|NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus 
gallus OX=9031 GN=NCAM1 PE=1 SV=3
Length=1091

 Score = 65.2 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 54/341 (16%), Positives = 112/341 (33%), Gaps = 62/341 (18%)

Query  43   VTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMG--------RRLLLRSVQLHDSGNY  94
            +TLTC     +   ++ W        +      G            L L+ +Q  D+G Y
Sbjct  325  ITLTCE-ASGDPIPSITWKTSTRNISNEEKTLDGRIVVRSHARVSSLTLKEIQYTDAGEY  383

Query  95   SCYRA---GRPAGTVHLLVDVPPE-------------EPQLSCFRKSPLSNVVCEWGPRS  138
             C  +   G+ +  ++L V   P+             +  ++C   +  S V+  +    
Sbjct  384  VCTASNTIGQDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAVISWFRDGQ  443

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
                      L+     S  + +  P     E    S        ++ F   +    + +
Sbjct  444  ----------LLPSSNYSNIKIYNTPSASYLEVTPDS--------ENDFGNYNCTAVNRI  485

Query  199  GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR  258
            G + S+        ++Q D P++ ++  V        V + +P +       L+++  +R
Sbjct  486  GQESSEFI------LVQADTPSSPSIDRVEPYSSTARVEFDEPEA-TGGVPILKYKAEWR  538

Query  259  AERSKTFTTWMVK----DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT-  313
            A     + + +      +++    I        + V+L A    G GE S   P    T 
Sbjct  539  ALGEGEWHSRLYDAKEANVEGTITISGLKPETTYSVRLSAVNGKGVGEIS--LPSDFKTQ  596

Query  314  PWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
            P  E  +P  E ++         N    N++ +D   +   
Sbjct  597  PVREPSAPKLEGQMG-----EDGNSIKVNVIKQDDGGSPIR  632


> sp|P14753|EPOR_MOUSE Erythropoietin receptor OS=Mus musculus 
OX=10090 GN=Epor PE=1 SV=1
Length=507

 Score = 64.8 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 39/207 (19%), Positives = 72/207 (35%), Gaps = 16/207 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
            +L CF +  L ++VC W   ++  +        +    S            + S +F C 
Sbjct  49   ELLCFTQR-LEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCS  107

Query  178  LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
            L   +  S   +  + V  + GS     +      ++  D PA + +   A     + + 
Sbjct  108  LPTADTSSFVPLE-LQVTEASGSPR-YHRIIHINEVVLLDAPAGL-LARRAEEGSHVVLR  164

Query  238  WQDPHSWNSSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
            W  P         +   +RY        R+       V + +  CV+ +   G R+   +
Sbjct  165  WLPPPGA-----PMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAV  219

Query  293  RAQ--EEFGQGEWSEWSPEAMGTPWTE  317
            RA+  E    G WS WS  A     ++
Sbjct  220  RARMAEPSFSGFWSAWSEPASLLTASD  246


> sp|Q2EY15|PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg 
PE=2 SV=1
Length=1191

 Score = 64.8 bits (156),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 45/301 (15%), Positives = 85/301 (28%), Gaps = 25/301 (8%)

Query  58   VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP  114
            + W+       S   R      +L++  +   D   Y C      G       L V +  
Sbjct  352  MSWLKNGRRIHS-NGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSE  410

Query  115  EEP----QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
            + P     +     S  + ++    P           +   K +    E++Q        
Sbjct  411  DRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQV-----VL  465

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVAR  229
                +  +       S Y   +     +G+   S   T      +   PP    ++  +R
Sbjct  466  GNDTTHYIIDDLEPDSNYTFYIVAYMPLGASQMSDHVTQNTLEDVPLRPPE---ISLTSR  522

Query  230  NPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
            +P  + V+W   P  +      L + L +R           +    H  ++        +
Sbjct  523  SPTDILVSWLPIPAKYRRGQVVL-YRLSFRLSTENAIQVVELPGTVHEYLLEGLKPDSVY  581

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWT----ESRSPPAENEVSTPMQALTTNKDDDNIL  344
            +V++ A    G GE S W   +  TP        +SP    E             D    
Sbjct  582  LVRITAATRVGLGESSVW--TSHRTPKATSVKAPKSPELHLEPLNCTTISVRWLQDTEDP  639

Query  345  F  345
             
Sbjct  640  A  640


 Score = 55.6 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 48/325 (15%), Positives = 98/325 (30%), Gaps = 43/325 (13%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH-PSRWAGMGRRLLLR  84
            P    +   +T+    +V L C          + W      +     +R  G G  L++ 
Sbjct  229  PTIIASPQNVTASLHQTVVLEC-MATGYPRPIISWSRLDHKSIDVFNTRVLGNGN-LIIS  286

Query  85   SVQLHDSGNYSCYRA-----GRPAGTVHLLVDVPP---EEPQLSCFRKSPLSNVVCEWGP  136
             V+L  +G Y C                L V  PP   E P+     ++  +  VC+   
Sbjct  287  DVKLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQ---  343

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFY----IVSM  192
                           +   SP   + +  +    + +     +    +        I   
Sbjct  344  --------------AEGIPSPKMSWLKNGRRIHSNGRIKMYNSKLVINQIIPEDDAIYQC  389

Query  193  CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
               +S GS  S+ +        +P  P N+    +  +   + + W+ P   +     + 
Sbjct  390  MAENSQGSVLSRARLTVVMSEDRPSAPYNVHAETM--SSSAILLAWERPLYNSDK--VIA  445

Query  253  FELRYRAER--SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEA  310
            + + Y      +      ++ +   H +I D      +   + A    G  + S+     
Sbjct  446  YSVHYMKAEGLNNEEYQVVLGNDTTHYIIDDLEPDSNYTFYIVAYMPLGASQMSD-----  500

Query  311  MGTPWTESRSPPAENEVSTPMQALT  335
              T  T    P    E+S   ++ T
Sbjct  501  HVTQNTLEDVPLRPPEISLTSRSPT  525


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 42/264 (16%), Positives = 83/264 (31%), Gaps = 46/264 (17%)

Query  218   PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY---RAERSKTFTTWMVKDLQ  274
             PP  + VT +        V+W+ P          R+ + Y   +A  +  +     +   
Sbjct  816   PPVGVKVTLIE--DDTALVSWKPPD--GPETVVTRYTILYASRKAWIAGEWQVLHREGAI  871

Query  275   HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW--TESRSPPAENEVSTPMQ  332
                ++ +  +G  ++V++ A  E G+G +S  S E    P   +ES   P   + S    
Sbjct  872   TMALLENLVAGNVYIVKISASNEVGEGPFSN-SVELAVLPKDASESNQRPKRLDSSNAKV  930

Query  333   ALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTW  392
                                            +    V  G      L+C+ I++   K  
Sbjct  931   YSGY--------------------YHLDQKSMTGIAVGVGIALTCILICVLILIYRSKAR  970

Query  393   KLRALKEGKTSMHP----------PYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNT  442
             K  A K  ++   P             +G+ +         LVP++      +  G+D  
Sbjct  971   KSSASKTAQSGTQPLSQASASVAAGSDMGKNLERATETAESLVPMMPSSFIDAKGGTDLI  1030

Query  443   SSHNRPDARDPRSPYDISNTDYFF  466
              +   P  +      + +   + F
Sbjct  1031  INSYGPIIK------NNTKKKWLF  1048


> sp|Q9HCK4|ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens OX=9606 
GN=ROBO2 PE=1 SV=2
Length=1378

 Score = 64.8 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 59/337 (18%), Positives = 100/337 (30%), Gaps = 45/337 (13%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK------PAAGSHPSRWAGMGR  79
            P   V         G +VT  C        A V W          P     P+    +  
Sbjct  314  PQFVVRPRDQIVAQGRTVTFPCETKGNPQPA-VFWQKEGSQNLLFPNQPQQPNSRCSVSP  372

Query  80   R--LLLRSVQLHDSGNYSCYR---AGRPAGTVHL-----LVDVPP----EEPQLSCFRKS  125
               L + ++Q  D+G Y C     AG       L     L D PP    + P        
Sbjct  373  TGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVD  432

Query  126  PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ------KFSCQLA  179
              + + C              +  +++    P  D +   Q     Q        +    
Sbjct  433  GTALLKC-----KATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYT  487

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
                 SS       V     S  + ++ +    +  P PP+   VT V +N   ++++WQ
Sbjct  488  CVATSSSGETSWSAVLDVTESGATISKNYDLSDL--PGPPSKPQVTDVTKNS--VTLSWQ  543

Query  240  D--PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE  297
               P +  +S Y +    +     S ++ T           +        ++  +RA   
Sbjct  544  PGTPGTLPASAYIIEAFSQ---SVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINP  600

Query  298  FGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
             G  + S  S        T+  SPPA+      +Q  
Sbjct  601  QGLSDPSPMSDPV----RTQDISPPAQGVDHRQVQKE  633


 Score = 38.2 bits (87),  Expect = 0.19, Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 24/59 (41%), Gaps = 0/59 (0%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
              G+   L C         T++W   K        R +  G +L++ + +  D+G Y+C
Sbjct  145  AAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTC  203


> sp|Q90344|EPHB2_COTJA Ephrin type-B receptor 2 OS=Coturnix japonica 
OX=93934 GN=EPHB2 PE=2 SV=1
Length=987

 Score = 64.8 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/207 (19%), Positives = 71/207 (34%), Gaps = 15/207 (7%)

Query  110  VDVP----PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
            VD+P    P  PQ S       ++++ EW P          V  +              C
Sbjct  318  VDMPCTTIPSAPQ-SVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRC  376

Query  166  QYSQESQKFSCQLAVP------EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPD  217
              + +       L  P          + Y   +   + V  +   +  F    I   Q  
Sbjct  377  GDNVQFAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAA  436

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            P A   +  V+R    ++++W  P     +   L +EL+Y  +      +  VK   +  
Sbjct  437  PSAVSIMHQVSRTVDSITLSWSQPDQ--PNGVILDYELQYYEKNLSELNSTAVKSPTNTV  494

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             + +  +G  +V Q+RA+   G G +S
Sbjct  495  TVQNLKAGTIYVFQVRARTVAGYGRYS  521


> sp|O94779|CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 
PE=1 SV=2
Length=1100

 Score = 64.4 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/317 (17%), Positives = 97/317 (31%), Gaps = 22/317 (7%)

Query  6    CALLAALLAAPGAALAPRRCPA-QEVARGVLTSLPGDSVTLTCPGV-EPEDNATVHWVLR  63
            C       +A   A    + P   E+         G+S+ L C  + +   + T +W L+
Sbjct  551  CRGENVFGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDASLDVTFYWTLK  610

Query  64   KP-----AAGSH--PSRWAGMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVP  113
                     G H    R       L++R++ L  +G Y C     A   +    LLV  P
Sbjct  611  GQPIDFEEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVRGP  670

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P  P +    +   S     W P +      +   L  R   +   +   +         
Sbjct  671  PGPPGIVIVEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQT-VKTVPEIITGD  729

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQP-DPPANITVTAVARN  230
              S  +AV       Y   +   + +G+   S            P   P N  V+  +  
Sbjct  730  MESA-MAVDLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTN--VSGRSGR  786

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSGLR  287
               L + W+       +     + + +R   ++ +   MV   +    I+          
Sbjct  787  RHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPLTP  846

Query  288  HVVQLRAQEEFGQGEWS  304
              V++      G G +S
Sbjct  847  FEVKVGVYNNKGDGPFS  863


> sp|P55146|TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus 
norvegicus OX=10116 GN=Tyro3 PE=1 SV=1
Length=880

 Score = 64.4 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 65/324 (20%), Positives = 101/324 (31%), Gaps = 76/324 (23%)

Query  16   PGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK------PAAGS  69
            PG+A A  +      A   +T   G  V L C  VE  D+  +HW+              
Sbjct  26   PGSAAAGLK---LMGAPVKMTVSQGQPVKLNC-SVEGMDDPDIHWMKDGAVVQNASQVSI  81

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCY-RAGR---PAGTVHLLVD-------------V  112
              S    +G  L L+S +  D+G Y C  + G     + +V L V+             V
Sbjct  82   SISEQNWIG-LLSLKSAERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAV  140

Query  113  PPEEP-QLSCFRKSPLSNVVC-EW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
            PP  P QLSC    P   V    W GP                  N      +       
Sbjct  141  PPNVPFQLSCEAVGPPEPVTIFWWRGPTKVGGPA-----SSPSVLNVTGVTQR-------  188

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITVT  225
               +FSC                   +  G   S+        I++    P  P NITVT
Sbjct  189  --TEFSC----------------EAHNIKGLATSRPA------IIRLQAPPAAPFNITVT  224

Query  226  AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA-ERSKTFTTWMVKDLQHHCVIHDAWS  284
             +  +    SV W       +  +    ++ +   E         V      C++ +   
Sbjct  225  TI--SSSNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFT--CLLRNLAP  280

Query  285  GLRHVVQLRAQEEFGQGEWSEWSP  308
               + +++R     G   + +W P
Sbjct  281  ATNYSLRVRCANALGPSPYGDWVP  304


> sp|P13591|NCAM1_HUMAN Neural cell adhesion molecule 1 OS=Homo 
sapiens OX=9606 GN=NCAM1 PE=1 SV=3
Length=858

 Score = 64.4 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/352 (15%), Positives = 108/352 (31%), Gaps = 69/352 (20%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS------------------RWAGMGRRLL  82
            + VTLTC     +   ++ W        S                     R       L 
Sbjct  323  EQVTLTCE-ASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLT  381

Query  83   LRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE-------------EPQLSCFRKSP  126
            L+S+Q  D+G Y C  +   G+ + +++L V   P+             +  ++C   + 
Sbjct  382  LKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAY  441

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
             S  +  +              L+     S  + +  P     E    S        ++ 
Sbjct  442  PSATISWFRDGQ----------LLPSSNYSNIKIYNTPSASYLEVTPDS--------END  483

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
            F   +    + +G +  +        ++Q D P++ ++  V        V + +P +   
Sbjct  484  FGNYNCTAVNRIGQESLEFI------LVQADTPSSPSIDQVEPYSSTAQVQFDEPEA-TG  536

Query  247  SFYRLRFELRYRAE----RSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                L+++  +RA         +       ++    I        + V+L A    G GE
Sbjct  537  GVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGE  596

Query  303  WSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
             S  S         E  +P  E ++         N    N++ +D   +   
Sbjct  597  ISAASEFKTQPVQGEPSAPKLEGQMG-----EDGNSIKVNLIKQDDGGSPIR  643


 Score = 46.3 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 48/288 (17%), Positives = 92/288 (32%), Gaps = 22/288 (8%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG-----MGRR  80
            P  +    V T   G+ V +TC  V    +AT+ W        S                
Sbjct  416  PKLQGPVAVYTWE-GNQVNITCE-VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASY  473

Query  81   LLLRSVQLHDSGNYSCYRAGRPAGTVH--LLVDVP-PEEPQLSCFRKSPLSNVVCEWG-P  136
            L +     +D GNY+C    R        +LV    P  P +    +   S    ++  P
Sbjct  474  LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSID-QVEPYSSTAQVQFDEP  532

Query  137  RSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
             +T  +     L  + +++    E +      ++E+        V     + Y V +   
Sbjct  533  EATGGVPI---LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAAL  589

Query  196  SSVGSKFSKTQTFQGCGILQPDP--PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
            +  G       +      +Q +P  P          N   +++  QD    +       +
Sbjct  590  NGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQD----DGGSPIRHY  645

Query  254  ELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
             +RYRA  S+      +     H ++        + V + A+ + G+ 
Sbjct  646  LVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKS  693


> sp|P29322|EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens 
OX=9606 GN=EPHA8 PE=1 SV=2
Length=1005

 Score = 64.1 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 70/212 (33%), Gaps = 13/212 (6%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC-------  165
            PP  P ++       ++V  EW P   P   +         +   A    E C       
Sbjct  328  PPSAP-VNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFV  386

Query  166  QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPDPPANIT  223
                   + S  +A      + Y   +   + V     + +      I   Q  P   + 
Sbjct  387  PQQTSLVQASLLVANLLAHMN-YSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVV  445

Query  224  VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAW  283
            +         +S+ WQ+P     +   L +E++Y  +  +  +   +K +     +    
Sbjct  446  IRQERAGQTSVSLLWQEPEQ--PNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLK  503

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
             G R+V Q+RA+   G G +S+      G P 
Sbjct  504  PGTRYVFQVRARTSAGCGRFSQAMEVETGKPR  535


> sp|Q06418|TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 
OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
Length=890

 Score = 64.1 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 65/312 (21%), Positives = 97/312 (31%), Gaps = 71/312 (23%)

Query  27   AQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS------HPSRWAGMGRR  80
                A   LT   G  V L C  VE  +   + WV       +        S    +G  
Sbjct  44   KLMGAPVKLTVSQGQPVKLNC-SVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIG-F  101

Query  81   LLLRSVQLHDSGNYSCYR--AGRPAGT--VHLLVD-------------VPPEEP-QLSCF  122
            L L+SV+  D+G Y C     G    +  V L V+             VPP  P QLSC 
Sbjct  102  LSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCE  161

Query  123  RKSPLSNVV-CEW-GPRSTPSL-TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA  179
               P   V    W G         + +VL V     S                 FSC   
Sbjct  162  AVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTM---------------FSC---  203

Query  180  VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
                            +  G   S+T T     +  P  P NITVT +  +    SV W 
Sbjct  204  -------------EAHNLKGLASSRTATVHLQAL--PAAPFNITVTKL--SSSNASVAWM  246

Query  240  DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH---HCVIHDAWSGLRHVVQLRAQE  296
                  +    L+     +  ++      +   +      C++ D      + +++R   
Sbjct  247  PGADGRA---LLQSCT-VQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRCAN  302

Query  297  EFGQGEWSEWSP  308
              G   +++W P
Sbjct  303  ALGPSPYADWVP  314


> sp|Q15375|EPHA7_HUMAN Ephrin type-A receptor 7 OS=Homo sapiens 
OX=9606 GN=EPHA7 PE=1 SV=3
Length=998

 Score = 64.1 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 68/217 (31%), Gaps = 34/217 (16%)

Query  113  PPEEPQLSCFRKSPL----------SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            P + P ++C R              + V  EW P +             +         Q
Sbjct  320  PSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTY---RILCKRCSWEQ  376

Query  163  EPCQYSQESQKFSCQLAVPEGDSSFYIVS------------MCVASSVGSKFSKTQTFQG  210
              C            +    G    Y+              +   + V S  S++Q    
Sbjct  377  GEC---VPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGV-SDLSRSQRLFA  432

Query  211  CGILQPDPPANITVTAVARN---PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
               +     A   V+ V +     R + ++WQ+P   + +     +E++Y  +  +  T 
Sbjct  433  AVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPE--HPNGVITEYEIKYYEKDQRERTY  490

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              VK       I++   G  +V Q+RA    G G +S
Sbjct  491  STVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYS  527


> sp|P97686|NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus 
norvegicus OX=10116 GN=Nrcam PE=1 SV=2
Length=1214

 Score = 64.1 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/285 (15%), Positives = 90/285 (32%), Gaps = 23/285 (8%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNAT-VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLH  89
              G      G  V+  C           + W+       +           L++  V+  
Sbjct  551  QPGYAVVQRGSKVSFECKVKHDHTLIPTILWLKDNGELPNDERFSVDKDH-LVVSDVKDE  609

Query  90   DSGNYSC---YRAGRPAGTVHLLVDVP----------PEEPQLSCFRKSPLSNVVCEWGP  136
            D G Y+C         + +  L V  P          P  P           +V   W P
Sbjct  610  DGGTYTCAANTTLDSVSASAVLRVVAPTPTPAPIYDVPNPPFDLELTNQLDKSVQLTWTP  669

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                +      ++  +     A  ++   + S           +       Y   +   +
Sbjct  670  GDDNNSPITKFIIEYEDAMHEAGLWRHQAEVSGTQT----TAQLKLSPYVNYSFRVMAEN  725

Query  197  SVG-SKFSKTQTFQGCGILQPDPPANIT-VTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
            S+G S  S+          +PD   N T V  +   P  L +TW+  + + S+   L+++
Sbjct  726  SIGRSVPSEASEQYLTKAAEPD--QNPTAVEGLGTEPDNLVITWKPLNGFQSNGPGLQYK  783

Query  255  LRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
            + +R +      T +V       ++    + + ++++++A  + G
Sbjct  784  VSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVG  828


> sp|Q01344|IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL5RA PE=1 SV=2
Length=420

 Score = 63.3 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 71/225 (32%), Gaps = 39/225 (17%)

Query  110  VDVPPEEP-----QLSC----------FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQ  154
            +  PP  P      L+C            +S   ++ C W   +     T+  L  R   
Sbjct  118  LHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRY--  175

Query  155  NSPAEDFQEPCQYSQESQKFS---CQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
                  + E CQ   +        C         S     + V  +  SK S  + F   
Sbjct  176  ----GSWTEECQEYSKDTLGRNIACWFPR-TFILSKGRDWLAVLVNGSSKHSAIRPFDQL  230

Query  212  ----GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
                 I Q +PP N+T          LS+ W+ P S         +E++    R+     
Sbjct  231  FALHAIDQINPPLNVTAEI---EGTRLSIQWEKPVSAFPIH-CFDYEVKIHNTRNGYLQI  286

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF---GQGEWSEWSPE  309
              +       +I D     ++ VQ+RA         G WSEWS  
Sbjct  287  EKLMTNAFISIIDDL---SKYDVQVRAAVSSMCREAGLWSEWSQP  328


> sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=Xenopus 
laevis OX=8355 GN=ephb1-b PE=1 SV=1
Length=902

 Score = 64.1 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 67/197 (34%), Gaps = 38/197 (19%)

Query  130  VVCEWGPRSTPS--LTTKAVLLVRKFQN-----SPAEDFQEPCQYSQESQKFSCQLAVPE  182
            +  EW P             ++ +K Q+     S  +D  +              ++   
Sbjct  256  ITLEWHPPRETGGRDDVNYNIICKKCQSDRRGCSHCDDNVDFVPRQLGLTDTRVFISNLW  315

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT---------------AV  227
               + Y   +   + V +K              P PP +++V                 V
Sbjct  316  VH-TPYTFEIQAVNGVTNKS-------------PFPPQHVSVNITTNQAAPSSVPIMHQV  361

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
                + ++++W  P     +   L +E+RY  +    F + + +   +   I     G+ 
Sbjct  362  KATMKSITLSWPQPEQ--PNGIILDYEIRYYEKDHHEFNSSLARSQTNTASIEGLRPGVV  419

Query  288  HVVQLRAQEEFGQGEWS  304
            +VVQ+RA+   G G++S
Sbjct  420  YVVQVRARTVAGYGKFS  436


> sp|Q08351|TPOR_MOUSE Thrombopoietin receptor OS=Mus musculus 
OX=10090 GN=Mpl PE=2 SV=2
Length=625

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 47/210 (22%), Positives = 77/210 (37%), Gaps = 20/210 (10%)

Query  119  LSCFRKSPLSNVVCEW---GPRSTPSLTTKAVLL---VRKFQNSPAEDFQEPCQYSQESQ  172
            L CF    L  V C+W      S+      +        +       + +EP   SQ + 
Sbjct  281  LQCFT-LDLKMVTCQWQQQDRTSSQGFFRHSRTRCCPTDRDPTWEKCEEEEPRPGSQPAL  339

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT-QTFQG-CGILQPDPPANITVTAVARN  230
               C       DS  +I+ + V ++ G+  S     F     +L P P    ++     +
Sbjct  340  VSRCHF-KSRNDSVIHIL-VEVTTAQGAVHSYLGSPFWIHQAVLLPTP----SLHWREVS  393

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
               L + WQ   SW +      ++LRY  E  + +       L       +     R+ +
Sbjct  394  SGRLELEWQHQSSWAAQ--ETCYQLRYTGEGREDWKVLEPS-LGARGGTLELRPRARYSL  450

Query  291  QLRAQEE--FGQGEWSEWSPEAMGTPWTES  318
            QLRA+      QG WS WSP A  +  +E+
Sbjct  451  QLRARLNGPTYQGPWSAWSPPARVSTGSET  480


> sp|P97528|CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 
GN=Cntn6 PE=1 SV=1
Length=1028

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 48/301 (16%), Positives = 90/301 (30%), Gaps = 18/301 (6%)

Query  19   ALAPRRCPAQEVARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRK-----PAAGSHPS  72
            +L  +      V    +    G+S+ L C    +P       W             +H  
Sbjct  493  SLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPTMEVLFVWYFNGDVIDLKKGVAHFE  552

Query  73   RWAG-MGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLS  128
            R  G     L++R++QL  SG Y C       R +    ++V  PP  P+         +
Sbjct  553  RIGGESVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVADIIVRGPPGPPEDVKVEHISST  612

Query  129  NVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFY  188
                 W P    +   +   +  +   S               Q ++  +         Y
Sbjct  613  TSQLSWRPGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGQTYNATVIGLSPWVE-Y  671

Query  189  IVSMCVASSVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNS  246
               +   +++G    SK           P+  P NI       +   L +TW+       
Sbjct  672  EFRVVAGNNIGIGEPSKPSELLRTKASIPNVAPVNI--NGGGGSRSELVITWEPIPEELQ  729

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSGLRHVVQLRAQEEFGQGEW  303
            +     + + +R   S T+    V  ++    I+            V++      G+G  
Sbjct  730  NGEGFGYIIMFRPVGSTTWMKEKVALVESSKFIYRNESIMPLSPFEVKVGVYNNEGEGSL  789

Query  304  S  304
            S
Sbjct  790  S  790


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 44/291 (15%), Positives = 92/291 (32%), Gaps = 41/291 (14%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC-  96
              G  +++ C        A++ W             +      L + +V   D+G+Y+C 
Sbjct  422  QVGGDISIECK-PNAFPKASISWKRGTENLKQSKRVFFLEDGSLKICNVTRSDAGSYTCV  480

Query  97   --------YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVL  148
                      +G        ++ VPP +  ++         + C           T  VL
Sbjct  481  ATNQFGNGKSSGSLIVKERTVITVPPSKMDVTV---GESIVLPC-----QVSHDPTMEVL  532

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSC----QLAVPEGDSSFYIVSMCVASSVGSKFSK  204
             V  F      D ++   + +     S        +  G S  Y+ ++       S  + 
Sbjct  533  FVWYFNG-DVIDLKKGVAHFERIGGESVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVAD  591

Query  205  TQTFQGCGILQ--PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS  262
                    I++  P PP ++ V  ++     L  +W+     NS      F ++ R   S
Sbjct  592  I-------IVRGPPGPPEDVKVEHISSTTSQL--SWRPGPDNNSPIQI--FTIQTRTPFS  640

Query  263  KTFTTW-----MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
              +        ++    ++  +      + +  ++ A    G GE S+ S 
Sbjct  641  VGWQAVATVPEILNGQTYNATVIGLSPWVEYEFRVVAGNNIGIGEPSKPSE  691


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 55/164 (34%), Gaps = 33/164 (20%)

Query  184   DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP-----------R  232
              ++ Y  S+   ++ G+  S              PP N+T      +             
Sbjct  871   ANTIYFASVRAYNTAGTGPSS-------------PPVNVTTKKSPPSQPPANIAWKLSNS  917

Query  233   WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR-HVVQ  291
              L + W+   +  +    L +++ YR  +++   T +++       +         ++++
Sbjct  918   KLCLNWEHVKTMENESEVLGYKILYR--QNRQSKTHVLETNNTSAEL--LVPFEEDYLIE  973

Query  292   LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
             +R   + G G     S E +  P   S S      +    Q LT
Sbjct  974   IRTVSDGGDGS----SSEEIRIPKMSSLSSVGVQILKPSTQFLT  1013


> sp|Q00993|UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus 
musculus OX=10090 GN=Axl PE=1 SV=2
Length=888

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 61/344 (18%), Positives = 97/344 (28%), Gaps = 80/344 (23%)

Query  28   QEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKP------------AAGSHPSRWA  75
                 G +T   G + TL C      +   V W+                  G       
Sbjct  31   FVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEW  90

Query  76   GMGRRLLLRSVQLHDSGNYSC--YRAGRPAGTVHLLVDV--PP---EEPQ----------  118
             +  +L + ++QL D+G Y C  +  GR   +    V +   P   EEP+          
Sbjct  91   KVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPF  150

Query  119  -LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
             LSC  + P   V   W   + P             Q               ++  FSC 
Sbjct  151  NLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGL----------NKTSSFSC-  199

Query  178  LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
                              ++ G   S+T T        P  P ++ V  V+R P  L V 
Sbjct  200  ---------------EAHNAKGVTTSRTATITVL----PQRPHHLHV--VSRQPTELEVA  238

Query  238  WQDPHSWNSSFYRLRFE-LRY------------RAERSKTFTTWMVKDLQHHCVIHDAWS  284
            W       S  Y L    L+             +++  +   T  V    H   +     
Sbjct  239  WTP---GLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLP  295

Query  285  GLRHVVQLRAQEEFGQGEWSEWSP--EAMGTPWTESRSPPAENE  326
               + +++      G   W+ W P     G P     +  A   
Sbjct  296  HTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRN  339


 Score = 54.0 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 49/298 (16%), Positives = 93/298 (31%), Gaps = 20/298 (7%)

Query  42   SVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC--YRA  99
               L+C    P +  T+ W+          +   G   +  L++  L+ + ++SC  + A
Sbjct  149  PFNLSCQAQGPPEPVTLLWLQD----AVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNA  204

Query  100  GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPR-----STPSLTTKAVLLVRKFQ  154
                 +    + V P+ P          + +   W P             +AVL      
Sbjct  205  KGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVG  264

Query  155  NSPAEDFQEPCQYSQESQ--KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG  212
                +        + +        +L      + ++I   C +S   S ++     +   
Sbjct  265  IWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTE  324

Query  213  ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
             +   PP N++     RN   + V WQ+P         L + L YR + +      +   
Sbjct  325  GVPLGPPENVSA---MRNGSQVLVRWQEPRVPLQGTL-LGYRLAYRGQDTPEVLMDIGLT  380

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTP  330
             +    +          V + A    G G WS         PW   +  P  + VS P
Sbjct  381  REVTLELRGDRPVANLTVSVTAYTSAGDGPWS---LPVPLEPWRPGQGQPLHHLVSEP  435


> sp|Q7TPD3|ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=10090 
GN=Robo2 PE=1 SV=2
Length=1470

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 60/349 (17%), Positives = 102/349 (29%), Gaps = 45/349 (13%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK------PAA  67
            A     + P   P   V         G +VT  C        A V W          P  
Sbjct  306  ATLTVRVRPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPA-VFWQKEGSQNLLFPNQ  364

Query  68   GSHPSRWAGMGRR--LLLRSVQLHDSGNYSCYR---AGRPAGTVHL-----LVDVPP---  114
               P+    +     L + ++Q  D+G Y C     AG       L     L D PP   
Sbjct  365  PQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII  424

Query  115  -EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ-  172
             + P          + + C              +  +++       D +   Q     Q 
Sbjct  425  LQGPINQTLAVDGTALLKC-----KATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQI  479

Query  173  -----KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV  227
                   +         SS       V     S  + ++ +    +  P PP+   VT V
Sbjct  480  KNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDMNDL--PGPPSKPQVTDV  537

Query  228  ARNPRWLSVTWQD--PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSG  285
            ++N   ++++WQ   P    +S Y +    +     S ++ T           +      
Sbjct  538  SKNS--VTLSWQPGTPGVLPASAYIIEAFSQ---SVSNSWQTVANHVKTTLYTVRGLRPN  592

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
              ++  +RA    G  + S  S        T+  SPPA+      +Q  
Sbjct  593  TIYLFMVRAINPQGLSDPSPMSDPV----RTQDISPPAQGVDHRQVQKE  637


 Score = 40.9 bits (94),  Expect = 0.025, Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 55/198 (28%), Gaps = 27/198 (14%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC-  96
              G+   L C         T++W   K        R +  G +L++ + +  D+G Y+C 
Sbjct  145  AAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCV  204

Query  97   ---YRAGRPAGTVHLLVDVPP---EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV  150
                   R +    L V   P     P      +       C              V   
Sbjct  205  GTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRC-----QVQGDPQPTV---  256

Query  151  RKFQNSPAEDFQEPCQYSQESQKFSCQLAV-PEGDSSFYIVSMCVASSVGSKF-SKTQTF  208
                    +D   P         ++ ++      D   Y+      + VG    S T T 
Sbjct  257  ----RWKKDDADLPRGRYDIKDDYTLRIKKAMSTDEGTYVCI--AENRVGKVEASATLTV  310

Query  209  QGCGILQPDPPANITVTA  226
            +    ++P  P    V  
Sbjct  311  R----VRPVAPPQFVVRP  324


> sp|Q9QZS7|NPHN_MOUSE Nephrin OS=Mus musculus OX=10090 GN=Nphs1 
PE=1 SV=2
Length=1256

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 49/266 (18%), Positives = 77/266 (29%), Gaps = 23/266 (9%)

Query  40    GDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPSRWA-----GMGRRLLLRSVQLHDSGN  93
             G SV + C     P       W                    G   RL +R  +L  +G 
Sbjct  768   GGSVDIVCTVDANPILPEMFSWERLGEDEEELNLDDMEKMSKGSTGRLRIRQAKLSQAGA  827

Query  94    YSCYRAG----RPAGTVHLLVDVPP--EEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
             Y C           G V L+V   P  + P  L+    +  S        R+        
Sbjct  828   YQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDF  887

Query  147   VLLVRKFQNSPAEDFQEPCQYSQESQKFSC-QLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
                         +      +Y Q     S   +A       + +      +++G   S  
Sbjct  888   TWTKNGVPLDLQDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALG---SDH  944

Query  206   QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
                Q   I +PDPP  + V +V+ +   L   W+            RF++RY A  S  F
Sbjct  945   TNIQLVSISRPDPPLGLKVVSVSPHSVGLE--WKP---GFDGGLPQRFQIRYEALESPGF  999

Query  266   TTWMVKDLQ-HHCVIHDAWSGLRHVV  290
                 V   Q     +       R+ +
Sbjct  1000  LYMDVLPAQATTFTLTGLKPSTRYRI  1025


> sp|P54759|EPHA7_RAT Ephrin type-A receptor 7 OS=Rattus norvegicus 
OX=10116 GN=Epha7 PE=1 SV=1
Length=998

 Score = 63.3 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/217 (17%), Positives = 68/217 (31%), Gaps = 34/217 (16%)

Query  113  PPEEPQLSCFRKSPL----------SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            P + P ++C R              + V  EW P +             +         Q
Sbjct  320  PSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTY---RILCKRCSWEQ  376

Query  163  EPCQYSQESQKFSCQLAVPEGDSSFYIVS------------MCVASSVGSKFSKTQTFQG  210
              C            +    G    Y+              +   + V S  S++Q    
Sbjct  377  GEC---VPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGV-SDLSRSQRLFA  432

Query  211  CGILQPDPPANITVTAVARN---PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
               +     A   V+ V +     R + ++WQ+P   + +     +E++Y  +  +  T 
Sbjct  433  AVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPE--HPNGVITEYEIKYYEKDQRERTY  490

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              +K       I++   G  +V Q+RA    G G +S
Sbjct  491  STLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYS  527


> sp|A5HJM1|IL7RA_CALJA Interleukin-7 receptor subunit alpha OS=Callithrix 
jacchus OX=9483 GN=IL7R PE=2 SV=1
Length=459

 Score = 62.5 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 46/285 (16%), Positives = 93/285 (33%), Gaps = 37/285 (13%)

Query  199  GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR  258
            G K    +      I++P+ P +++V        +L VT+   H        L  ++ YR
Sbjct  112  GEKSLTCKNVNVATIVKPEAPFDLSVIYREGANDFL-VTFNTSHLQKKYVKVLMHDVAYR  170

Query  259  -AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQE-EFGQGEWSEWSPE-AMGTP-  314
              +    +    +   +   +         + +++R+   ++ +G WSEWSP     TP 
Sbjct  171  HEKDENNWMHVNLSSTKLTLLQRKLQPKATYEIKVRSIPGDYFKGFWSEWSPSYYFRTPE  230

Query  315  ---WTESRSPPAENEVSTPMQALTTNKDDDNILFR--------DSANATSLPVQDSSSVP  363
                +   +P         + ++        +L++         S       ++     P
Sbjct  231  INNHSGETNPTLLTISILSVLSVVLLVILACVLWKKRIKPIIWPSLPDHKKTLEHLCKKP  290

Query  364  LPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEG----KTSMHP---------PYSL  410
                +V+    +F          +  +   ++A  E     + ++ P         P   
Sbjct  291  SKNLIVSFNPESFLDC-------QIHRVDDIQARDEVEGFLQDTVPPQLEESETQRPGGD  343

Query  411  GQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRS  455
             Q  P  P    V  P      SP    + N S+H+ P     RS
Sbjct  344  VQ-SPSWPSENVVTTPETFGRDSPLRCLAGNVSAHDAPILSSSRS  387


> sp|P35331|NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus 
gallus OX=9031 PE=1 SV=1
Length=1284

 Score = 63.3 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/268 (16%), Positives = 92/268 (34%), Gaps = 28/268 (10%)

Query  51   EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVH  107
            +P    TV W+              G    L + +V   D G Y+C         + +  
Sbjct  548  DPTLIPTVIWLKDNNELPDDERFLVGKDN-LTIMNVTDKDDGTYTCIVNTTLDSVSASAV  606

Query  108  LLVDVPPEEPQLSCFRKSPL----------SNVVCEWGPRSTPSLT-TKAVLLVRKFQNS  156
            L V   P  P +   R +P            ++   W P    +   T  V+      + 
Sbjct  607  LTVVAAPPTPAIIYARPNPPLDLELTGQLERSIELSWVPGEENNSPITNFVIEYEDGLHE  666

Query  157  PAEDFQEPCQYSQESQKFS-CQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGIL  214
            P           Q     S   + +       Y   +   + +G S+ S+          
Sbjct  667  PGVWH------YQTEVPGSHTTVQLKLSPYVNYSFRVIAVNEIGRSQPSEPSEQYLTKSA  720

Query  215  QPDP-PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER-SKTFTTWMVKD  272
             PD  P+N+    +   P  L +TW+    + S+   L++++ +R +     +T+ +V +
Sbjct  721  NPDENPSNVQ--GIGSEPDNLVITWESLKGFQSNGPGLQYKVSWRQKDVDDEWTSVVVAN  778

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
            +    ++    + + + ++++A  + G 
Sbjct  779  V-SKYIVSGTPTFVPYEIKVQALNDLGY  805


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 63/198 (32%), Gaps = 28/198 (14%)

Query  114   PEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             P  P         L ++  EWG P     + T  +L  +   N+   +     +    + 
Sbjct  928   PSPPSFLKITNPTLDSLTLEWGSPTHPNGVLTSYILKFQPINNT--HELGPLVEIRIPAN  985

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGS----KFSKTQTFQGCGILQPDPPANITVTAVA  228
             + S  L      S+ Y       +SVGS               GIL+P   A   V  + 
Sbjct  986   ESSLIL-KNLNYSTRYKFYFNAQTSVGSGSQITEEAVTIMDEAGILRPAVGAG-KVQPLY  1043

Query  229   RNPRWLS---------VTWQD--PHSWNSSFYRLRFELRYRAERSKT-FTTWMVKDLQHH  276
                R ++         ++W+   P           F + Y    SK  +   +V   +  
Sbjct  1044  PRIRNVTTAAAETYANISWEYEGPD-------HANFYVEYGVAGSKEDWKKEIVNGSRSF  1096

Query  277   CVIHDAWSGLRHVVQLRA  294
              V+     G  + V++ A
Sbjct  1097  FVLKGLTPGTAYKVRVGA  1114


> sp|P29318|EPHA3_CHICK Ephrin type-A receptor 3 OS=Gallus gallus 
OX=9031 GN=EPHA3 PE=1 SV=1
Length=983

 Score = 62.9 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 77/223 (35%), Gaps = 22/223 (10%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  P+         ++V+ +W               +   +   +    EPC  +    
Sbjct  324  PPSAPRN-VISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGGSSKICEPCSDNVRFL  382

Query  173  K------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANI  222
                    +    V     + Y   +   + V    + ++ F    I      P P   I
Sbjct  383  PRQTGLTNTTVTVVDLLAHTNYTFEIDAVNGVSDLSTLSRQFAAVSITTNQAAPSP---I  439

Query  223  TVTAVARNPRW-LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD  281
            TV    R  R  +S++WQ+P   + +   L +E++Y  ++ +  +  +++    +  I  
Sbjct  440  TVIRKDRTSRNSVSLSWQEPE--HPNGIILDYEVKYYEKQEQETSYTILRAKSTNVTISG  497

Query  282  AWSGLRHVVQLRAQEEFGQGEWS-----EWSPEAMGTPWTESR  319
                  +V Q+RA+     G  S     E SP++       S+
Sbjct  498  LKPDTTYVFQIRARTAARYGTSSRKFEFETSPDSFSISSENSQ  540


> sp|P13595|NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus 
musculus OX=10090 GN=Ncam1 PE=1 SV=3
Length=1115

 Score = 62.9 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 49/316 (16%), Positives = 106/316 (34%), Gaps = 55/316 (17%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS--------RWAGMGRRLLLRSVQLHDSG  92
            + VTLTC     +   ++ W        S           R       L L+S+Q  D+G
Sbjct  324  EQVTLTCE-ASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAG  382

Query  93   NYSCYRA---GRPAGTVHLLVDVPPE-------------EPQLSCFRKSPLSNVVCEWGP  136
             Y C  +   G+ + +++L     P+             +  ++C   +  S  +  +  
Sbjct  383  EYICTASNTIGQDSQSMYLEFQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRD  442

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                        L+     S  + +  P     E    S        ++ F   +    +
Sbjct  443  GQ----------LLPSSNYSNIKIYNTPSASYLEVTPDS--------ENDFGNYNCTAVN  484

Query  197  SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
             +G +  +        ++Q D P++ ++  V        V + +P +       L+++  
Sbjct  485  RIGQESLEFI------LVQADTPSSPSIDRVEPYSSTAQVQFDEPEA-TGGVPILKYKAE  537

Query  257  YRAERSKTFT----TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
            +++   +++          +++    I       R+ V+L A    G GE S  + E   
Sbjct  538  WKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLGEISA-ATEFKT  596

Query  313  TPWTESRSPPAENEVS  328
             P  E  +P  E ++ 
Sbjct  597  QPVREPSAPKLEGQMG  612


 Score = 43.3 bits (100),  Expect = 0.006, Method: Composition-based stats.
 Identities = 79/468 (17%), Positives = 146/468 (31%), Gaps = 88/468 (19%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAG-----MGRR  80
            P  +    V T   G+ V +TC  V    +AT+ W        S                
Sbjct  407  PKLQGPVAVYTWE-GNQVNITCE-VFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASY  464

Query  81   LLLRSVQLHDSGNYSCYRAGRPAGTVH--LLVDVP-PEEPQLSCFRKSPLSNVVCEWG-P  136
            L +     +D GNY+C    R        +LV    P  P +    +   S    ++  P
Sbjct  465  LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSID-RVEPYSSTAQVQFDEP  523

Query  137  RSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA  195
             +T  +     L  + ++++   E +      ++E+        +     + Y V +   
Sbjct  524  EATGGVPI---LKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAAL  580

Query  196  SSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
            +  G    S    F+   + +P  P          N   +++  QD    +       + 
Sbjct  581  NGKGLGEISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQD----DGGSPIRHYL  636

Query  255  LRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
            ++YRA  S+      +     H ++        + V + A+ + G+      S  A    
Sbjct  637  VKYRALASEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGK------SKAAH---  687

Query  315  WTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSL  374
                                         +FR SA  T++P   S +  L T  + G  +
Sbjct  688  ----------------------------FVFRTSAQPTAIPANGSPTAGLSTGAIVGILI  719

Query  375  AF------------------GTLLCIAIVL--RFKKTWKLRALKEGKTSMHPPYSLGQLV  414
                                G L+CIA+ L  +     K + ++EGK +     S   +V
Sbjct  720  VIFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIV  779

Query  415  PERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNT  462
              R               +P+  G  +T  +      +P  P D + T
Sbjct  780  EVRTE----------EERTPNHDGGKHTEPNETTPLTEPELPADTTAT  817


> sp|P28693|EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus 
OX=9031 GN=EPHB2 PE=1 SV=3
Length=1004

 Score = 62.9 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 71/207 (34%), Gaps = 15/207 (7%)

Query  110  VDVP----PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
            VD+P    P  PQ +       ++++ EW P          V  +              C
Sbjct  318  VDMPCTTIPSAPQ-AVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRC  376

Query  166  QYSQESQKFSCQLAVP------EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPD  217
              + +       L  P          + Y   +   + V  +   +  F    I   Q  
Sbjct  377  GDNVQFAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAA  436

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            P A   +  V+R    ++++W  P     +   L +EL+Y  +      +  VK   +  
Sbjct  437  PSAVSIMHQVSRTVDSITLSWSQPDQ--PNGVILDYELQYYEKNLSELNSTAVKSPTNTV  494

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             + +  +G  +V Q+RA+   G G +S
Sbjct  495  TVQNLKAGTIYVFQVRARTVAGYGRYS  521


> sp|Q8TDY8|IGDC4_HUMAN Immunoglobulin superfamily DCC subclass 
member 4 OS=Homo sapiens OX=9606 GN=IGDCC4 PE=1 SV=1
Length=1250

 Score = 62.9 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 78/422 (18%), Positives = 134/422 (32%), Gaps = 43/422 (10%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK-PAAG  68
                A   A L     PA   A   L+     +    C     E    + W+    P   
Sbjct  319  TRDFATAAAELRVLAAPAITQAPEALSRTRASTARFVC-RASGEPRPALRWLHNGAPLRP  377

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLV----DVPPEEPQLSC  121
            +   +  G G  L++  + L D+G Y C     AG       L V     +P    +++ 
Sbjct  378  NGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASLAVVVREGLPSAPTRVTA  437

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
               S  + +V    P           L  +K +     ++Q          +        
Sbjct  438  TPLSSSAVLVAWERPEMHSEQIIGFSLHYQKARGMDNVEYQFAVNNDTTELQVR-----D  492

Query  182  EGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
               ++ Y   +   S +G S+ S          +   P A   ++  + NP  + V W  
Sbjct  493  LEPNTDYEFYVVAYSQLGASRTSTPALVHTLDDV---PSAAPQLSLSSPNPSDIRVAWLP  549

Query  241  -PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
             P S ++    +++++ Y   +     +  V+  +   +++       + V++ A    G
Sbjct  550  LPPSLSNGQ-VVKYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVRISAGTAAG  608

Query  300  QGEWSEWSPEAMGTPW----TESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLP  355
             G  S+W      TP     +     PAE +V   M++L             S      P
Sbjct  609  FGAPSQWMH--HRTPSMHNQSHVPFAPAELKVQAKMESLVV-----------SWQPPPHP  655

Query  356  VQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVP  415
             Q S    L    V     A G  L      +      +R  K+ K      Y L QLVP
Sbjct  656  TQISG-YKLYWREVGAEEEANGDRLPGGRGDQAWDVGPVRLKKKVKQ-----YELTQLVP  709

Query  416  ER  417
             R
Sbjct  710  GR  711


 Score = 37.1 bits (84),  Expect = 0.40, Method: Composition-based stats.
 Identities = 17/91 (19%), Positives = 35/91 (38%), Gaps = 7/91 (8%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSS---FYRLRFELRYRAERSKTFTTWMVKDLQ  274
            PP+++ ++ +   P  + + W  P   N     +  L      + E    +T    +   
Sbjct  850  PPSDLRLSPL--TPSTVRLHWCPPTEPNGEIVEYLILYSSNHTQPEH--QWTLLTTQGNI  905

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                +H   S  R+  ++ A+ E G G +S 
Sbjct  906  FSAEVHGLESDTRYFFKMGARTEVGPGPFSR  936


> sp|O88786|I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 
OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
Length=383

 Score = 61.7 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 52/171 (30%), Gaps = 13/171 (8%)

Query  132  CEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI--  189
            C W P  T    T   +           D    C    +  + +    +   DSS Y   
Sbjct  149  CSWKPGKTVYSDTNYTMFFWY----EGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDF  204

Query  190  -VSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
             + +  +S +    S    FQ   I++P PP  + ++    N   + + W  P       
Sbjct  205  FICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISV--ENSIDIRMKWSTPGGPIPPR  262

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
                +E+  R E   ++ +    D     +   A         +R +    
Sbjct  263  -CYTYEIVIR-EDDISWES--ATDKNDMKLKRRANESEDLCFFVRCKVNIY  309


 Score = 46.7 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/137 (17%), Positives = 49/137 (36%), Gaps = 10/137 (7%)

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS-FYRLRFELRYRAERSKTFTTWMVKD  272
            ++ +PP +  +        +L + W+ P          L +EL+YR   S ++ T + ++
Sbjct  24   IKVNPPQDFEI-LDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRN  82

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGE--WSEWSPEAMGTPWTESRSPPAENEVSTP  330
            L +     D   G+   ++    E    G    S W   + G     S     ++     
Sbjct  83   LIYK-DGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQD-----  136

Query  331  MQALTTNKDDDNILFRD  347
            M+ +  N       ++ 
Sbjct  137  MKCIYYNWQYLVCSWKP  153


> sp|Q61772|EPHA7_MOUSE Ephrin type-A receptor 7 OS=Mus musculus 
OX=10090 GN=Epha7 PE=1 SV=2
Length=998

 Score = 62.5 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/217 (17%), Positives = 68/217 (31%), Gaps = 34/217 (16%)

Query  113  PPEEPQLSCFRKSPL----------SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            P + P ++C R              + V  EW P +             +         Q
Sbjct  320  PSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTY---RILCKRCSWEQ  376

Query  163  EPCQYSQESQKFSCQLAVPEGDSSFYIVS------------MCVASSVGSKFSKTQTFQG  210
              C            +    G    Y+              +   + V S  S++Q    
Sbjct  377  GEC---VPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGV-SDLSRSQRLFA  432

Query  211  CGILQPDPPANITVTAVARN---PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
               +     A   V+ V +     R + ++WQ+P   + +     +E++Y  +  +  T 
Sbjct  433  AVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPE--HPNGVITEYEIKYYEKDQRERTY  490

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              +K       I++   G  +V Q+RA    G G +S
Sbjct  491  STLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYS  527


> sp|Q810U3|NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=Nfasc 
PE=1 SV=1
Length=1240

 Score = 62.9 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 49/286 (17%), Positives = 95/286 (33%), Gaps = 35/286 (12%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            G +V L C    +P    TV W+          +R       L +  V   D G+Y+C  
Sbjct  536  GTTVQLECRVKHDPSLKLTVSWLKDDEPLYIG-NRMKKEDDSLTIFGVAERDQGSYTCMA  594

Query  99   AGRP---AGTVHLLV------------DVP---PEEPQLSCFRKSPLSNVVCEWGPRSTP  140
            +          +L V             +P   P+ P+          +V   W P    
Sbjct  595  STELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDDN  654

Query  141  SLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSV  198
            +   T  V+   + Q  P                 S   AV        Y   +   + V
Sbjct  655  NSPITDYVVQFEEDQFQPGVWHDHSRF------PGSVNSAVLHLSPYVNYQFRVIAVNEV  708

Query  199  GSKF-SKTQTFQGCGILQPDP-PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            GS   S            P+  P+++      +N   + +TW   ++ ++    LR+ ++
Sbjct  709  GSSHPSLPSERYRTSGAPPESNPSDVKGEGTRKNN--MEITWTPMNATSAFGPNLRYIVK  766

Query  257  YRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
            +R   ++  +    V       V+      + + ++++A+ +FG+G
Sbjct  767  WRRRETRETWN--NVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG  810


> sp|Q90610|NEO1_CHICK Neogenin (Fragment) OS=Gallus gallus OX=9031 
PE=2 SV=1
Length=1443

 Score = 62.9 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 71/221 (32%), Gaps = 13/221 (6%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYS  168
            V +P   P +  +     ++V   W    + +       L   +      +D        
Sbjct  522  VQLPGPAPNIRAYA-GSPTSVTVTWETPLSGNGEIQNYKLYYMEKGQDSEQD--------  572

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
             +    S  +   +  + +    +          ++    +    +    P N+T+ A  
Sbjct  573  VDVAGLSYTITGLKKYTEYSFRVVAYNKHGPGVSTQDVVVRTLSDVPSAAPQNLTLEARN  632

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
                 L   WQ P +   S     +++RYR    K+  T  V   Q   +I     G  +
Sbjct  633  SKSIMLH--WQPPPAGTHSGQITGYKIRYRKVSRKSDVTESVGGTQLFQLIEGLERGTEY  690

Query  289  VVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSPPAENEVS  328
              ++ A    G G  ++W S E   +   ESR P   + + 
Sbjct  691  NFRIAAMTVNGTGPATDWVSAETFESDLDESRVPEVPSSLH  731


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 54/346 (16%), Positives = 98/346 (28%), Gaps = 53/346 (15%)

Query  27   AQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW--AGMGRRLLLR  84
                    LT + G +    C          V W        +  S       G  LL+ 
Sbjct  216  VFVRQPSSLTKVTGQNAVFPC-VAGGFPTPYVRWTKNGEELITEDSERFALRAGGSLLIS  274

Query  85   SVQLHDSGNYSCYRAGR---PAGTVHLLVDVPPEEPQLSCFRKSPLSN-----VVCE---  133
             V   D G Y+C              L V VPPE   L                 CE   
Sbjct  275  DVTEEDVGTYTCIADNENETIEAQAELAVQVPPE--FLKRPANIYAHESMDIVFECEVTG  332

Query  134  -------WGPRSTPSLTTKAVLLVRKFQ-----NSPAEDFQEPCQYSQESQKFS-----C  176
                   W       + +    +V++          +++    C    +           
Sbjct  333  KPTPTVKWVKNGDVVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLI  392

Query  177  QLAVPEGDSSFYIVSMC-VAS-SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL  234
             L +     +    S+    +  +    +            P  P ++  T V  + R++
Sbjct  393  ILDLDVAIPTLPPTSLTSATNDHLAPATTGPL---------PTAPRDVVATLV--STRFI  441

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAER-SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
             +TW+ P S +     L + + Y  E  ++       +  +   +I +      +V ++ 
Sbjct  442  RLTWRTPVS-DPQGDNLTYSIFYTKEGINRERVENTSRPGETQVMIQNLMPETVYVFRVV  500

Query  294  AQEEFGQGEWSEWSPEAMGTPWT---ESRSPPAENEVSTPMQALTT  336
            AQ + G GE S  +P  + T         +P       +P     T
Sbjct  501  AQNKHGHGESS--APLKVATQPEVQLPGPAPNIRAYAGSPTSVTVT  544


 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 62/183 (34%), Gaps = 12/183 (7%)

Query  184   DSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
              ++ Y  S+ V     S   S T       ++   PP ++TV +    PR + V WQ P 
Sbjct  907   PNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPS  966

Query  243   SWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               N     Y + +     AE    +    V   +    I +      +  +++A+   G 
Sbjct  967   EANGKITGYIIYYSTDVNAEIH-DWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGM  1025

Query  301   GEWSEWSPEAMGTPWTES----RSPPAENEVSTPMQALTTNKDDDNILFRDSAN--ATSL  354
             G  SE       TP  ES     +  A        + +    D    L   ++   + + 
Sbjct  1026  GPMSE--AVQFRTPKAESSDKMPNDQASGSAGKGSRPVDVGPDYKPPLSGSNSPHGSPTS  1083

Query  355   PVQ  357
             P+ 
Sbjct  1084  PLD  1086


 Score = 39.8 bits (91),  Expect = 0.063, Method: Composition-based stats.
 Identities = 46/273 (17%), Positives = 85/273 (31%), Gaps = 30/273 (11%)

Query  106  VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP---RSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            V  L DVP   PQ          +++  W P    +     T   +  RK       D  
Sbjct  612  VRTLSDVPSAAPQNLTLEARNSKSIMLHWQPPPAGTHSGQITGYKIRYRKVSR--KSDVT  669

Query  163  EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASS---VGSKFSKTQTFQGCGILQPDPP  219
            E    +Q  Q         E +     +++          S  +         +  P+ P
Sbjct  670  ESVGGTQLFQLIEGLERGTEYNFRIAAMTVNGTGPATDWVSAETFESDLDESRV--PEVP  727

Query  220  ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVI  279
            +++ V  +  +   + V+W  P   N +     + + Y    S    T  V   Q +  I
Sbjct  728  SSLHVRPLVTS---IVVSWTPPE--NQNIVVRGYAIGY-GIGSPHAQTIKVDYKQRYYTI  781

Query  280  HDAWSGLRHVVQLRAQEEFG-------------QGEWSEWSPEAMGTPWTESRSPPAENE  326
             +      +V+ L+A    G               + SE     +  P+T    P     
Sbjct  782  ENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHSDTSEVDLFVINAPYTPVPDPSPMM-  840

Query  327  VSTPMQALTTNKDDDNILFRDSANATSLPVQDS  359
                +QA   + D   I + D++   +  + D+
Sbjct  841  PPVGVQASILSHDTIRITWADNSLPKNQKITDA  873


> sp|O42422|EPHA7_CHICK Ephrin type-A receptor 7 OS=Gallus gallus 
OX=9031 GN=EPHA7 PE=2 SV=1
Length=993

 Score = 62.5 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 77/239 (32%), Gaps = 39/239 (16%)

Query  113  PPEEPQLSCFRKSPL----------SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            P + P ++C R              + V  EW P +             +         Q
Sbjct  320  PSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTY---RILCKRCSWEQ  376

Query  163  EPCQYSQESQKFSCQLAVPEGDSSFYIVS------------MCVASSVGSKFSKTQTFQG  210
              C            +    G    Y+              +   + V S  S++Q    
Sbjct  377  GEC---VPCGSNIGYMPQQTGLVDNYVTVMDLLAHANYTFEVEAVNGV-SDLSRSQRLFA  432

Query  211  CGILQPDPPANITVTAVARN---PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
               +     A   V+ V +     R + ++WQ+P   + +     +E++Y  +  +  T 
Sbjct  433  AVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPE--HPNGVITEYEIKYYEKDQRERTY  490

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS---EWS--PEAMGTPWTESRSP  321
              VK       I++   G  +V Q+RA    G G +S   + +   EA  T  +  ++P
Sbjct  491  STVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATATAVSSEQNP  549


> sp|Q810U4|NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus 
musculus OX=10090 GN=Nrcam PE=1 SV=2
Length=1256

 Score = 62.5 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 91/276 (33%), Gaps = 23/276 (8%)

Query  40   GDSVTLTCPGVEPEDNAT-VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY-  97
            G  V+  C           + W+       +   R++     L++  V+  D G Y+C  
Sbjct  554  GSKVSFECRVKHDHTLIPTIMWLKDNGELPND-ERFSTDKDHLVVSDVKDDDGGTYTCTA  612

Query  98   --RAGRPAGTVHLLVDVP----------PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK  145
                   + +  L V  P          P  P           +V   W P    +    
Sbjct  613  NTTLDSASASAVLRVVAPTPTPAPIYDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPIT  672

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
              ++  +     A  ++   + S           +       Y   +   +S+G   S  
Sbjct  673  KFIIEYEDAMHDAGLWRHQAEVSGTQT----TAQLKLSPYVNYSFRVMAENSIG--RSMP  726

Query  206  QTFQGCGILQP-DPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
                   + +  +P  N + V  +   P  L +TW+  + + S+   L++++ +R +   
Sbjct  727  SEASEQYLTKAAEPDQNPMAVEGLGTEPDNLVITWKPLNGFQSNGPGLQYKVSWRQKDGD  786

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
               T +V       ++    + + ++++++A  + G
Sbjct  787  DEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVG  822


> sp|P68500|CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 
PE=1 SV=2
Length=1098

 Score = 62.1 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 53/317 (17%), Positives = 99/317 (31%), Gaps = 22/317 (7%)

Query  6    CALLAALLAAPGAALAPRRCPA-QEVARGVLTSLPGDSVTLTCPGV-EPEDNATVHWVLR  63
            C  +    +A   A    + P   E+         G+S+ L C  + +   + T +W L+
Sbjct  550  CQGVNIFGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDASLDVTFYWTLK  609

Query  64   KP-----AAGSHPS--RWAGMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVP  113
                     G H    R       L++R++ L  +G Y C     A   +    LLV  P
Sbjct  610  GQPIDFEKEGGHFENIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVRGP  669

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P  P +    +   S     W P +      +   L  R   +   +   +         
Sbjct  670  PGPPGVVIVEEITESTATLSWSPATDNHSPISSYNLQARSPFSLGWQT-VKTVPEVITGD  728

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQP-DPPANITVTAVARN  230
              S  +AV       Y   +   + +G+   S            P   P+N  V+  +  
Sbjct  729  MESA-MAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTNEAVPKTAPSN--VSGRSGR  785

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSGLR  287
               L + W+       +     + + +R   ++ +   MV   +    I+          
Sbjct  786  RHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPLTP  845

Query  288  HVVQLRAQEEFGQGEWS  304
              V++      G G +S
Sbjct  846  FEVKVGVYNNKGDGPFS  862


> sp|P97527|CNTN5_RAT Contactin-5 OS=Rattus norvegicus OX=10116 
GN=Cntn5 PE=1 SV=1
Length=1099

 Score = 62.1 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 99/319 (31%), Gaps = 26/319 (8%)

Query  6    CALLAALLAAPGAALAPRRCPA-QEVARGVLTSLPGDSVTLTCPGV-EPEDNATVHWVLR  63
            C  +    +A   A    + P   E+         G+S+ L C  + +   + T +W L+
Sbjct  551  CQGVNIFGSAEIIASVSVKEPTRIELTPKRTELTVGESIVLNCKAMHDSSLDVTFYWTLK  610

Query  64   KP-----AAGSH--PSRWAGMGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVP  113
                     G H    R       L++R++ L  +G Y C     A   +    LLV  P
Sbjct  611  GQPIDFEKEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVRGP  670

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P  P +    +   S     W P +      +   L  R   +   +   +         
Sbjct  671  PGPPGVVIVEEITESTATLSWSPATDNHSPISSYNLQARSPFSLGWQT-VKTVPEVITGD  729

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQP-DPPANITVTAVARN  230
              S  +AV       Y   +   + +G+   S            P   P+N++      +
Sbjct  730  MESA-MAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTNEAVPKTAPSNVS----GGS  784

Query  231  PRW--LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSG  285
             R   L + W+       +     + + +R   ++ +   MV        I+        
Sbjct  785  GRRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSDASKFIYRDESVPPL  844

Query  286  LRHVVQLRAQEEFGQGEWS  304
                V++      G G +S
Sbjct  845  TPFEVKVGVYNNKGDGPFS  863


> sp|Q2EY13|PRTGB_DANRE Protogenin B (Fragment) OS=Danio rerio 
OX=7955 GN=prtgb PE=2 SV=1
Length=1069

 Score = 62.1 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 46/313 (15%), Positives = 96/313 (31%), Gaps = 23/313 (7%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P+        T     +   +C   E      + W        +   R      +L++  
Sbjct  312  PSLVEKPESQTRPRAGTARFSCQ-AEGTPTPQITWFKNGEVIRT-NGRTKMYNNKLVITQ  369

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLV---DVPPEEPQLSCFRKSPLSNVVCEW-GPRS  138
            +   D   Y C      G    T  L+V   +  P  P+         S ++  W  P+ 
Sbjct  370  IIPEDDAFYQCLAENSQGSVVSTSRLIVVQSENRPSAPRNIHAETISSSAILLAWERPQY  429

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
                     +   K +    E++Q            +  +      +  Y   +    ++
Sbjct  430  NADKVIAYSIHYMKSEGLNNEEYQA-----VIGNDTTSHIVDDLEPARNYTFYIVAYMAM  484

Query  199  GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD-PHSWNSSFYRLRFELRY  257
            G+     Q       L+  P     ++  +R+P  + V+WQ  P   +       + L Y
Sbjct  485  GASRMSEQV--TRHTLEDVPLRTPELSLTSRSPTDILVSWQPLPPKLSRGRVSA-YRLSY  541

Query  258  RAERSKTFTTWMV---KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP  314
            R    +   +  +    +     ++ D      +++++      G  + S WS  +  TP
Sbjct  542  RTATDEQVNSVELPVSGENGTQYLLQDLQPDTIYLIRMSVSTRVGWSQPSAWS--SHRTP  599

Query  315  WTESRSPPAENEV  327
             T S + P    +
Sbjct  600  KTSSATVPPAPNL  612


 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 47/292 (16%), Positives = 88/292 (30%), Gaps = 31/292 (11%)

Query  25   CPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS-RWAGMGRRLLL  83
             P        ++      V L C   E      V W           +    G G  L++
Sbjct  220  KPLIIAGPQNISVALHQPVVLEC-LAEGNPRPLVSWSRADSKPIDVSAASVLGNGN-LMI  277

Query  84   RSVQLHDSGNYSCYRA-------GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP  136
             +V+ H SG Y C             AG V +L     E+P+     ++  +   C    
Sbjct  278  SAVKAHHSGTYVCRATTPGTRNYTTAAGNVTVLPPSLVEKPESQTRPRAGTARFSC----  333

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                   T  +   +       E  +   +    + K      +PE D +FY       +
Sbjct  334  -QAEGTPTPQITWFK-----NGEVIRTNGRTKMYNNKLVITQIIPE-DDAFY--QCLAEN  384

Query  197  SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            S GS  S ++        +P  P NI    +  +   + + W+ P         + + + 
Sbjct  385  SQGSVVSTSRLIVVQSENRPSAPRNIHAETI--SSSAILLAWERPQYNADK--VIAYSIH  440

Query  257  Y---RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            Y       ++ +    + +     ++ D      +   + A    G    SE
Sbjct  441  YMKSEGLNNEEYQAV-IGNDTTSHIVDDLEPARNYTFYIVAYMAMGASRMSE  491


 Score = 43.6 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 34/108 (31%), Gaps = 7/108 (6%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            PP +    A A +   + ++W  P    SS   + F +RY        ++          
Sbjct  710  PPPD-HTHAKANSSSAVHLSWGRPA--FSSGKPVTFSVRYGPASPSEASSVRYIQTSEQT  766

Query  278  V-IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAE  324
            V +       R+   +R      Q   S WS         E+   P E
Sbjct  767  VMVTGLQPNTRYEFAVR--LHMDQMS-SPWSATVYQRTLLEAPMSPPE  811


> sp|Q69Z26|CNTN4_MOUSE Contactin-4 OS=Mus musculus OX=10090 GN=Cntn4 
PE=1 SV=2
Length=1026

 Score = 62.1 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 46/309 (15%), Positives = 92/309 (30%), Gaps = 22/309 (7%)

Query  30   VARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRK-----PAAGSHPSRWAG--MGRRL  81
            V    +    G+S+ L C    +   +    W            G H  R  G      L
Sbjct  502  VPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFNGHLIDFDKDGDHFERVGGQDSAGDL  561

Query  82   LLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
            ++R++QL  +G Y C       + +    L+V  PP  P+     +   +     W P  
Sbjct  562  MIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGP  621

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
                     ++  +   S             + + F+  +         Y      A+ +
Sbjct  622  DNHSPITMYVIQARTPFSVGWQAVNTVPDLVDGKTFTATVVGLNPWVE-YEFRTVAANVI  680

Query  199  GSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            G    S+    +      P+  PAN  V+    +   L +TW+       +     + + 
Sbjct  681  GIGEPSRPSEKRRTEEALPEVTPAN--VSGGGGSKSELVITWETVPEELQNGRGFGYVVA  738

Query  257  YRAERSKTFTTWMVKDLQHHCVIHD---AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT  313
            +R      +   ++        +             V++      G+G +S   P  +  
Sbjct  739  FRPHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFS---PTTLVY  795

Query  314  PWTESRSPP  322
               E  + P
Sbjct  796  SAEEEPTKP  804


 Score = 46.3 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 37/300 (12%), Positives = 82/300 (27%), Gaps = 33/300 (11%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM---GRRLLLRSVQLHDSGNYSC  96
            G  V + C   +P+ +    +  RK       +    +   G   ++   +  D+G+Y+C
Sbjct  422  GGEVVIEC---KPKASPRPVYTWRKGREILRENERITISEDGNLRIINVTK-SDAGSYTC  477

Query  97   YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS  156
                           +  +  ++     S    V        +  L  +           
Sbjct  478  IATNHFGTASSTGNVIVKDPTKVMVPPSSMDVTV------GESIVLPCQVT-HDHSLDIV  530

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG----  212
                F        +      ++   +      I ++ +  +         +         
Sbjct  531  FTWTFNGHLIDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAAD  590

Query  213  -ILQ--PDPPANITVTAVARNPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTW  268
             I++  P PP  +T+  +      L  +W+  P + +       + ++ R   S  +   
Sbjct  591  LIVRGPPGPPEAVTIDEITDTTAQL--SWRPGPDNHSP---ITMYVIQARTPFSVGWQAV  645

Query  269  M-----VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                  V        +      + +  +  A    G GE S  S E   T        PA
Sbjct  646  NTVPDLVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPS-EKRRTEEALPEVTPA  704


> sp|P97685|NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 
GN=Nfasc PE=1 SV=2
Length=1240

 Score = 62.1 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 49/286 (17%), Positives = 95/286 (33%), Gaps = 35/286 (12%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
            G +V L C    +P    TV W+          +R       L +  V   D G+Y+C  
Sbjct  536  GTTVQLECRVKHDPSLKLTVSWLKDDEPLYIG-NRMKKEDDSLTIFGVAERDQGSYTCMA  594

Query  99   AGRP---AGTVHLLV------------DVP---PEEPQLSCFRKSPLSNVVCEWGPRSTP  140
            +          +L V             +P   P+ P+          +V   W P    
Sbjct  595  STELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDDN  654

Query  141  SLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSV  198
            +   T  V+   + Q  P                 S   AV        Y   +   + V
Sbjct  655  NSPITDYVVQFEEDQFQPGVWHDHSKF------PGSVNSAVLHLSPYVNYQFRVIAVNEV  708

Query  199  GSKF-SKTQTFQGCGILQPDP-PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            GS   S            P+  P+++      +N   + +TW   ++ ++    LR+ ++
Sbjct  709  GSSHPSLPSERYRTSGAPPESNPSDVKGEGTRKNN--MEITWTPMNATSAFGPNLRYIVK  766

Query  257  YRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
            +R   ++  +    V       V+      + + ++++A+ +FG+G
Sbjct  767  WRRRETRETWN--NVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG  810


> sp|Q2VWP9|PRTG_RAT Protogenin OS=Rattus norvegicus OX=10116 GN=Prtg 
PE=2 SV=1
Length=1193

 Score = 61.7 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 44/301 (15%), Positives = 86/301 (29%), Gaps = 25/301 (8%)

Query  58   VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP  114
            + W+       S   R      +L++  +   D   Y C      G       L V +  
Sbjct  353  MSWLKNGRRIHS-NGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSE  411

Query  115  EEP----QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
            + P     +     S  + ++    P           +   K +    E++Q        
Sbjct  412  DRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQV-----VL  466

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVAR  229
                +  +       S Y   +     +G+   S   T      +   PP    ++  +R
Sbjct  467  GNDTTHYIIDDLEPDSNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPE---ISLTSR  523

Query  230  NPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
            +P  + ++W   P  +      L + L +R     +     +    H  ++        +
Sbjct  524  SPTDILISWLPIPAKYRRGQVVL-YRLSFRLSTENSIQVVELPGTVHEYLLEGLEPDSVY  582

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWT----ESRSPPAENEVSTPMQALTTNKDDDNIL  344
            +V++ A    G GE S W   +  TP        +SP    E             D    
Sbjct  583  LVRITAATRVGLGESSVW--TSHRTPKATSVKAPKSPELHLEPLNCTTISVRWLQDTEDP  640

Query  345  F  345
             
Sbjct  641  A  641


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 45/314 (14%), Positives = 95/314 (30%), Gaps = 38/314 (12%)

Query  7    ALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA  66
            ++ A+L   P         P    +   +T+    +V L C          + W      
Sbjct  211  SMEASLTIVPANETRSFYMPTIIASPQNVTASLHQTVVLEC-MATGYPKPIISWSRLDHK  269

Query  67   AGSH-PSRWAGMGRRLLLRSVQLHDSGNYSCYRA-----GRPAGTVHLLVDVPP---EEP  117
            +     +R  G G  L++  V+L  +G Y C                L V  PP   E P
Sbjct  270  SIDVFNTRVLGNGN-LIISDVKLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWP  328

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQ  177
            +     ++  +  VC+                  +   SP   + +  +    + +    
Sbjct  329  ESLTRPRAGTARFVCQ-----------------AEGIPSPKMSWLKNGRRIHSNGRIKMY  371

Query  178  LAVPEGDSSFY----IVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
             +    +        I      +S GS  S+ +        +P  P N+    +  +   
Sbjct  372  NSKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSEDRPSAPYNVHAETM--SSSA  429

Query  234  LSVTWQDPHSWNSSFYRLRFELRYRAER--SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ  291
            + + W+ P   +     + + + Y      +      ++ +   H +I D      +   
Sbjct  430  ILLAWERPLYNSDK--VIAYSVHYMKAEGLNNEEYQVVLGNDTTHYIIDDLEPDSNYTFY  487

Query  292  LRAQEEFGQGEWSE  305
            + A    G  + S+
Sbjct  488  IVAYMPMGASQMSD  501


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 32/193 (17%), Positives = 64/193 (33%), Gaps = 28/193 (15%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY---RAERSKTFTTWMVKDLQ  274
            PP  + VT +        V+W+ P          R+ + Y   +A  +  +     +   
Sbjct  817  PPVGVKVTLIE--DDTALVSWKPPD--GPETVVTRYTILYASRKAWIAGEWQVLHREGAI  872

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQAL  334
               ++ +  +G  ++V++ A  E G+G                    P  N V   +   
Sbjct  873  TMALLENLVAGNVYIVKISASNEVGEG--------------------PFPNSVELAVLPK  912

Query  335  TTNKDDDNILFRDSANATSLP-VQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWK  393
              ++ +      DS++A             +    V  G      L+C+ I++   K  K
Sbjct  913  DASESNQRPKRLDSSDAKVYSGYYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKARK  972

Query  394  LRALKEGKTSMHP  406
              A K  ++   P
Sbjct  973  SSASKTTQSGTQP  985


> sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 
GN=Neo1 PE=1 SV=1
Length=1377

 Score = 61.7 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 35/222 (16%), Positives = 76/222 (34%), Gaps = 14/222 (6%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYS  168
            V +P   P +  +  +  +++   W    + +       L   +      +D        
Sbjct  505  VQLPGPAPNIRAYA-TSPTSITVTWETPLSGNGEIQNYKLYYMEKGTDKEQD--------  555

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
             +    S  +   +  + +    +          ++    +    +    P N+++    
Sbjct  556  VDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTLSDVPSAAPQNLSLEV--  613

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            RN + + + WQ P S   +     +++RYR A R    T  +V   Q   +I     G  
Sbjct  614  RNSKSIVIHWQPPSSATQNGQITGYKIRYRKASRKSDVTETVVTGTQLSQLIEGLDRGTE  673

Query  288  HVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSPPAENEVS  328
            +  ++ A    G G  ++W S E   +   ESR P   + + 
Sbjct  674  YNFRVAALTVNGTGPATDWLSAETFESDLDESRVPEVPSSLH  715


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 61/183 (33%), Gaps = 12/183 (7%)

Query  184   DSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
              ++ Y  S+ V     S   S T       ++   PP ++TV +    PR + V WQ P 
Sbjct  891   PNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPS  950

Query  243   SWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               N     Y + +     AE    +    V   +    I +      +  +++A+   G 
Sbjct  951   EANGKITGYIIYYSTDVNAEIH-DWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGM  1009

Query  301   GEWSEWSPEAMGTPWTES----RSPPAENEVSTPMQALTTNKDDDNILFRDSAN--ATSL  354
             G  SE       TP  +S     +  A        +      D    +   ++   + + 
Sbjct  1010  GPMSE--AVQFRTPKADSSDKMPNDQALGSAGKGGRLPDLGSDYKPPMSGSNSPHGSPTS  1067

Query  355   PVQ  357
             P+ 
Sbjct  1068  PLD  1070


> sp|Q8BYI9|TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr 
PE=1 SV=2
Length=1358

 Score = 61.7 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 47/115 (41%), Gaps = 14/115 (12%)

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
            + YIV++      G+  S+         +  DPP NIT++ V ++   L+V+W  P +  
Sbjct  838  TEYIVNLVAVH--GTVTSEPIVGSITTGI--DPPKNITISNVTKDS--LTVSWSSPVAPF  891

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV---QLRAQEE  297
                   + + YR  +     + +V +      I   +    + +    +R +EE
Sbjct  892  DY-----YRVSYRPTQVGRLDSSVVPNTVTEFAITRLYPATEYEISLNSVRGREE  941


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 62/192 (32%), Gaps = 28/192 (15%)

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
            EW P        K   ++ K+     E  +   +      ++S Q   P    S Y VS+
Sbjct  523  EWTPPRA-----KVDFILLKYGLVGGEGGKTTFRLQPPLSQYSVQALRP---GSRYEVSI  574

Query  193  CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                  G+  S+  + Q    +  D P N+ V +       L + W +  +         
Sbjct  575  SAV--RGTNESEASSTQFTTEI--DAPKNLRVGSRTATS--LDLEWDNSEAEAQE-----  623

Query  253  FELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            +++ Y     + +   +V           + D   G  + V + A         S+ S  
Sbjct  624  YKVVYSTLAGEQYHEVLVPKGIGPTTKTTLTDLVPGTEYGVGISAVMN------SKQSIP  677

Query  310  AMGTPWTESRSP  321
            A     TE  SP
Sbjct  678  ATMNARTELDSP  689


> sp|Q92823|NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo 
sapiens OX=9606 GN=NRCAM PE=1 SV=3
Length=1304

 Score = 61.7 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 47/298 (16%), Positives = 94/298 (32%), Gaps = 35/298 (12%)

Query  21   APRRCPAQEVARGVLTSLPGDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGR  79
               + P   V         G  V+  C    +   + TV W+       S          
Sbjct  547  WIVKQPEYAVV------QRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDH  600

Query  80   RLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVP----------PEEPQLSCFRKSP  126
             L++  V   DSG Y+C         + +  L V  P          P  P         
Sbjct  601  -LVVADVSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQL  659

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
              +V   W P    +      ++         ED            + S      +   S
Sbjct  660  DKSVQLSWTPGDDNNSPITKFII-------EYEDAMHKPGLWHHQTEVSGTQTTAQLKLS  712

Query  187  FYIV---SMCVASSVGSKFSKTQTFQGCGILQ-PDPPANIT-VTAVARNPRWLSVTWQDP  241
             Y+     +   +S+G   S         + +  +P  N T V  +   P  L +TW+  
Sbjct  713  PYVNYSFRVMAVNSIGK--SLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPL  770

Query  242  HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
            + + S+   L++++ +R +      T +V       ++    + + ++++++A  + G
Sbjct  771  NGFESNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMG  828


 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 41/279 (15%), Positives = 88/279 (32%), Gaps = 23/279 (8%)

Query  57   TVHWVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDV  112
            T+ W      +  H           L +   Q   +G Y+C    + G     VHL +  
Sbjct  485  TIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKD  544

Query  113  PP---EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
            P    ++P+ +  ++  + +  C    +   +L+   + L    +    E F     +  
Sbjct  545  PTWIVKQPEYAVVQRGSMVSFEC--KVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLV  602

Query  170  ESQ---KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTA  226
             +      S        +++   VS     SV +               P+PP ++ +T 
Sbjct  603  VADVSDDDSGTYTCV-ANTTLDSVSASAVLSVVAPTPTPAPVYDV----PNPPFDLELT-  656

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK--TFTTWMVKDLQHHCVIHDAWS  284
              +  + + ++W      NS     +F + Y     K   +                   
Sbjct  657  -DQLDKSVQLSWTPGDDNNSPI--TKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLKLSP  713

Query  285  GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
             + +  ++ A    G+   SE S + +       ++P A
Sbjct  714  YVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTA  752


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 60/195 (31%), Gaps = 22/195 (11%)

Query  114   PEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             P  P         L ++  EW P S P  + T+  L  +        +          + 
Sbjct  952   PSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYTLKYQPIN--STHELGPLVDLKIPAN  1009

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGS----KFSKTQTFQGCGILQPD------PPANI  222
             K    L      S+ Y       +S GS          T    GIL PD         N 
Sbjct  1010  KTRWTL-KNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQAVNP  1068

Query  223   TVTAV--ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT-FTTWMVKDLQHHCVI  279
              ++ +  A    + +++W+           + F + Y    SK  +   +V   +    +
Sbjct  1069  RISNLTAAAAETYANISWEYEG---PEH--VNFYVEYGVAGSKEEWRKEIVNGSRSFFGL  1123

Query  280   HDAWSGLRHVVQLRA  294
                  G  + V++ A
Sbjct  1124  KGLMPGTAYKVRVGA  1138


> sp|Q62845|CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 
GN=Cntn4 PE=1 SV=1
Length=1026

 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 46/309 (15%), Positives = 92/309 (30%), Gaps = 22/309 (7%)

Query  30   VARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRK-----PAAGSHPSRWAG--MGRRL  81
            V    +    G+S+ L C    +   +    W            G H  R  G      L
Sbjct  502  VPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFNGHLIDFDKDGDHFERVGGQDSAGDL  561

Query  82   LLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
            ++R++QL  +G Y C       + +    L+V  PP  P+     +   +     W P  
Sbjct  562  MIRNIQLKHAGKYVCMVQTSVDKLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGP  621

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
                     ++  +   S             + + F+  +         Y      A+ +
Sbjct  622  DNHSPITMYVIQARTPFSVGWQAVSTVPELVDGKTFTATVVGLNPWVE-YEFRTVAANVI  680

Query  199  GSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            G    S+    +      P+  PAN  V+    +   L +TW+       +     + + 
Sbjct  681  GIGEPSRPSEKRRTEEALPEVTPAN--VSGGGGSKSELVITWETVPEELQNGRGFGYVVA  738

Query  257  YRAERSKTFTTWMVKDLQHHCVIHD---AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT  313
            +R      +   ++        +             V++      G+G +S   P  +  
Sbjct  739  FRPHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFS---PTTLVY  795

Query  314  PWTESRSPP  322
               E  + P
Sbjct  796  SAEEEPTKP  804


 Score = 46.0 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 38/300 (13%), Positives = 83/300 (28%), Gaps = 33/300 (11%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM---GRRLLLRSVQLHDSGNYSC  96
            G  V + C   +P+ +    +  RK       +    +   G   ++   +  D+G+Y+C
Sbjct  422  GGEVVIEC---KPKASPRPVYTWRKGREILRENERITISEDGNLRIINVTK-SDAGSYTC  477

Query  97   YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNS  156
                           V  +  ++     S    V        +  L  +           
Sbjct  478  IATNHFGTASSTGNVVVKDPTKVMVPPSSMDVTV------GESIVLPCQVT-HDHSLDIV  530

Query  157  PAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG----  212
                F        +      ++   +      I ++ +  +         +         
Sbjct  531  FTWTFNGHLIDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSAAAD  590

Query  213  -ILQ--PDPPANITVTAVARNPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTW  268
             I++  P PP  +T+  +      L  +W+  P + +       + ++ R   S  +   
Sbjct  591  LIVRGPPGPPEAVTIDEITDTTAQL--SWRPGPDNHSP---ITMYVIQARTPFSVGWQAV  645

Query  269  -----MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                 +V        +      + +  +  A    G GE S  S E   T        PA
Sbjct  646  STVPELVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPS-EKRRTEEALPEVTPA  704


> sp|P36335|NCA12_XENLA Neural cell adhesion molecule 1-B OS=Xenopus 
laevis OX=8355 GN=ncam1-b PE=2 SV=1
Length=1092

 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 57/367 (16%), Positives = 117/367 (32%), Gaps = 56/367 (15%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
            L  + A P             V            +TLTC     +   ++ W        
Sbjct  296  LLKVYAKPKMTYVE---NKTTVELD--------EITLTCE-ASGDPIPSITWRTAHRNIS  343

Query  69   SHPSRWAGMG--------RRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEE-  116
            S      G            L L+ +Q  D+G Y C  +   G     ++  V   P+  
Sbjct  344  SEEKTLDGHIVVKDHIRMSALTLKDIQYTDAGEYFCVASNPIGVDMQAMYFEVQYAPKIR  403

Query  117  -PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFS  175
             P +    +    N+ C        +  + AV   R  Q  P+ +F    +        S
Sbjct  404  GPVVVYTWEGNPVNITC-----DVLAHPSAAVSWFRDGQLLPSSNFSN-IKIYNGPTFSS  457

Query  176  CQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
             ++  P+ ++ F   +    +S+G + S+        ++Q D P++  +  V      + 
Sbjct  458  LEVN-PDSENDFGNYNCSAVNSIGHESSEFI------LVQADTPSSPAIRKVEPYSSTVM  510

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTFT----TWMVKDLQHHCVIHDAWSGLRHVVQ  291
            + + +P +       L+++  +R    + +            +    +        ++V+
Sbjct  511  IVFDEPDA-TGGVPILKYKAEWRVVGQEKWHARYYDAKEVSAESIITVTGLKPETSYMVK  569

Query  292  LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM----QALTTNKDDDNILFRD  347
            L A    G G+          TP  +  + P + E S P      +   N    +I+ +D
Sbjct  570  LSAVNGKGLGD---------STPSQDFTTQPVKGEPSAPKLVGHLSEDGNSIKVDIIKQD  620

Query  348  SANATSL  354
               +   
Sbjct  621  DGGSPIR  627


 Score = 36.7 bits (83),  Expect = 0.56, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 39/110 (35%), Gaps = 8/110 (7%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSGNYSC--  96
            +SV L+C   +   +  + W+ +         + +       + +  V+  D   YSC  
Sbjct  226  ESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNEDKSEMTIYRVEKEDEAEYSCIA  284

Query  97   -YRAGRPAGTVHLLVDVPPEEP--QLSCFRKSPLSNVVCEWGPRSTPSLT  143
              +AG     V L V   P+    +     +     + CE      PS+T
Sbjct  285  NNQAGEAEAIVLLKVYAKPKMTYVENKTTVELDEITLTCEASGDPIPSIT  334


> sp|Q9N3X8|SDK_CAEEL Protein sidekick homolog OS=Caenorhabditis 
elegans OX=6239 GN=rig-4 PE=1 SV=2
Length=2325

 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 59/308 (19%), Positives = 104/308 (34%), Gaps = 29/308 (9%)

Query  35   LTSLPGDSVTLTCP-GVEPEDNATVHWVLRK---PAAGSHPSRWAGMGR-RLLLRSVQLH  89
              SL G +V  +C    E    A+V W L     P  G+   R +   +  L++R V   
Sbjct  556  QKSLIGTNVEFSCEVAKEYVRKASVEWYLNDVLLPVNGNSGLRISRNRKGSLIIRQVGPD  615

Query  90   DSGNYSCYRA----GRPAGTVHLLVDVPPEEPQLSCFRKSP--LSNVVCEWGPRSTPSLT  143
            ++G Y C          A  +  +++ P    ++     +    + V   W      +  
Sbjct  616  NTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMPAKVRVRWNEGFDGNEP  675

Query  144  T---KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSFYIVSMCVASSVG  199
                   +         ++         +E  K  C   + +   SS     +  ++  G
Sbjct  676  IIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTDIEDLRPSSTAEFRVVASNKHG  735

Query  200  -SKFSKTQTFQGCGILQPDP---PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              K S         + Q  P   P N+  +A  R+P  + V WQ P     S   L + +
Sbjct  736  PGKPSLPSY--SVTMPQQPPSAAPRNVAASA--RSPHSVMVQWQQPKEELDSGDVLGYVV  791

Query  256  RYR--AERSKTFTTWMVKDLQHHCVIHD-AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
            RYR     S T+    +        + D   +   + +Q+ A  + G G +SE S E   
Sbjct  792  RYRLAGYSSLTWNEKNLTTKDARNTLVDELITWREYEIQVAAYNKRGLGVFSE-SIEV--  848

Query  313  TPWTESRS  320
            T      +
Sbjct  849  TTSEGRPT  856


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/242 (14%), Positives = 72/242 (30%), Gaps = 20/242 (8%)

Query  104   GTVHLLVDVPPEEPQLSCFRKSPLSN-VVCEWGPRSTP---SLTTKAVLLVRKFQNSPAE  159
                   +   P+ P    F +   +  +   W P             +++ R+  +   +
Sbjct  1146  SRSFETLQTNPDTPSQRLFAEPVSATSISVSWTPLLATHWNGQPKGYLIVYREIDDENWK  1205

Query  160   DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDP  218
             + + P      + + S          + Y V++   +  G    + +   +    +    
Sbjct  1206  EVRTP------ALRSSEHTVTDLRPFTSYEVNVFSENGFGRSLPTDSVKARTYESVPSGS  1259

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS-----KTFTTWMVKDL  273
             P NI VTA         + W      +++   + ++LR   ER      +T    +    
Sbjct  1260  PRNIVVTAEGSKAAI--IKWNPVAELSTNGDVIGYKLRVVPERESLMADETKVIDIPGQS  1317

Query  274   QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQA  333
                  + D      + V + A    G G   E S         +  +PP   + S   + 
Sbjct  1318  TLMAKVSDLRPFTSYHVYMSAYTIVGNGP--ENSTPISFETMEDVPAPPESFQCSYISEQ  1375

Query  334   LT  335
               
Sbjct  1376  EV  1377


 Score = 42.9 bits (99),  Expect = 0.008, Method: Composition-based stats.
 Identities = 31/243 (13%), Positives = 62/243 (26%), Gaps = 38/243 (16%)

Query  126   PLSNVVC-----------EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
             P  +  C              P S     T  ++   K     +     P          
Sbjct  1363  PPESFQCSYISEQEVRMKWLPPGSPNGKITNYIISYWKSHEPRSMAIDAPL-----LGNL  1417

Query  175   SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP--DPPANITVTAVARNPR  232
                 A+    ++ Y  ++   +S G             +  P  + PA +  T       
Sbjct  1418  LMFAAMSLNPNTQYTFAIKARNSKGESEEAVAEVMTSSVRLPVRNAPAPVRDTLSQHQAT  1477

Query  233   WLSVTW--QDPH--SWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWSGL  286
              + + W    P   + ++       ++ Y+      + T     +  +   VI       
Sbjct  1478  EIIIRWDESLPRKLTEDAESPVRAVQVSYQKTNEDEWITLEKKFEYSKRRSVIKHLSPNS  1537

Query  287   RHVVQLRAQEEFGQGEW---SEW------SPEAM-----GTPWTESRSPPAENEVSTPMQ  332
                 ++R   +F +  W   SEW      +P A       TP+  +              
Sbjct  1538  MFRFRIRFIGDFLESSWSPESEWMRTLPSAPFAQPISLKATPYERNSVQLEWVVPHKSTW  1597

Query  333   ALT  335
                
Sbjct  1598  NSD  1600


 Score = 37.9 bits (86),  Expect = 0.28, Method: Composition-based stats.
 Identities = 52/389 (13%), Positives = 102/389 (26%), Gaps = 76/389 (20%)

Query  16   PGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA  75
            P  +         +  + +  +   D + + C          + W+L      +   ++ 
Sbjct  449  PFTSELEPSQKLIKTPKDLTVASGTDRIMMEC-AATGSPPPNIIWLLNGHEIQTDNVKYD  507

Query  76   GMGRRLLLRSVQLHDSGNYSCYRAGR---------PAGTVHLLVDVPPEEPQL-------  119
                 L +  ++  D G Y+C  +G            G   +    P ++  L       
Sbjct  508  LTNDGLAIHDIRKSDEGEYTCEISGSNVKATANVQVNGDSLIEYG-PADQKSLIGTNVEF  566

Query  120  SCF-RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
            SC   K  +     EW       L       +R  +N                 ++ C++
Sbjct  567  SCEVAKEYVRKASVEWYLNDVL-LPVNGNSGLRISRNRKGSLIIRQVGPDNT-GEYRCRV  624

Query  179  AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN-PRWLSVT  237
             V                  G + + +   Q   I +P  P  +         P  + V 
Sbjct  625  TVD-----------------GREENASAMLQI--IEKPAMPERVRAELHNETMPAKVRVR  665

Query  238  WQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMV---------KDLQHHCVIHDAWSGLR  287
            W +    N     ++  +  R       ++ W                   I D      
Sbjct  666  WNEGFDGNEPI--IKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTDIEDLRPSST  723

Query  288  HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRD  347
               ++ A  + G G                  S P+ + V+ P Q  +    +     R 
Sbjct  724  AEFRVVASNKHGPG----------------KPSLPSYS-VTMPQQPPSAAPRNVAASARS  766

Query  348  SANATSLPVQDSSSVPLPTFLVAGGSLAF  376
                 S+ VQ          L +G  L +
Sbjct  767  ---PHSVMVQWQQPKE---ELDSGDVLGY  789


> sp|Q589G5|PRTG_CHICK Protogenin OS=Gallus gallus OX=9031 GN=PRTG 
PE=2 SV=1
Length=1187

 Score = 61.0 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/299 (14%), Positives = 86/299 (29%), Gaps = 25/299 (8%)

Query  58   VHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP  114
            + W+       S   R      +L++  +   D   Y C      G       L V +  
Sbjct  350  ISWLKNGRRIHS-NGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSE  408

Query  115  EEP----QLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
            + P     +     S  + ++    P           +   K +    E++Q        
Sbjct  409  DRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQV-----VI  463

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVAR  229
                +  +      +S Y   +     +G+   S   T      +    P    ++  +R
Sbjct  464  GNDTTHYIIDDLEPASNYTFYIVAYMPLGASQMSDHVTQHTLEDVPLRAPE---ISLTSR  520

Query  230  NPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
            +P  + ++W   P  +      L + L +R           +       ++        +
Sbjct  521  SPTDILISWLPIPAKYRRGQVVL-YRLSFRLSTDSKIQVLELPGTSDEYLLEGLRPDSVY  579

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWT----ESRSPPAENEVSTPMQALTTNKDDDNI  343
            +V++ A    G GE S W   +  TP        +SP    E           + D + 
Sbjct  580  LVRITAATRIGWGEASLW--TSHRTPKATSVKAPKSPELRLEPINCTTITVQWQQDSDD  636


 Score = 59.1 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 49/331 (15%), Positives = 99/331 (30%), Gaps = 35/331 (11%)

Query  16   PGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH-PSRW  74
            P + L P   PA       +T+    +V L C          + W      +     +R 
Sbjct  217  PASDLKPFHKPAIIAGPQNVTASLHQTVILEC-VATGNPKPIISWSRLDHKSIDVFNTRV  275

Query  75   AGMGRRLLLRSVQLHDSGNYSCYRA-----GRPAGTVHLLVDVPP---EEPQLSCFRKSP  126
             G G  L++  V++  +G Y C                L V  PP   E P+     ++ 
Sbjct  276  LGNGN-LMISDVKVQHAGVYVCRATIPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAG  334

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
             +   C         +    +  ++  +   +    +           S  +        
Sbjct  335  TARFAC-----QAEGIPAPKISWLKNGRRIHSNGRIKMY--------NSKLVINQIIPED  381

Query  187  FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
              I      +S GS  S+ +        +P  P N+    +  +   + + W+ P   + 
Sbjct  382  DAIYQCMAENSQGSVLSRARLTVVMSEDRPSAPYNVHAETM--SSSAILLAWERPLYNSD  439

Query  247  SFYRLRFELRYRAER--SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
                + + + Y      +      ++ +   H +I D      +   + A    G  + S
Sbjct  440  K--VIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLEPASNYTFYIVAYMPLGASQMS  497

Query  305  EWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
            +       T  T    P    E+S   ++ T
Sbjct  498  D-----HVTQHTLEDVPLRAPEISLTSRSPT  523


 Score = 38.6 bits (88),  Expect = 0.16, Method: Composition-based stats.
 Identities = 17/91 (19%), Positives = 37/91 (41%), Gaps = 7/91 (8%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS---KTFTTWMVKDLQ  274
            PP  + VT +        V+W+ P          R+ + Y + +S     +     +   
Sbjct  814  PPVGVKVTLIE--DDTALVSWKPPD--GPETVVTRYTILYASRKSWIAGEWQVLHREGAM  869

Query  275  HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
               ++ +  +G  ++V++ A  E G+G +S 
Sbjct  870  TMALLENLVAGNVYLVKIAASNEVGEGPFSN  900


 Score = 33.6 bits (75),  Expect = 4.8, Method: Composition-based stats.
 Identities = 29/244 (12%), Positives = 73/244 (30%), Gaps = 25/244 (10%)

Query  89   HDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP-RSTPSLTTKAV  147
             ++  ++ +R  +            P+ P+L     +  + +  +W       +      
Sbjct  592  GEASLWTSHRTPKATSV------KAPKSPELRLEPIN-CTTITVQWQQDSDDTAAIQGYK  644

Query  148  LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS-----SVGSKF  202
            L  ++         QE      ++      ++  +    +++  +   +           
Sbjct  645  LYYKEEGQ------QENGPILLDASDLEYTVSGLDPRRKYHVRLLAYNNMEEGYQADQTV  698

Query  203  SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS  262
            S          + P PP    + A A     + + W  P    +S   + + +R      
Sbjct  699  STPGCVSVRDRMVPPPPPPHHLYAKANTSSSIYLHWGKPA--FTSAQVINYTIRCNPVGL  756

Query  263  KTFTTWM-VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
            +  +  + ++  + H ++        +   +R      Q   S WSP    T   E+ S 
Sbjct  757  QNASLVLYLQTSETHMLVQGLEPKTMYEFAVR--LHVDQLS-SPWSPVVYHTTLPEAPSG  813

Query  322  PAEN  325
            P   
Sbjct  814  PPVG  817


> sp|P54757|EPHA5_RAT Ephrin type-A receptor 5 OS=Rattus norvegicus 
OX=10116 GN=Epha5 PE=1 SV=1
Length=1005

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 67/204 (33%), Gaps = 18/204 (9%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLL-------VRKFQNSPAEDFQEPC  165
            PP  P+ +       ++V  EW P +                                  
Sbjct  359  PPSAPRNA-ISNVNETSVFLEWIPPADTGGGKDVSYYILCKKCNSHAGVCEECGGHVRYL  417

Query  166  QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPAN  221
                  +  S  +A P    + Y   +   + V      T+ +    +      P P  N
Sbjct  418  PQQIGLKNTSVMMADPLAH-TNYTFEIEAVNGVSDLSPGTRQYVSVNVTTNQAAPSPVTN  476

Query  222  ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD  281
            +    +A+N   +S++WQ+P     +   L +E++Y  +  +T  T  +K  +       
Sbjct  477  VKKGKIAKNS--ISLSWQEPD--RPNGIILEYEIKYFEKDQETSYTI-IKSKETTITAEG  531

Query  282  AWSGLRHVVQLRAQEEFGQGEWSE  305
                  +V Q+RA+   G G +S 
Sbjct  532  LKPASVYVFQIRARTAAGYGVFSR  555


> sp|P54763|EPHB2_MOUSE Ephrin type-B receptor 2 OS=Mus musculus 
OX=10090 GN=Ephb2 PE=1 SV=3
Length=986

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 70/207 (34%), Gaps = 15/207 (7%)

Query  110  VDVP----PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
            +D+P    P  PQ +       ++++ EW P          V  +              C
Sbjct  317  LDMPCTTIPSAPQ-AVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRC  375

Query  166  QYSQESQKFSCQLAVP------EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPD  217
              + +       L  P          + Y   +   + V  +   +  F    I   Q  
Sbjct  376  GDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAA  435

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            P A   +  V+R    ++++W  P     +   L +EL+Y  +    +    +K   +  
Sbjct  436  PSAVSIMHQVSRTVDSITLSWSQPDQ--PNGVILDYELQYYEKELSEYNATAIKSPTNTV  493

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             +    +G  +V Q+RA+   G G +S
Sbjct  494  TVQGLKAGAIYVFQVRARTVAGYGRYS  520


> sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase 
delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
Length=1912

 Score = 61.0 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 79/461 (17%), Positives = 146/461 (32%), Gaps = 61/461 (13%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV +TC          V W+L             G   R +L  
Sbjct  236  PRFSIPPTNHEIMPGGSVNITC-VAVGSPMPYVKWMLGAEDLTPEDDMPIG---RNVLEL  291

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G       + V   P+ P      +S  +++   W   +    
Sbjct  292  NDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPE--  349

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
                 ++  K +NS  E ++E       + ++S     P  D   Y   +   +++G   
Sbjct  350  PVSYYIIQHKPKNSE-ELYKEI--DGVATTRYSVAGLSPYSD---YEFRVVAVNNIGRGP  403

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---  258
             S+    Q         P ++    +  +   + V W++P     +     + + Y    
Sbjct  404  PSEPVLTQTSEQAPSSAPRDVQARML--SSTTILVQWKEPE--EPNGQIQGYRVYYTMDP  459

Query  259  AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE--WSPEAMGTP--  314
             +    +    V D Q    I +      + V++ A    G G  S         G P  
Sbjct  460  TQHVNNWMKHNVADSQI-TTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQ  518

Query  315  ----WTESRSPPAENEVSTPMQALTTNKDDDNILFRDS----------ANATSLPVQDSS  360
                  E  S  +     TP ++ T    +  ++++D              TS  +Q   
Sbjct  519  PLNFKAEPESETSILLSWTPPRSDTI--ANYELVYKDGEHGEEQRITIEPGTSYRLQGLK  576

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVP-ERPR  419
               L  F +A  S               +      A    +T    P +  Q +    P 
Sbjct  577  PNSLYYFRLAARS--------------PQGLGASTAEISARTMQSKPSAPPQDISCTSPS  622

Query  420  PTPVLVPLISPPV-SPSSLGSDNTSSHNRPDARDPRSPYDI  459
             T +LV    PPV   + + ++ +  +   D  D + P++I
Sbjct  623  STSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDK-PHEI  662


 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/195 (13%), Positives = 58/195 (30%), Gaps = 10/195 (5%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
                P +P+L     + ++  + +W P        +   L    ++       E  +  +E
Sbjct  821   GAVPGKPRL-VINHTQMNTALIQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSE--KE  877

Query  171   SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
                 +  +         Y+  +   + VG      +       +    P N+        
Sbjct  878   DHFTATDIHKGAS----YVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTST  933

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT-WMVKDLQHHCVIHDAWSGLRHV  289
                + ++WQ P     +    ++ L YR           ++        +        + 
Sbjct  934   S--VQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYD  991

Query  290   VQLRAQEEFGQGEWS  304
             V++RA    G G +S
Sbjct  992   VKVRAHTSKGPGPYS  1006


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 40/295 (14%), Positives = 90/295 (31%), Gaps = 53/295 (18%)

Query  79   RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV-PPEEPQLSCFRKSPLSNVVCEWGPR  137
            +   ++ +     G       G  +  + ++     P +P          ++++  W P 
Sbjct  486  KTYSVKVLAFTSIG------DGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP  539

Query  138  STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASS  197
                  T A   +        E+ +         +  +         +S Y   +   S 
Sbjct  540  R---SDTIANYELVYKDGEHGEEQR------ITIEPGTSYRLQGLKPNSLYYFRLAARSP  590

Query  198  --VGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
              +G+  ++          +P  PP +I+ T+   +   L V+WQ P     +     + 
Sbjct  591  QGLGASTAEISARTMQS--KPSAPPQDISCTS-PSSTSIL-VSWQPPPVEKQNGIITEYS  646

Query  255  LRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
            ++Y A   +      +  +       ++        + + + A  + G G      PE++
Sbjct  647  IKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPG------PESL  700

Query  312  GT---PWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVP  363
                    +  S P       P +               + N+TS+ V   S VP
Sbjct  701  SVLIRTNEDVPSGP-------PRKVEVE-----------AVNSTSVKVSWRSPVP  737


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 33/207 (16%), Positives = 66/207 (32%), Gaps = 25/207 (12%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTKAVLLVRKFQNSPAE--------  159
            DVP   P+         ++V   W    P           +   + +N   +        
Sbjct  709  DVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDV  768

Query  160  ---DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQ  215
               D Q     + E       +       + Y +++   ++ G    SK +     G + 
Sbjct  769  MLADAQWEFDDTTEHD----MIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAV-  823

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P  P  + +     N     + W  P   ++      + L++  +  +  TT    + + 
Sbjct  824  PGKPR-LVINHTQMNTAL--IQWHPP--VDTFGPLQGYRLKFGRKDMEPLTTLEFSEKED  878

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGE  302
            H    D   G  +V +L A+ + G GE
Sbjct  879  HFTATDIHKGASYVFRLSARNKVGFGE  905


> sp|P29323|EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens 
OX=9606 GN=EPHB2 PE=1 SV=5
Length=1055

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 70/207 (34%), Gaps = 15/207 (7%)

Query  110  VDVP----PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPC  165
            +D+P    P  PQ +       ++++ EW P          V  +              C
Sbjct  317  LDMPCTTIPSAPQ-AVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRC  375

Query  166  QYSQESQKFSCQLAVP------EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPD  217
              + +       L  P          + Y   +   + V  +   +  F    I   Q  
Sbjct  376  GDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAA  435

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            P A   +  V+R    ++++W  P     +   L +EL+Y  +    +    +K   +  
Sbjct  436  PSAVSIMHQVSRTVDSITLSWSQPDQ--PNGVILDYELQYYEKELSEYNATAIKSPTNTV  493

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWS  304
             +    +G  +V Q+RA+   G G +S
Sbjct  494  TVQGLKAGAIYVFQVRARTVAGYGRYS  520


> sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase 
F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
Length=1907

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 49/327 (15%), Positives = 97/327 (30%), Gaps = 33/327 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV LTC  V       V W++             G   R +L  
Sbjct  232  PRFSIPPSSQEVMPGGSVNLTCVAVGAP-MPYVKWMMGAEELTKEDEMPVG---RNVLEL  287

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G    T  + V   P+ P      ++  ++V   W        
Sbjct  288  SNVVRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSG-NSEP  346

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
             T   +  R    +   +          + ++S     P  +   Y   +   +S+G   
Sbjct  347  VTYYGIQYR----AAGTEGPFQEVDGVATTRYSIGGLSPFSE---YAFRVLAVNSIGRGP  399

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
             S+    +        PP  +    ++ +     V W+ P     +     + + Y  + 
Sbjct  400  PSEAVRARTGEQAPSSPPRRVQARMLSASTML--VQWEPPE--EPNGLVRGYRVYYTPDS  455

Query  262  SK---TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES  318
             +    +      D      +     G+ + +++ A    G G      P +        
Sbjct  456  RRPPNAWHKHN-TDAGLLTTVGSLLPGITYSLRVLAFTAVGDG------PPSPTIQVKTQ  508

Query  319  RSPPAENEVSTPMQALTTNKDDDNILF  345
            +  PA+       QA   +     + +
Sbjct  509  QGVPAQ---PADFQAEVESDTRIQLSW  532


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 47/301 (16%), Positives = 87/301 (29%), Gaps = 28/301 (9%)

Query  78   GRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV-PPEEPQLSCFRKSPLSNVVCEWGP  136
            G    LR +     G       G P+ T+ +      P +P          + +   W  
Sbjct  481  GITYSLRVLAFTAVG------DGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWL-  533

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                 L  +  +++ +     AED  E  Q+       S          + Y   +   S
Sbjct  534  -----LPPQERIIMYELVYWAAED--EDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARS  586

Query  197  SVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
             +G                P  PP    V  V+     + V+W  P + + +    ++ +
Sbjct  587  DMGVGVFTPTIEARTAQSTPSAPPQ--KVMCVSMGSTTVRVSWVPPPADSRNGVITQYSV  644

Query  256  RYRAERSKTFTTWMVKDLQ---HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
             Y A   +     +V  +        +        + V +RA  + G G  S  SP  + 
Sbjct  645  AYEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPES--SPVLVR  702

Query  313  TPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA-----NATSLPVQDSSSVPLPTF  367
            T       PP + EV               +  +          T + +++     LP  
Sbjct  703  TDEDVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPII  762

Query  368  L  368
             
Sbjct  763  Q  763


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 52/319 (16%), Positives = 98/319 (31%), Gaps = 37/319 (12%)

Query  44   TLTCPGVEPEDNATVHWVLR----KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA  99
             L   G  P+    + W        PA  +   +    G  L + S +  D G Y C   
Sbjct  154  MLCAAGGNPD--PEISWFKDFLPVDPATSNGRIKQLRSGA-LQIESSEESDQGKYECVAT  210

Query  100  GRPAGT----VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
                       +L V V    P+ S    S          P  + +LT  AV     +  
Sbjct  211  NSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEV------MPGGSVNLTCVAVGAPMPYVK  264

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                  +   +      +   +L+     +++   +    SS+G   +   T Q      
Sbjct  265  WMMGAEELTKEDEMPVGRNVLELSNVVRSANY---TCVAISSLGMIEA---TAQVTVKAL  318

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P PP ++ VT        +++TW   +S   ++    + ++YRA  ++     +      
Sbjct  319  PKPPIDLVVTETTATS--VTLTWDSGNSEPVTY----YGIQYRAAGTEGPFQEVDGVATT  372

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
               I        +  ++ A    G+G  SE           ++ S P        +QA  
Sbjct  373  RYSIGGLSPFSEYAFRVLAVNSIGRGPPSE---AVRARTGEQAPSSP-----PRRVQARM  424

Query  336  TNKDDDNILFRDSANATSL  354
             +     + +        L
Sbjct  425  LSASTMLVQWEPPEEPNGL  443


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/208 (17%), Positives = 63/208 (30%), Gaps = 17/208 (8%)

Query  154  QNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCG  212
              + A+   E  +  + +              + Y V++   ++ G    SK +     G
Sbjct  766  MLAEAQWRPEESEDYETTISG-------LTPETTYSVTVAAYTTKGDGARSKPKIVTTTG  818

Query  213  ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
             +   P   I+ TA+        + W  P         L + L+Y         T     
Sbjct  819  AVPGRPTMMISTTAMNTAL----LQWHPPKELPGE--LLGYRLQYCRADEARPNTIDFGK  872

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQ  332
               H  +     G  ++ +L A+   G GE  E+  E   TP       P    V+    
Sbjct  873  DDQHFTVTGLHKGTTYIFRLAAKNRAGLGE--EFEKEI-RTPEDLPSGFPQNLHVTGLTT  929

Query  333  ALTTNKDDDNILFRDSANATSLPVQDSS  360
            + T    D  +L   +    S  V    
Sbjct  930  STTELAWDPPVLAERNGRIISYTVVFRD  957


> sp|Q99650|OSMR_HUMAN Oncostatin-M-specific receptor subunit beta 
OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
Length=979

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/251 (13%), Positives = 73/251 (29%), Gaps = 19/251 (8%)

Query  105  TVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
             + L V    EEP+           + C W P +  +L                   ++ 
Sbjct  228  GIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKL  287

Query  165  CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV  224
            C +     K  C   + +     Y  ++   + +  +      F     +    P ++  
Sbjct  288  CTH-----KNWCNWQITQDSQETYNFTLIAENYLRKRSVNIL-FNLTHRVYLMNPFSVNF  341

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
              V      +  TW+       + +    ++    E         +  +     + +   
Sbjct  342  ENVNATNAIM--TWKVHSI--RNNFTYLCQIELHGEGKMMQYNVSI-KVNGEYFLSELEP  396

Query  285  GLRHVVQLRAQEEFGQGEWSEWSPEAMGT-PWTESRSPPAENEVST-PMQALTTNKDDDN  342
               ++ ++R  +     +WSEWS +   T     S +P     VS  P     T      
Sbjct  397  ATEYMARVRCADASHFWKWSEWSGQNFTTLEAAPSEAPDVWRIVSLEPGNHTVT------  450

Query  343  ILFRDSANATS  353
            + ++  +   +
Sbjct  451  LFWKPLSKLHA  461


> sp|P16872|IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il7r PE=1 SV=2
Length=459

 Score = 59.8 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/157 (18%), Positives = 60/157 (38%), Gaps = 9/157 (6%)

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
                  I S  +   +G K    +      I++ + P+++ V        +L VT+  PH
Sbjct  96   TSEFLLIGSSNICVKLGQKNLTCKNMAINTIVKAEAPSDLKVVYRKEANDFL-VTFNAPH  154

Query  243  SWNSSFYRLRFELRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE--FG  299
                   +++ ++ YR  R ++ +T   +   +             + +++R+     + 
Sbjct  155  LKKKYLKKVKHDVAYRPARGESNWTHVSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYF  214

Query  300  QGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
            +G WSEWSP +      E+  P  +     P+    T
Sbjct  215  KGFWSEWSPSST----FETPEPKNQGG-WDPVLPSVT  246


> sp|H2A0L7|FND1_PINMG Fibronectin type III domain-containing protein 
1 OS=Margaritifera margaritifera OX=102329 PE=1 SV=1
Length=754

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 54/195 (28%), Gaps = 16/195 (8%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
            D+ P  P       +  +     W P +     T   +   +          +P      
Sbjct  354  DLIPSAPLNLKLEGTKPNAFAVSWDPPTVKGTLTNYTIYATEESGKATMVTIDP------  407

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVAR  229
              K +        + + Y + +  +S  G S  S+           P  P N+   A+  
Sbjct  408  --KLTSYALYNLYEGTMYTIRIAASSDNGMSPKSEPLEVT-TDKFIPMAPRNVR--AIDN  462

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
            N   +++ W  P           + + Y  + +      +         I +      + 
Sbjct  463  NLTSVTLEWDAPLPGR--GMIRGYRINYTLDFTDYEEMLISDPSITTATITNLTPATEYY  520

Query  290  VQL--RAQEEFGQGE  302
             Q+  R  +  G G 
Sbjct  521  FQVFARTMKRLGYGS  535


> sp|P54755|EPHA5_CHICK Ephrin type-A receptor 5 OS=Gallus gallus 
OX=9031 GN=EPHA5 PE=2 SV=1
Length=1013

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 73/203 (36%), Gaps = 16/203 (8%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQY-----  167
            PP  P+ S       ++V  EW P +           +   + +      E C       
Sbjct  333  PPSAPR-SAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHSGLCEACGSHVRYL  391

Query  168  -SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANI  222
              Q   K +  + V     + Y   +   + V  +    + F    +      P P +++
Sbjct  392  PQQTGLKNTSVMMVDLLAHTNYTFEIEAVNGVSDQNPGARQFVSVNVTTNQAAPSPVSSV  451

Query  223  TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDA  282
                + +N   +S++WQ+P     +   L +E++Y  +  +T  T  +K  +        
Sbjct  452  KKGKITKNS--ISLSWQEPD--RPNGIILEYEIKYFEKDQETSYTI-IKSKETAITADGL  506

Query  283  WSGLRHVVQLRAQEEFGQGEWSE  305
              G  +V Q+RA+   G G +S 
Sbjct  507  KPGSAYVFQIRARTAAGYGGFSR  529


> sp|Q8IWV2|CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 
PE=1 SV=1
Length=1026

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 49/337 (15%), Positives = 99/337 (29%), Gaps = 27/337 (8%)

Query  30   VARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRK-----PAAGSHPSRWAG--MGRRL  81
            V    +    G+S+ L C    +   +    W            G H  R  G      L
Sbjct  502  VPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDFDRDGDHFERVGGQDSAGDL  561

Query  82   LLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
            ++R++QL  +G Y C       R +    L+V  PP  P+     +   +     W P  
Sbjct  562  MIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGP  621

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSV  198
                     ++  +   S             + + F+  +         Y      A+ +
Sbjct  622  DNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVE-YEFRTVAANVI  680

Query  199  GSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELR  256
            G    S+    +      P+  PAN  V+    +   L +TW+       +     + + 
Sbjct  681  GIGEPSRPSEKRRTEEALPEVTPAN--VSGGGGSKSELVITWETVPEELQNGRGFGYVVA  738

Query  257  YRAERSKTFTTWMVKDLQHHCVIHD---AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT  313
            +R      +   ++        +             V++      G+G +S   P  +  
Sbjct  739  FRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFS---PTTVVY  795

Query  314  PWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
               E  + P  +  +  + A      D  + +     
Sbjct  796  SAEEEPTKPPASIFARSLSAT-----DIEVFWASPLE  827


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 37/299 (12%), Positives = 79/299 (26%), Gaps = 32/299 (11%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSGNYSCY  97
            G+ V    P   P+    V+   +         R      G   ++   +  D+G+Y+C 
Sbjct  423  GEVVIECKPKASPK---PVYTWKKGRDILKENERITISEDGNLRIINVTK-SDAGSYTCI  478

Query  98   RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP  157
                          V  +  ++     S    V        +  L  +            
Sbjct  479  ATNHFGTASSTGNLVVKDPTRVMVPPSSMDVTV------GESIVLPCQVT-HDHSLDIVF  531

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG-----  212
               F               ++   +      I ++ +  +         +          
Sbjct  532  TWSFNGHLIDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADL  591

Query  213  ILQ--PDPPANITVTAVARNPRWLSVTWQD-PHSWNSSFYRLRFELRYRAERSKTFTTW-  268
            I++  P PP  +T+  +      L  +W+  P + +       + ++ R   S  +    
Sbjct  592  IVRGPPGPPEAVTIDEITDTTAQL--SWRPGPDNHSP---ITMYVIQARTPFSVGWQAVS  646

Query  269  ----MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                ++        +      + +  +  A    G GE S  S E   T        PA
Sbjct  647  TVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPS-EKRRTEEALPEVTPA  704


> sp|Q5VTT5|MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 
PE=1 SV=1
Length=1437

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 64/196 (33%), Gaps = 12/196 (6%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            P  P          + +V  W P           +L        +E+        Q    
Sbjct  700  PSAPYGFALLNCGKNEMVIGWKPPKRRG---GGKILGYFLDQHDSEELDWHAVNQQPIPT  756

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCG---ILQPDPPANITVTAVAR  229
              C+++    +  FY      A+  G    S   +   C    + QP PP ++  + V  
Sbjct  757  RVCKVSDLH-EGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRA  815

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRH  288
                L + W+ P    +      + + ++ E S+ +       +   H  + D   G  +
Sbjct  816  TS--LVLQWEPPLYMGAGPVT-GYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY  872

Query  289  VVQLRAQEEFGQGEWS  304
            V Q++A    G G+ S
Sbjct  873  VFQVQAMNSAGLGQPS  888


 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 52/359 (14%), Positives = 99/359 (28%), Gaps = 64/359 (18%)

Query  41   DSVTLTCP-GVEPEDNATVHWVLRKPAA-GSHPSRWAGMGRRLLLRSVQL--HDSGNYSC  96
            +  +L+C    +  D  ++ W         S   +     R+  L+       D G Y  
Sbjct  286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV  345

Query  97   YR----AGRPAGTVHLLVDV------PPEEPQLSCFRKSPLSNVVCEWGPRSTP--SLTT  144
                    R   T  L+ D        P  P            ++  W P S    +  T
Sbjct  346  RVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT  405

Query  145  KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK---  201
               +     +    E  +    +        C +     +   Y   +   S VGS    
Sbjct  406  AYTI-----ERCQGESGEWIACHEAPGGTCRCPIQG-LVEGQSYRFRVRAISRVGSSVPS  459

Query  202  ---------------FSKTQTFQGCGILQ------------PDPPANITVTAVARNPRWL  234
                                 F     +             P PP N+  + +     ++
Sbjct  460  KASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREA--YV  517

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD--LQHHCVIHDAWSGLRHVVQL  292
             + W++P   + +   L + L      S T+     +         + D      +V ++
Sbjct  518  VLAWEEPSPRDRA--PLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRV  575

Query  293  RAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANA  351
            RA  ++G  + SE S           R PPA       +QA    +   ++ +    + 
Sbjct  576  RAMNQYGLSDPSEPSEPIA------LRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP  628


 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 53/371 (14%), Positives = 99/371 (27%), Gaps = 40/371 (11%)

Query  10   AALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
               + +P   +         V        P D   LT   +E     +  W      +  
Sbjct  497  TVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPV  555

Query  70   HPSR----WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKS  125
               R         +  + R   ++  G         P         +PP   Q+  FR +
Sbjct  556  RSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPP-PAQVQAFRDT  614

Query  126  PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
              ++V   W P   P L     +  RK   S  +         +  Q     +       
Sbjct  615  -QTSVSLTWDPVKDPEL-LGYYIYSRKVGTSEWQTVNN-----KPIQGTRFTVPGLRTGK  667

Query  186  SF-YIVSMCVASSVGSKFSKTQTFQGCGIL-QPDPPANITVTAVARNPRWLSVTWQDPHS  243
             + + V     + VG   + T+  +    L  P  P    +    +N   + + W+ P  
Sbjct  668  EYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNE--MVIGWKPPKR  725

Query  244  WNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWSGLRHVVQLRAQEEFGQGE  302
                   L + L         +     + +    C + D   G  +  + RA    G GE
Sbjct  726  -RGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE  784

Query  303  WS---------EWSPEAMGTPWTESR------------SPPAENEVSTPMQALTTNKDDD  341
             S         EW+    G P+                 PP             + +++ 
Sbjct  785  LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEG  844

Query  342  NILFRDSANAT  352
            +  ++      
Sbjct  845  SEQWKPVTPGP  855


> sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase 
F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
Length=1898

 Score = 60.2 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 51/327 (16%), Positives = 98/327 (30%), Gaps = 33/327 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV LTC  V       V W++             G   R +L  
Sbjct  232  PRFSIPPSSQEVMPGGSVNLTCVAVGAP-MPYVKWMMGAEELTKEDEMPVG---RNVLEL  287

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G    T  + V   P+ P      ++  ++V   W   +    
Sbjct  288  SNVMRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGN----  343

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
             T+ V        +   D          S ++S     P  +   Y   +   +S+G   
Sbjct  344  -TEPVSFYGIQYRAAGTDGPFQEVDGVASTRYSIGGLSPFSE---YAFRVLAVNSIGRGP  399

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
             S+    +        PP  +    ++ +     V W+ P     +     + + Y  + 
Sbjct  400  PSEAVRARTGEQAPSSPPRRVQARMLSASTML--VQWEPPE--EPNGLVRGYRVYYTPDS  455

Query  262  SK---TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES  318
             +    +      D      +     G+ + +++ A    G G      P +        
Sbjct  456  RRPLSAWHKHN-TDAGLLTTVGSLLPGITYSLRVLAFTAVGDG------PPSPTIQVKTQ  508

Query  319  RSPPAENEVSTPMQALTTNKDDDNILF  345
            +  PA+       QA   +     + +
Sbjct  509  QGVPAQ---PADFQANAESDTRIQLSW  532


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 43/239 (18%), Positives = 74/239 (31%), Gaps = 18/239 (8%)

Query  183  GDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
               + Y +++   ++ G    SK +     G +   P   ++ TA+        + W  P
Sbjct  779  TPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMMVSTTAMHTAL----LQWHPP  834

Query  242  HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                     L + L+YR        T        H  +     G  +V +L A+   G G
Sbjct  835  KELPGE--LLGYRLQYRRADEARPNTIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPG  892

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSS  361
            E  E+  E   TP       P    V+    + T    D  +L   + + T+  V     
Sbjct  893  E--EFEKEIT-TPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDI  949

Query  362  VPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
                  L    +    TLL     L+   T+ ++              L   +  R  P
Sbjct  950  NSQ-LELQNVTNDTHLTLLG----LKPDTTYDIKVRAHTSKGA---GPLSPSIQSRTMP  1000


 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 51/330 (15%), Positives = 93/330 (28%), Gaps = 30/330 (9%)

Query  51   EPEDNATVH-WVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHL  108
             P+    +  W      AG   +      G    LR +     G       G P+ T+ +
Sbjct  452  TPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVG------DGPPSPTIQV  505

Query  109  LVDV-PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQY  167
                  P +P          + +   W       L  +  ++  +     AED  E  Q+
Sbjct  506  KTQQGVPAQPADFQANAESDTRIQLSWL------LPPQERIVKYELVYWAAED--EGQQH  557

Query  168  SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTA  226
                   S          + Y   +   S +G                P  PP    VT 
Sbjct  558  KVTFDPTSSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQ--KVTC  615

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ---HHCVIHDAW  283
            V+     + V+W  P + + +    ++ + Y A   +     +V  +        +    
Sbjct  616  VSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLE  675

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNI  343
                + V +RA  + G G  S  SP  + T       PP + EV               +
Sbjct  676  KWTEYRVWVRAHTDVGPGPES--SPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPV  733

Query  344  LFRDSA-----NATSLPVQDSSSVPLPTFL  368
              +          T + +++      P   
Sbjct  734  PNKQHGQIRGYQVTYVRLENGEPRGQPIIQ  763


 Score = 49.8 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 54/323 (17%), Positives = 99/323 (31%), Gaps = 36/323 (11%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLR----KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
            G + T+ C       +  + W        PAA +   +    G  L + S +  D G Y 
Sbjct  149  GRTATMLC-AAGGNPDPEISWFKDFLPVDPAASNGRIKQLRSGA-LQIESSEESDQGKYE  206

Query  96   CYRAGRPAGT----VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
            C              +L V V    P+ S    S          P  + +LT  AV    
Sbjct  207  CVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEV------MPGGSVNLTCVAVGAPM  260

Query  152  KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
             +        +   +      +   +L+     +++   +    SS+G   +   T Q  
Sbjct  261  PYVKWMMGAEELTKEDEMPVGRNVLELSNVMRSANY---TCVAISSLGMIEA---TAQVT  314

Query  212  GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
                P PP ++ VT        +++TW    S N+      + ++YRA  +      +  
Sbjct  315  VKALPKPPIDLVVTETTATS--VTLTW---DSGNTEPVSF-YGIQYRAAGTDGPFQEVDG  368

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM  331
                   I        +  ++ A    G+G  SE           ++ S P        +
Sbjct  369  VASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSE---AVRARTGEQAPSSP-----PRRV  420

Query  332  QALTTNKDDDNILFRDSANATSL  354
            QA   +     + +        L
Sbjct  421  QARMLSASTMLVQWEPPEEPNGL  443


 Score = 49.0 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 55/192 (29%), Gaps = 17/192 (9%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
            P   PQ      +  + V   W P        + T+  +     +    ED +       
Sbjct  606  PSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAY---EAVDGEDRKRHVVDGI  662

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANITVTAVA  228
              +  S  L   E   + Y V +   + VG    S     +    +   PP  + V  + 
Sbjct  663  SREHSSWDLLGLEKW-TEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL-  720

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRY------RAERSKTFTTWMVKDLQHHCVIHDA  282
             N   + V+W+ P           +++ Y                 M+ + Q    I   
Sbjct  721  -NSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQ-ETTISGL  778

Query  283  WSGLRHVVQLRA  294
                 + + + A
Sbjct  779  TPETTYSITVAA  790


> sp|Q92752|TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR 
PE=1 SV=3
Length=1358

 Score = 60.2 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 45/115 (39%), Gaps = 14/115 (12%)

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
            + YIV++      G+  S+         +  DPP +IT++ V ++   + V+W  P +  
Sbjct  838  TEYIVNLVAVH--GTVTSEPIVGSITTGI--DPPKDITISNVTKDS--VMVSWSPPVASF  891

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV---QLRAQEE  297
                   + + YR  +     + +V +      I        + +    +R +EE
Sbjct  892  DY-----YRVSYRPTQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREE  941


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 36/192 (19%), Positives = 62/192 (32%), Gaps = 28/192 (15%)

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
            EW P        K   ++ K+     E  +   +      ++S Q   P    S Y VS+
Sbjct  523  EWIPPRA-----KVDFILLKYGLVGGEGGRTTFRLQPPLSQYSVQALRP---GSRYEVSV  574

Query  193  CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                  G+  S + T Q    +  D P N+ V +       L + W +  +         
Sbjct  575  SAV--RGTNESDSATTQFTTEI--DAPKNLRVGSRTATS--LDLEWDNSEAEVQE-----  623

Query  253  FELRYRAERSKTFTTWMVK---DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            +++ Y     + +   +V           + D   G  + V + A         S+ S  
Sbjct  624  YKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGTEYGVGISAVMN------SQQSVP  677

Query  310  AMGTPWTESRSP  321
            A     TE  SP
Sbjct  678  ATMNARTELDSP  689


> sp|Q60ZN5|SDK_CAEBR Protein sidekick homolog OS=Caenorhabditis 
briggsae OX=6238 GN=rig-4 PE=3 SV=1
Length=2322

 Score = 60.2 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 59/309 (19%), Positives = 107/309 (35%), Gaps = 27/309 (9%)

Query  35   LTSLPGDSVTLTCP-GVEPEDNATVHWVLRK---PAAGSHPSRWAGMGR-RLLLRSVQLH  89
              SL G +V  +C    E    ATV W L     P  G+   R +   +  L++R V   
Sbjct  557  QKSLIGTNVEFSCEVAKEYARKATVEWYLNDALLPVNGNSGLRISRNRKGSLIIRQVGPD  616

Query  90   DSGNYSCYRA----GRPAGTVHLLVDVPPEEPQLSCFRKSP--LSNVVCEWGPRSTPSLT  143
            ++G Y C          A  +  +++ P    ++     +    + V   W      +  
Sbjct  617  NTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMPAKVRVRWNEGFDGNEP  676

Query  144  T---KAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DSSFYIVSMCVASSVG  199
                   +         ++         ++  K  C   + +   SS     +  ++  G
Sbjct  677  IIKHAIEIRTMGPTGLWSDWTTAIDNIPKDDGKPCCWADIEDLRPSSTAEFRVVASNKHG  736

Query  200  -SKFSKTQTFQGCGILQPDP---PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              K S   +     + Q  P   P N+  +A  R+P  + V WQ P     S   L + +
Sbjct  737  PGKPSLPSS--SVTMPQQPPSAAPRNVAASA--RSPHSVMVQWQQPKEEQDSGDFLGYVV  792

Query  256  RYR--AERSKTFTTWMVKDLQHHCVIHD-AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
            RYR     S T+    +        + D   +   + +Q+ A  + G G +SE S E   
Sbjct  793  RYRLAGYSSLTWNEKNLTTKDARNTLVDELITWREYEIQVAAYNKRGLGVFSE-SIEVTT  851

Query  313  TPWTESRSP  321
                 +++P
Sbjct  852  AEGRPTQAP  860


 Score = 49.4 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 33/245 (13%), Positives = 71/245 (29%), Gaps = 28/245 (11%)

Query  114   PEEPQLSCFRKSPLSNVVCEWGP-RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             P  P+     +    +V  +W P  S     T  V+         + + +     +Q + 
Sbjct  1362  PAPPESFQCSQISEQDVRMKWLPPGSPNGKITNYVISY-----WKSHEPRSMAIDAQVAG  1416

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP--DPPANITVTAVARN  230
                   A+    ++ Y  ++   +S G             +  P  + PA +  T     
Sbjct  1417  NLLMFSAMSLSPNTQYTFAIKAKNSKGESEEAVAEVMTSSVRLPVRNAPAPVRDTTSQHL  1476

Query  231   PRWLSVTW--QDPH--SWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWS  284
                +++ W    P   + ++       ++ Y+      + T     +  +   VI     
Sbjct  1477  ATEITIRWDESLPRKLTEDAESPVRAVQVSYQKTNEDEWLTLEKKFEYSKRRAVIKHLSP  1536

Query  285   GLRHVVQLRAQEEFGQGEW---SEW------SPEAM-----GTPWTESRSPPAENEVSTP  330
                   ++R   +F +  W   SEW      +P A       TP+  +            
Sbjct  1537  NSMFRFRIRFIGDFLESSWSPESEWMRTLPSAPFAQPISLKATPYERNSVQLEWVVPHKS  1596

Query  331   MQALT  335
                  
Sbjct  1597  TWNSD  1601


 Score = 46.0 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 33/223 (15%), Positives = 67/223 (30%), Gaps = 20/223 (9%)

Query  110   VDVPPEEPQLSCFRKSPLSN-VVCEWGPRSTP---SLTTKAVLLVRKFQNSPAEDFQEPC  165
             +   PE P    F +   +  +   W P             +++ R+      ++ + P 
Sbjct  1153  LQTNPETPSQRLFTEPVSATSISVSWTPLLATHWNGQPKGYLIVYREVDEDNWKEVRTP-  1211

Query  166   QYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANITV  224
                  + + S          + Y V++   +  G    +     +    +    P NI V
Sbjct  1212  -----ALRSSEHTVTDLRPFTTYEVNVFSENVFGRSLPTDAVKARTYESVPSGSPRNIVV  1266

Query  225   TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS-----KTFTTWMVKDLQHHCVI  279
             TA         V W      +++   + ++LR   ER      +T    +         +
Sbjct  1267  TAEGSKSAI--VKWDPVAELSTNGDVIGYKLRVVPERESLMADETREIDVPGQSTLMTKV  1324

Query  280   HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
              +      + V + A    G G   E S         +  +PP
Sbjct  1325  SNLRPFTSYYVYMSAYTIVGNGP--ENSTPLSFETLEDVPAPP  1365


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 54/375 (14%), Positives = 101/375 (27%), Gaps = 71/375 (19%)

Query  16   PGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA  75
            P  +         +  + +  +   D +TL C          + W L      +   ++ 
Sbjct  450  PFTSDIESSQRLTKTPKDLTAASGTDKITLEC-AAAGSPPPHIVWFLNGNGIQTDSVKYD  508

Query  76   GMGRRLLLRSVQLHDSGNYSCYRAGRPA---------GTVHLLVDVPPEEPQL-------  119
                 L +  ++  D G Y+C  +G            G   +    P ++  L       
Sbjct  509  FSNGDLTIHDIRKSDEGEYTCEISGTDVKASANVQVNGDSLIEYG-PADQKSLIGTNVEF  567

Query  120  SCF-RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
            SC   K        EW   +   L       +R  +N                 ++ C++
Sbjct  568  SCEVAKEYARKATVEWYL-NDALLPVNGNSGLRISRNRKGSLIIRQVGPDNT-GEYRCRV  625

Query  179  AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN-PRWLSVT  237
             V                  G + + +   Q   I +P  P  +         P  + V 
Sbjct  626  TVD-----------------GREENASAMLQI--IEKPAMPERVRAELHNETMPAKVRVR  666

Query  238  WQDPHSWNSSFYRLRFELRYRAERSKTFTTW-------MVKDLQHHC--VIHDAWSGLRH  288
            W +    N    +   E+R     +  ++ W          D +  C   I D       
Sbjct  667  WNEGFDGNEPIIKHAIEIRTMGP-TGLWSDWTTAIDNIPKDDGKPCCWADIEDLRPSSTA  725

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDS  348
              ++ A  + G G                  S P+ + V+ P Q  +    +     R  
Sbjct  726  EFRVVASNKHGPG----------------KPSLPS-SSVTMPQQPPSAAPRNVAASARS-  767

Query  349  ANATSLPVQDSSSVP  363
                S+ VQ      
Sbjct  768  --PHSVMVQWQQPKE  780


> sp|P55144|TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 
OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
Length=880

 Score = 59.8 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 64/325 (20%), Positives = 104/325 (32%), Gaps = 78/325 (24%)

Query  16   PGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRK------PAAGS  69
            PG+A A  +      A   +T   G  V L C  VE  ++  +HW+              
Sbjct  26   PGSAAAGLK---LMGAPVKMTVSQGQPVKLNC-SVEGMEDPDIHWMKDGTVVQNASQVSI  81

Query  70   HPSRWAGMGRRLLLRSVQLHDSGNYSCY-RAGR---PAGTVHLLVD-------------V  112
              S  + +G  L L+SV+  D+G Y C  + G     + +V L V+             V
Sbjct  82   SISEHSWIG-LLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAV  140

Query  113  PPEEP-QLSCFRKSPLSNVVCEWGPR--STPSL-TTKAVLLVRKFQNSPAEDFQEPCQYS  168
            PP  P QLSC    P   V   W            + +VL V                  
Sbjct  141  PPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVLNVTGVT--------------  186

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPPANITV  224
             +  +FSC                   +  G   S+        I++    P  P N TV
Sbjct  187  -QRTEFSC----------------EARNIKGLATSRPA------IVRLQAPPAAPFNTTV  223

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA-ERSKTFTTWMVKDLQHHCVIHDAW  283
            T ++      SV W       +  +    ++ +   E         V      C++ +  
Sbjct  224  TTISSYNA--SVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFT--CLLRNLA  279

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSP  308
                + +++R     G   + +W P
Sbjct  280  PATNYSLRVRCANALGPSPYGDWVP  304


> sp|Q92859|NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 
PE=1 SV=2
Length=1461

 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 76/223 (34%), Gaps = 16/223 (7%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYS  168
            V +P   P L  +  S  +++   W    + +       L   +      +D        
Sbjct  536  VQLPGPAPNLRAYAAS-PTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQD--------  586

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT-QTFQGCGILQPDPPANITVTAV  227
             +    S  +   +   + Y   +   +  G   S      +    +    P N+++   
Sbjct  587  VDVSSHSYTINGLKKY-TEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEV-  644

Query  228  ARNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHCVIHDAWSGL  286
             RN + + + WQ P     +     +++RYR A R    T  +V   Q   +I     G 
Sbjct  645  -RNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGT  703

Query  287  RHVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSPPAENEVS  328
             +  ++ A    G G  ++W S E   +   E+R P   + + 
Sbjct  704  EYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLH  746


 Score = 56.4 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 54/281 (19%), Positives = 93/281 (33%), Gaps = 32/281 (11%)

Query  39   PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR--WAGMGRRLLLRSVQLHDSGNYSC  96
             G  V L C         T+ W+  + A  +  S       G  L +  V   D+G Y C
Sbjct  262  IGQDVVLPC-VASGLPTPTIKWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFC  320

Query  97   YRA---GRPAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV  150
                          L V   PE   +P      +S      CE          T  V   
Sbjct  321  IADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVFECE-----VTGKPTPTV---  372

Query  151  RKFQNSPAEDFQEPCQYSQESQKFSCQL-AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQ  209
               +     D   P  Y +  ++ + Q+  + + D  FY       + VG+  +  Q   
Sbjct  373  ---KWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFY--QCIAENDVGNAQAGAQLII  427

Query  210  GCG---ILQPDP--PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER-SK  263
                     P P  P ++  + V  + R++ +TW+ P S +     L + + Y  E  ++
Sbjct  428  LEHAPATTGPLPSAPRDVVASLV--STRFIKLTWRTPAS-DPHGDNLTYSVFYTKEGIAR  484

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
                      +    I +      ++ ++ AQ + G GE S
Sbjct  485  ERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESS  525


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 61/183 (33%), Gaps = 12/183 (7%)

Query  184   DSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
              ++ Y  S+ V     S   S T       ++   PP ++TV +    P+ + V WQ P 
Sbjct  922   PNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPS  981

Query  243   SWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               N     Y + +     AE    +    V   +    I +      +  +++A+   G 
Sbjct  982   EANGKITGYIIYYSTDVNAEIH-DWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGM  1040

Query  301   GEWSEWSPEAMGTPWTES----RSPPAENEVSTPMQALTTNKDDDNILFRDSAN--ATSL  354
             G  SE       TP  +S     +  A        +      D    +   ++   + + 
Sbjct  1041  GPMSE--AVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTS  1098

Query  355   PVQ  357
             P+ 
Sbjct  1099  PLD  1101


> sp|O13146|EPHA3_DANRE Ephrin type-A receptor 3 OS=Danio rerio 
OX=7955 GN=epha3 PE=2 SV=1
Length=981

 Score = 59.4 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 55/184 (30%), Gaps = 19/184 (10%)

Query  130  VVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
            V  EW P             V   + S      E C         +      +   +   
Sbjct  344  VTLEWSPPRDSGGRGDVSYSVHCRKCSGETGASERC---VPCGSGA-HFNPRQFGLTHPR  399

Query  190  VSMCVASSVGSKFSKTQTFQGCGILQPDP----PANIT--------VTAVARNPRWLSVT  237
            V +       +     +   G   L P P      N+T        +         +++ 
Sbjct  400  VLVTELQPHTNYTFSVEALNGVSDLSPSPRQLVSVNVTTSQTVSVILKERKGTDS-VTLA  458

Query  238  WQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE  297
            WQ P   + +   + +E+ Y  +  +     ++K   +   +     G  ++ ++RA+ +
Sbjct  459  WQGPEPVDGT--VVEYEVTYYEKNQQDQNYTVLKTKSNSMTVDGLKPGTTYIFRVRARTD  516

Query  298  FGQG  301
             G G
Sbjct  517  GGYG  520


> sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase 
delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3
Length=1912

 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 72/431 (17%), Positives = 125/431 (29%), Gaps = 55/431 (13%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV +TC          V W+L             G   R +L  
Sbjct  236  PRFSIPPTNHEIMPGGSVNITC-VAVGSPMPYVKWMLGAEDLTPEDDMPIG---RNVLEL  291

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G       + V   P+ P      +S  +++   W   +    
Sbjct  292  NDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPE--  349

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
                 ++  K +NS              + ++S     P  D   Y   +   +++G   
Sbjct  350  PVSYYIIQHKPKNSEE---PYKEIDGIATTRYSVAGLSPYSD---YEFRVVAVNNIGRGP  403

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---  258
             S+    Q         P ++    +  +   + V W++P     +     + + Y    
Sbjct  404  ASEPVLTQTSEQAPSSAPRDVQARML--SSTTILVQWKEPE--EPNGQIQGYRVYYTMDP  459

Query  259  AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE--WSPEAMGTP--  314
             +    +    V D Q    I +      + V++ A    G G  S         G P  
Sbjct  460  TQHVNNWMKHNVADSQI-TTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQ  518

Query  315  ----WTESRSPPAENEVSTPMQALT--------TNKDDDNILFRDSANATSLPVQDSSSV  362
                  E  S  +     TP ++ T         + D            TS  +Q     
Sbjct  519  PLNFKAEPESETSILLSWTPPRSDTIASYELVYRDGDQGEEQRITIEPGTSYRLQGLKPN  578

Query  363  PLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVP-ERPRPT  421
             L  F ++  S               +      A    +T    P +  Q +    P  T
Sbjct  579  SLYYFRLSARS--------------PQGLGASTAEISARTMQSKPSAPPQDISCTSPSST  624

Query  422  PVLVPLISPPV  432
             +LV    PPV
Sbjct  625  SILVSWQPPPV  635


 Score = 52.5 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 91/293 (31%), Gaps = 49/293 (17%)

Query  79   RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDV-PPEEPQLSCFRKSPLSNVVCEWGPR  137
            +   ++ +     G       G  +  + ++     P +P          ++++  W P 
Sbjct  486  KTYSVKVLAFTSIG------DGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP  539

Query  138  STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASS  197
                  T A   +        E+ +         +  +         +S Y   +   S 
Sbjct  540  R---SDTIASYELVYRDGDQGEEQR------ITIEPGTSYRLQGLKPNSLYYFRLSARSP  590

Query  198  --VGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
              +G+  ++          +P  PP +I+ T+   +   L V+WQ P     +     + 
Sbjct  591  QGLGASTAEISARTMQS--KPSAPPQDISCTS-PSSTSIL-VSWQPPPVEKQNGIITEYS  646

Query  255  LRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
            L+Y A   + F    +  +       ++        + + + A  + G G      PE++
Sbjct  647  LKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPG------PESL  700

Query  312  GT-PWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVP  363
                 T+   P        P +               + NAT++ V   S VP
Sbjct  701  SVLIRTDEDVPSGP-----PRKVEVE-----------AVNATAVKVSWRSPVP  737


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 59/195 (30%), Gaps = 10/195 (5%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
                P +P+L     + ++  + +W P        +   L    ++       E  +  +E
Sbjct  821   GAVPGKPRL-VINHTQMNTALIQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSE--KE  877

Query  171   SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
                 +  +         Y+  +   + VG      +       +    P N+        
Sbjct  878   DHFTATDIHKGAS----YVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTST  933

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT-WMVKDLQHHCVIHDAWSGLRHV  289
                + ++WQ P     +    ++ L YR           ++        +    S   + 
Sbjct  934   S--VQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYD  991

Query  290   VQLRAQEEFGQGEWS  304
             V++RA    G G +S
Sbjct  992   VKVRAHTSKGPGPYS  1006


 Score = 39.4 bits (90),  Expect = 0.096, Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 65/207 (31%), Gaps = 25/207 (12%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTKAVLLVRKFQNSPAE--------  159
            DVP   P+         + V   W    P           +   K +N   +        
Sbjct  709  DVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDV  768

Query  160  ---DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQ  215
               D Q     + E       +       + Y +++   ++ G    SK +     G + 
Sbjct  769  MLADAQWEFDDTTEHD----MIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAV-  823

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P  P  + +     N     + W  P   ++      + L++  +  +  TT    + + 
Sbjct  824  PGKPR-LVINHTQMNTAL--IQWHPP--VDTFGPLQGYRLKFGRKDMEPLTTLEFSEKED  878

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGE  302
            H    D   G  +V +L A+ + G GE
Sbjct  879  HFTATDIHKGASYVFRLSARNKVGFGE  905


> sp|Q7Z5N4|SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens OX=9606 
GN=SDK1 PE=2 SV=3
Length=2213

 Score = 59.8 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 62/349 (18%), Positives = 106/349 (30%), Gaps = 29/349 (8%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPS  72
            A+    +  R              + G + TL C    +P  +    W     A     +
Sbjct  564  ASATLTVWNRTSIVH--PPEDHVVIKGTTATLHCGATHDPRVSLRYVWKKDNVALTPSST  621

Query  73   RWAGMGR--RLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQ--LSCFRKS  125
                + +   LL+      D G+YSC      G  +    L V   P  PQ  L     S
Sbjct  622  SRIVVEKDGSLLISQTWSGDIGDYSCEIVSEGGNDSRMARLEVIELPHSPQNLLVSPNSS  681

Query  126  PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
                VV  W      +      ++     NSP +            +     ++      
Sbjct  682  HSHAVVLSWVRPFDGNSPILYYIVELSENNSPWKVHLSN----VGPEMTGVTVSGLTPAR  737

Query  186  SFYIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHS  243
            + Y   +C  + VG     ++T            PP NI  +   R  + + V WQ P  
Sbjct  738  T-YQFRVCAVNEVGRGQYSAETSRLMLPEEPPSAPPKNIVAS--GRTNQSIMVQWQPPPE  794

Query  244  WNSSFYRLRFELRYRAERSK-TFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQG  301
               +     + LRYR       +    +   + ++C++ D     ++ +Q+ A    G G
Sbjct  795  TEHNGVLRGYILRYRLAGLPGEYQQRNITSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLG  854

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
             +S        T +T    P A       +Q    N      L+     
Sbjct  855  VFSR-----AVTEYTLQGVPTA---PPQNVQTEAVNSTTIQFLWNPPPQ  895


 Score = 56.4 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 59/335 (18%), Positives = 101/335 (30%), Gaps = 58/335 (17%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW----AGMGRRLLLRSVQLHDSGNYS  95
            G +  L C  V       + W        S   R           L +  V + D+GNY+
Sbjct  494  GMTAILRCE-VSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQIAPVFIQDAGNYT  552

Query  96   CY---RAGRPAGTVHLLVD------VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
            CY     G    +  L V        PPE+  +    K   + + C  G    P ++ + 
Sbjct  553  CYAANTEGSLNASATLTVWNRTSIVHPPEDHVVI---KGTTATLHC--GATHDPRVSLRY  607

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM---------CVASS  197
            V                  + +      S    V E D S  I            C   S
Sbjct  608  VWK----------------KDNVALTPSSTSRIVVEKDGSLLISQTWSGDIGDYSCEIVS  651

Query  198  VGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
             G   S+    +   +  P  P N+ V+  + +   + ++W  P   NS       EL  
Sbjct  652  EGGNDSRMARLEVIEL--PHSPQNLLVSPNSSHSHAVVLSWVRPFDGNSPILYYIVEL--  707

Query  258  RAERSKTFTTW--MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPW  315
             +E +  +      V        +        +  ++ A  E G+G++S  +  +     
Sbjct  708  -SENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNEVGRGQYS--AETSRLMLP  764

Query  316  TESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
             E  S P +N V     A         + ++    
Sbjct  765  EEPPSAPPKNIV-----ASGRTNQSIMVQWQPPPE  794


 Score = 54.0 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 62/205 (30%), Gaps = 34/205 (17%)

Query  114   PEEPQ--LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
             P  P+  L    +    ++  +W P S  +   +   +  +      E        S E+
Sbjct  1477  PAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRYFTMQVREL-PRGEWQTYSSSISHEA  1535

Query  172   QKFSCQLAVPEGDSSFYIVSMCVASSVGSK--FSKTQTFQGCGILQPDPPANITVTAVAR  229
                +C +       + Y + +   + +G     S+T+       +  +PP +++ T    
Sbjct  1536  --TACVVDR-LRPFTSYKLRLKATNDIGDSDFSSETEAVTTLQDVPGEPPGSVSATPHTT  1592

Query  230   NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK------------------------TF  265
             +   + + WQ P   + +     + + YR    +                        +F
Sbjct  1593  SS--VLIQWQPPRDESLNGLLQGYRIYYRELEYEAGSGTEAKTLKNPIALHAELTAQSSF  1650

Query  266   TTWMVKDLQHHCVIHDAWSGLRHVV  290
              T         C +       R+ V
Sbjct  1651  KTVNSSSTSTMCELTHLKKYRRYEV  1675


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/228 (17%), Positives = 69/228 (30%), Gaps = 21/228 (9%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
             D  P  P    F +  L++V   W P   P  +     +  R               ++ 
Sbjct  1375  DDAPGPPVRLVFPEVRLTSVRIVWQPPEEPNGIILGYQIAYR---------LASSSPHTF  1425

Query  170   ESQKFSCQL----AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL-QPDPPANITV  224
              + +    +    A      S YI  +   +  G       T        +P PP  + V
Sbjct  1426  TTVEVGATVRQFTATDLAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPPRELLV  1485

Query  225   TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW--MVKDLQHHCVIHDA  282
                    R L + W       S      F ++ R      + T+   +      CV+   
Sbjct  1486  PQAEVTARSLRLQWVPGSDGASPIRY--FTMQVRELPRGEWQTYSSSISHEATACVVDRL  1543

Query  283   WSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTP  330
                  + ++L+A  + G  ++S  S     T   +    P  +  +TP
Sbjct  1544  RPFTSYKLRLKATNDIGDSDFS--SETEAVTTLQDVPGEPPGSVSATP  1589


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 72/223 (32%), Gaps = 25/223 (11%)

Query  106   VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST---PSLTTKAVLLVRKF-----QNSP  157
             V  L DVP E P          S+V+ +W P        L     +  R+        + 
Sbjct  1571  VTTLQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELEYEAGSGTE  1630

Query  158   AEDFQEPCQYSQESQKFSCQLAVPEGDSSF------------YIVSMCVASSVG-SKFSK  204
             A+  + P     E    S    V    +S             Y V M   + +G S  S 
Sbjct  1631  AKTLKNPIALHAELTAQSSFKTVNSSSTSTMCELTHLKKYRRYEVIMTAYNIIGESPASA  1690

Query  205   TQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS--  262
                           P N+ VT +      L VTW  P   + +     +++ Y    S  
Sbjct  1691  PVEVFVGEAAPAMAPQNVQVTPLTA--SQLEVTWDPPPPESQNGNIQGYKIYYWEADSQN  1748

Query  263   KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
             +T    ++   +    + +  S  +++V + A    G G  S+
Sbjct  1749  ETEKMKVLFLPEPVVRLKNLTSHTKYLVSISAFNAAGDGPKSD  1791


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/342 (15%), Positives = 109/342 (32%), Gaps = 29/342 (8%)

Query  102   PAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPA  158
                +  +   VPP+    P           +   ++ P      +  +  +V     +  
Sbjct  1055  LVTSSTISSGVPPDLPGAPSNLVISNISPRSATLQFRPGYDGKTSI-SRWIVEGQVGAIG  1113

Query  159   EDFQEPCQYSQESQKFSCQLAVP-EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             ++ +    Y +E++  +  L +P     + Y   M   + VG       +     +  P 
Sbjct  1114  DEEEWVTLYEEENEPDAQMLEIPNLTPYTHYRFRMKQVNIVGPSPYSPSSRVIQTLQAP-  1172

Query  218   P---PANITVTAVARNPRWLSVTWQD-PHS-WNSSFYRLRFELRYRAER--SKTFTTWMV  270
             P   P ++TV   +     L + W   P S +N +   + + ++Y      S      + 
Sbjct  1173  PDVAPTSVTVRTASETS--LRLRWVPLPDSQYNGNPESVGYRIKYWRSDLQSSAVAQVVS  1230

Query  271   KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW-------SPEAMGTPWTESRSPPA  323
               L+    I +    + + +Q++A    G G WSE        S  +       + +  +
Sbjct  1231  DRLEREFTIEELEEWMEYELQMQAFNAVGAGPWSEVVRGRTRESVPSAAPENVSAEAVSS  1290

Query  324   ENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIA  383
                + T       +++   + ++       +  +     P P   +  G+     LL   
Sbjct  1291  TQILLTWTSVPEQDQNGLILGYK-------ILFRAKDLDPEPRSHIVRGNHTQSALLAGL  1343

Query  384   IVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLV  425
                   +   L   + G      P  L +   + P P   LV
Sbjct  1344  RKFVLYELQVLAFTRIGNGVPSTPLILERTKDDAPGPPVRLV  1385


 Score = 40.9 bits (94),  Expect = 0.026, Method: Composition-based stats.
 Identities = 32/215 (15%), Positives = 63/215 (29%), Gaps = 24/215 (11%)

Query  133   EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
              W P      +    +   K     A+   E  +                   + Y+VS+
Sbjct  1721  TWDPPPPE--SQNGNIQGYKIYYWEADSQNETEKMKVLFLPEPVVRLKNLTSHTKYLVSI  1778

Query  193   CVASSVGSK-FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
                ++ G    S  Q         P  P+ +  + +      L+V+W +P + N      
Sbjct  1779  SAFNAAGDGPKSDPQQ-GRTHQAAPGAPSFLAFSEI--TSTTLNVSWGEPAAAN--GILQ  1833

Query  252   RFELRYRAERSKTFTTWMVK-----DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
              + + Y         + +V      + Q    + D   G+ +  +++A+           
Sbjct  1834  GYRVVYEPLAPVQGVSKVVTVEVRGNWQRWLKVRDLTKGVTYFFRVQARTITYG------  1887

Query  307   SPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDD  341
              PE            PAE    +P   L T    +
Sbjct  1888  -PELQANITAG----PAEGSPGSPRDVLVTKSASE  1917


 Score = 34.4 bits (77),  Expect = 3.1, Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 5/73 (7%)

Query  26   PAQEVARGVLTSLPGDS-VTLTC-PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLL  83
            P   V  G  + + G S  TL C     P ++ +V W           S     GRRL +
Sbjct  293  PTIVVPPGNRSVVAGSSETTLECIASARPVEDLSVTWKRNGVRI---TSGLHSFGRRLTI  349

Query  84   RSVQLHDSGNYSC  96
             +    D+G Y C
Sbjct  350  SNPTSADTGPYVC  362


> sp|P97798|NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 
PE=1 SV=1
Length=1493

 Score = 59.4 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 76/222 (34%), Gaps = 14/222 (6%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPAEDFQEPCQYS  168
            V +P   P +  +  +  +++   W    + +       L   +      +D        
Sbjct  567  VQLPGPAPNIRAYA-TSPTSITVTWETPLSGNGEIQNYKLYYMEKGTDKEQD--------  617

Query  169  QESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
             +    S  +   +  + +    +          ++    +    +    P N+++    
Sbjct  618  IDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTLSDVPSAAPQNLSLEV--  675

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRYR-AERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
            RN + + + WQ P S   +     +++RYR A R    T  +V   Q   +I     G  
Sbjct  676  RNSKSIVIHWQPPSSTTQNGQITGYKIRYRKASRKSDVTETLVTGTQLSQLIEGLDRGTE  735

Query  288  HVVQLRAQEEFGQGEWSEW-SPEAMGTPWTESRSPPAENEVS  328
            +  ++ A    G G  ++W S E   +   E+R P   + + 
Sbjct  736  YNFRVAALTVNGTGPATDWLSAETFESDLDETRVPEVPSSLH  777


 Score = 49.8 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 61/183 (33%), Gaps = 12/183 (7%)

Query  184   DSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
              ++ Y  S+ V     S   S T       ++   PP ++TV +    PR + V WQ P 
Sbjct  953   PNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPS  1012

Query  243   SWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
               N     Y + +     AE    +    V   +    I +      +  +++A+   G 
Sbjct  1013  EANGKITGYIIYYSTDVNAEIH-DWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGM  1071

Query  301   GEWSEWSPEAMGTPWTES----RSPPAENEVSTPMQALTTNKDDDNILFRDSAN--ATSL  354
             G  SE       TP  +S     +  A        +      D    +   ++   + + 
Sbjct  1072  GPMSE--AVQFRTPKADSSDKMPNDQALGSAGKGSRLPDLGSDYKPPMSGSNSPHGSPTS  1129

Query  355   PVQ  357
             P+ 
Sbjct  1130  PLD  1132


> sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase 
F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1
Length=1898

 Score = 59.8 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 50/327 (15%), Positives = 98/327 (30%), Gaps = 33/327 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG +V LTC  V       V W++             G   R +L  
Sbjct  232  PRFSIPPSSQEVMPGGNVNLTCVAVGAP-MPYVKWMMGAEELTKEDEMPVG---RNVLEL  287

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G    T  + V   P+ P      ++  ++V   W   +    
Sbjct  288  SNVMRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGN----  343

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
             T+ V        +   D          S ++S     P  +   Y   +   +S+G   
Sbjct  344  -TEPVSFYGIQYRAAGTDGPFQEVDGVASTRYSIGGLSPFSE---YAFRVLAVNSIGRGP  399

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
             S+    +        PP  +    ++ +     V W+ P     +     + + Y  + 
Sbjct  400  PSEAVRARTGEQAPSSPPRRVQARMLSASTML--VQWEPPE--EPNGLVRGYRVYYTPDS  455

Query  262  SK---TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES  318
             +    +      D      +     G+ + +++ A    G G      P +        
Sbjct  456  RRPLSAWHKHN-TDAGLLTTVGSLLPGITYSLRVLAFTAVGDG------PPSPTIQVKTQ  508

Query  319  RSPPAENEVSTPMQALTTNKDDDNILF  345
            +  PA+       QA   +     + +
Sbjct  509  QGVPAQ---PADFQAKAESDTRIQLSW  532


 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 40/239 (17%), Positives = 71/239 (30%), Gaps = 18/239 (8%)

Query  183  GDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
               + Y +++   ++ G    SK +     G +   P   ++ TA+        + W  P
Sbjct  779  TPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMMVSTTAMHTAL----LQWHPP  834

Query  242  HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                     L + L+YR        T        H  +     G  ++ +L A+   G G
Sbjct  835  KELPGE--LLGYRLQYRRADEARPNTIDFGKDDQHFTVTGLHKGATYIFRLAAKNRAGPG  892

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSS  361
            E  E+  E   TP       P    V+    + T    D  +L   +   T+  V     
Sbjct  893  E--EFEKEIT-TPEDAPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRITNYTVVYRDI  949

Query  362  VPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
                      G +    L      L+   T+ ++              L   +  R  P
Sbjct  950  NSQHELQNVTGDVHLTLL-----GLKPDTTYDIKVRAHTSKGA---GPLSPSIQSRTMP  1000


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 51/330 (15%), Positives = 94/330 (28%), Gaps = 30/330 (9%)

Query  51   EPEDNATVH-WVLRKPAAGSHPS-RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHL  108
             P+    +  W      AG   +      G    LR +     G       G P+ T+ +
Sbjct  452  TPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVG------DGPPSPTIQV  505

Query  109  LVDV-PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQY  167
                  P +P     +    + +   W       L  +  ++  +     AED  E  Q+
Sbjct  506  KTQQGVPAQPADFQAKAESDTRIQLSWL------LPPQERIIKYELVYWAAED--EGQQH  557

Query  168  SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTA  226
                   S          + Y   +   S +G                P  PP    VT 
Sbjct  558  KVTFDPTSSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEACTAQSTPSAPPQ--KVTC  615

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ---HHCVIHDAW  283
            V+     + V+W  P + + +    ++ + Y A   +     +V  +        +    
Sbjct  616  VSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLE  675

Query  284  SGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNI  343
                + V +RA  + G G  S  SP  + T       PP + EV               +
Sbjct  676  KWTEYRVWVRAHTDVGPGPES--SPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPV  733

Query  344  LFRDSA-----NATSLPVQDSSSVPLPTFL  368
              +          T + +++      P   
Sbjct  734  PNKQHGQIRGYQVTYVRLENGEPRGQPIIQ  763


 Score = 49.0 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 96/319 (30%), Gaps = 37/319 (12%)

Query  44   TLTCPGVEPEDNATVHWVLR----KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA  99
             L   G  P+    + W        PA+ +   +    G  L + S +  D G Y C   
Sbjct  154  MLCAAGGNPD--PEISWFKDFLPVDPASSNGRIKQLRSGA-LQIESSEESDQGKYECVAT  210

Query  100  GRPAGT----VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
                       +L V V    P+ S    S          P    +LT  AV     +  
Sbjct  211  NSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEV------MPGGNVNLTCVAVGAPMPYVK  264

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                  +   +      +   +L+     +++   +    SS+G   +   T Q      
Sbjct  265  WMMGAEELTKEDEMPVGRNVLELSNVMRSANY---TCVAISSLGMIEA---TAQVTVKAL  318

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P PP ++ VT        +++TW    S N+      + ++YRA  +      +      
Sbjct  319  PKPPIDLVVTETTATS--VTLTW---DSGNTEPVSF-YGIQYRAAGTDGPFQEVDGVAST  372

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
               I        +  ++ A    G+G  SE           ++ S P        +QA  
Sbjct  373  RYSIGGLSPFSEYAFRVLAVNSIGRGPPSE---AVRARTGEQAPSSP-----PRRVQARM  424

Query  336  TNKDDDNILFRDSANATSL  354
             +     + +        L
Sbjct  425  LSASTMLVQWEPPEEPNGL  443


 Score = 49.0 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 55/192 (29%), Gaps = 17/192 (9%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
            P   PQ      +  + V   W P        + T+  +     +    ED +       
Sbjct  606  PSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAY---EAVDGEDRKRHVVDGI  662

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANITVTAVA  228
              +  S  L   E   + Y V +   + VG    S     +    +   PP  + V  + 
Sbjct  663  SREHSSWDLLGLEKW-TEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL-  720

Query  229  RNPRWLSVTWQDPHSWNSSFYRLRFELRY------RAERSKTFTTWMVKDLQHHCVIHDA  282
             N   + V+W+ P           +++ Y                 M+ + Q    I   
Sbjct  721  -NSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQ-ETTISGL  778

Query  283  WSGLRHVVQLRA  294
                 + + + A
Sbjct  779  TPETTYSITVAA  790


> sp|A0JM20|TYRO3_XENTR Tyrosine-protein kinase receptor TYRO3 
OS=Xenopus tropicalis OX=8364 GN=tyro3 PE=2 SV=1
Length=881

 Score = 59.4 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/235 (17%), Positives = 82/235 (35%), Gaps = 33/235 (14%)

Query  81   LLLRSVQLHDSGNYSC---YRAGRPAGTVH--LLVDVP--PEEPQLSCFRKSPLSNVVCE  133
            L L++V+  D+G Y C   +   +        ++  VP    EP+      +   N+ C 
Sbjct  88   LSLKNVERPDAGRYWCEAEHSGRKSVSDAIWVMVEGVPYFTLEPKDLSVTPNSPFNMTC-  146

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
                +        V+      +   +    P        +     +              
Sbjct  147  ----AAVGPPEPLVIFWWVGDSPLGKSESSPSVLQIPGIRERTAFSC------------E  190

Query  194  VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
              ++ G   S+T   +  G+  P PP N+T++ V  +    +VTW       +SF  ++ 
Sbjct  191  AHNAKGVSSSRTAIVEVKGL--PYPPFNVTISKVTGSTA--TVTWSP---GFNSFSLIKS  243

Query  254  E-LRYRAER-SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
              ++ ++   ++   + +        V+ D      H V+++   E G   +SEW
Sbjct  244  CTIQVQSLHGNREMYSRLTSVPPFAVVLDDLQPLTNHSVRVQCTNEMGASPFSEW  298


> sp|Q63155|DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 
GN=Dcc PE=1 SV=2
Length=1445

 Score = 59.4 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 47/122 (39%), Gaps = 4/122 (3%)

Query  186  SFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW  244
            + Y +     +  G    +   T      +   PP N+++  V  N R + V+W  P S 
Sbjct  592  TEYTLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVV--NSRSIKVSWLPPPSG  649

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              + +   +++R+R + ++      ++      +      G ++  Q+ A    G G  S
Sbjct  650  TQNGFITGYKIRHR-KTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPS  708

Query  305  EW  306
             W
Sbjct  709  NW  710


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 52/309 (17%), Positives = 103/309 (33%), Gaps = 36/309 (12%)

Query  10   AALLAAPGA--ALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA  67
              +L+ PG    L   + P+  +A        G    L C  V      +  W+  +   
Sbjct  228  VRILSDPGLHRQLYFLQRPSNVIAIE------GKDAVLEC-CVSGYPPPSFTWLRGEEVI  280

Query  68   GSHPSRWAGMG-RRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFR  123
                 +++ +G   LL+ +V   DSG Y+C   Y+    + +  L V VPP    L+   
Sbjct  281  QLRSKKYSLLGGSNLLISNVTDDDSGTYTCVVTYKNENISASAELTVLVPPW--FLNHPS  338

Query  124  KSP-LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE  182
                  ++  E+    +         +       P++ FQ               L V +
Sbjct  339  NLYAYESMDIEFECAVSGKPVPTVNWMKNGDVVIPSDYFQ------IVGGSNLRILGVVK  392

Query  183  GDSSFYIVSMCVASSVGSKFSK-----TQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
             D  FY       +  G+  S       +       + P  P ++    V  + R++ ++
Sbjct  393  SDEGFY--QCVAENEAGNAQSSAQLIVPKPAIPSSSILPSAPRDVV--PVLVSSRFVRLS  448

Query  238  WQDPHSWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            W+ P     +   + + F    R   ++       +       + +      +  ++ A 
Sbjct  449  WRPPAEAKGNIQTFTVFFS---REGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAY  505

Query  296  EEFGQGEWS  304
             E+G GE S
Sbjct  506  NEWGPGESS  514


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 64/203 (32%), Gaps = 8/203 (4%)

Query  160   DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA-SSVGSKFSKTQTFQGCGILQPDP  218
              F    +Y  E        A     ++ Y  S+ V  +   S +S T             
Sbjct  888   SFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSA  947

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHH  276
             P ++TV      PR + V+WQ P   N     Y L + L  +      +    +   +  
Sbjct  948   PKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLD-KNIPIDDWIMETISGDRLT  1006

Query  277   CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
               I D      +  +++A+   G G  S+  P    T   E     A ++          
Sbjct  1007  HQIMDLSLDTMYYFRIQARNAKGVGPLSD--PILFRTLKVEHPDKMANDQGRHGD--GGY  1062

Query  337   NKDDDNILFRDSANATSLPVQDS  359
                D N++ R + N   +     
Sbjct  1063  WPVDTNLIDRSTLNEPPIGQMHP  1085


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/238 (15%), Positives = 73/238 (31%), Gaps = 47/238 (20%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ---YSQE  170
            P++P  S   +   + ++  W P   P++  +  ++     +  AE  +   +   YS E
Sbjct  726  PDQPS-SLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIE  784

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP--------------  216
              + S            Y++S+   ++ G      ++     I  P              
Sbjct  785  RLESSSH----------YVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFP  834

Query  217  ----------DPPANITVTAVARNPRWLSVTWQD---PHSWNSSFYRLRFELRYRAERSK  263
                       PP  +   A+      + V+W D   P +  +S  RL + +R+R   S 
Sbjct  835  TSGPDVSTPMLPPVGVQAVALTHEA--VRVSWADNSVPKNQKTSDVRL-YTVRWRTSFSA  891

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
            +                       +   +   +       S WS  A  T +  + + 
Sbjct  892  SAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRS---STWSMTAHATTYEAAPTS  946


> sp|P70211|DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 
GN=Dcc PE=1 SV=2
Length=1447

 Score = 59.4 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/122 (19%), Positives = 47/122 (39%), Gaps = 4/122 (3%)

Query  186  SFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW  244
            + Y +     +  G    +   T      +   PP NI++  V  N R + V+W  P S 
Sbjct  592  TEYTLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNISLEVV--NSRSIKVSWLPPPSG  649

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              + +   +++R+R + ++      ++      +      G ++  Q+ A    G G  S
Sbjct  650  TQNGFITGYKIRHR-KTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPS  708

Query  305  EW  306
             W
Sbjct  709  NW  710


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 64/203 (32%), Gaps = 8/203 (4%)

Query  160   DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA-SSVGSKFSKTQTFQGCGILQPDP  218
              F    +Y  E        A     ++ Y  S+ V  +   S +S T             
Sbjct  888   SFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSA  947

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHH  276
             P ++TV      PR + V+WQ P   N     Y L + L  +      +    +   +  
Sbjct  948   PKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLD-KNIPIDDWIMETISGDRLT  1006

Query  277   CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
               I D      +  +++A+   G G  S+  P    T   E     A ++          
Sbjct  1007  HQIMDLSLDTMYYFRIQARNVKGVGPLSD--PILFRTLKVEHPDKMANDQGRHGD--GGY  1062

Query  337   NKDDDNILFRDSANATSLPVQDS  359
                D N++ R + N   +     
Sbjct  1063  WPVDTNLIDRSTLNEPPIGQMHP  1085


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/238 (15%), Positives = 73/238 (31%), Gaps = 47/238 (20%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ---YSQE  170
            P++P  S   +   + ++  W P   P++  +  ++     +  AE  +   +   YS E
Sbjct  726  PDQPS-SLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIE  784

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQP--------------  216
              + S            Y++S+   ++ G      ++     I  P              
Sbjct  785  RLESSSH----------YVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFP  834

Query  217  ----------DPPANITVTAVARNPRWLSVTWQD---PHSWNSSFYRLRFELRYRAERSK  263
                       PP  +   A+      + V+W D   P +  +S  RL + +R+R   S 
Sbjct  835  TSGPDVSTPMLPPVGVQAVALTHEA--VRVSWADNSVPKNQKTSDVRL-YTVRWRTSFSA  891

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
            +                       +   +   +       S WS  A  T +  + + 
Sbjct  892  SAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRS---STWSMTAHATTYEAAPTS  946


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 47/277 (17%), Positives = 92/277 (33%), Gaps = 28/277 (10%)

Query  40   GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMG-RRLLLRSVQLHDSGNYSC--  96
            G    L C  V      +  W+  +        +++ +G   LL+ +V   DSG Y+C  
Sbjct  254  GKDAVLEC-CVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGTYTCVV  312

Query  97   -YRAGRPAGTVHLLVDVPPEEPQLSCFRKSP-LSNVVCEWGPRSTPSLTTKAVLLVRKFQ  154
             Y+    + +  L V VPP    L+         ++  E+    +         +     
Sbjct  313  TYKNENISASAELTVLVPPW--FLNHPSNLYAYESMDIEFECAVSGKPVPTVNWMKNGDV  370

Query  155  NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSK-----TQTFQ  209
              P++ FQ               L V + D  FY       +  G+  S       +   
Sbjct  371  VIPSDYFQ------IVGGSNLRILGVVKSDEGFY--QCVAENEAGNAQSSAQLIVPKPAI  422

Query  210  GCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF--YRLRFELRYRAERSKTFTT  267
                + P  P +  V  V  + R++ ++W+ P     +   + + F    R   ++    
Sbjct  423  PSSSILPSAPRD--VLPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFS---REGDNRERAL  477

Query  268  WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
               +       + +      +  ++ A  E+G GE S
Sbjct  478  NTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESS  514


> sp|Q6V4S5|SDK2_MOUSE Protein sidekick-2 OS=Mus musculus OX=10090 
GN=Sdk2 PE=1 SV=1
Length=2176

 Score = 59.4 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 62/380 (16%), Positives = 122/380 (32%), Gaps = 36/380 (9%)

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSC---FRKSPLSNVVCEWG  135
                 +    +   G               +   VPPE P              +V  ++ 
Sbjct  966   TTYTIEVAAMTSKGQ-------GQVSASTISSGVPPELPGAPTNLGISNIGPRSVTLQFR  1018

Query  136   PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCV  194
             P      +  +  +V        E  +    Y   ++  +  + VP+ +  ++Y   M  
Sbjct  1019  PGYDGKTSI-SRWVVEAQVGVIGEGEEWLLIYQLGNEPDARSMEVPDLNPFTYYSFRMRQ  1077

Query  195   ASSVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFY--R  250
              + VG+   S+           PD  PAN+T+   +     L + W        +     
Sbjct  1078  VNIVGTSPPSQPSRKIQTLQAPPDIAPANVTLRTASETS--LWLRWMPLPEMEYNGNPES  1135

Query  251   LRFELRY-RAERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
             + ++++Y R++      +  V+D ++    I D      + VQ++A    G G WS    
Sbjct  1136  VGYKIKYGRSDGHGKTLSHTVQDRVEREYTIEDLEEWTEYRVQVQAFNAIGSGPWS---Q  1192

Query  309   EAMGTPWT--ESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN-ATSLPVQDSSSVPLP  365
               +G       S  P   + ++T   ++     +     R+       +  ++  S   P
Sbjct  1193  AVVGRTRESVPSSGPTNVSALATTSSSMLVRWSEIPEADRNGLVLGYKVRYKEKDSDSQP  1252

Query  366   TF-LVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVL  424
              F LV G S     L  +   + ++            +  HPP     L      P  +L
Sbjct  1253  RFWLVEGNSSRSAQLTGLGKYVLYEVQVLAFTRIGDGSPSHPPILERTLDDVPGPPMGIL  1312

Query  425   VP---------LISPPVSPS  435
              P         +  PP +P+
Sbjct  1313  FPEVRTTSVRLIWQPPAAPN  1332


 Score = 52.1 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/255 (15%), Positives = 82/255 (32%), Gaps = 25/255 (10%)

Query  54    DNATVHWVLRKPAAGSHPSRWAGMGRRLL--LRSVQLHDSGNYSCYRAGRPAGTVHL--L  109
             D+    W++      S  ++  G+G+ +L  ++ +     G       G P+    L   
Sbjct  1249  DSQPRFWLVEG--NSSRSAQLTGLGKYVLYEVQVLAFTRIG------DGSPSHPPILERT  1300

Query  110   VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
             +D  P  P    F +   ++V   W P + P+    A  +  +   + A           
Sbjct  1301  LDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNATTANTATVE----V  1356

Query  170   ESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPPANITVTA  226
              +      +A      S Y+  +   +  G   +  +   T +     +P PP+   V  
Sbjct  1357  LAPSARQYMATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKRD--RPQPPSKPVVQQ  1414

Query  227   VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWS  284
                  R + ++W+      S      + ++ R   S  +      V        +     
Sbjct  1415  EDVKARSVLLSWEPGSDGLSP--VRYYTIQTRELPSGRWALHSASVSHNASAFTVDRLKP  1472

Query  285   GLRHVVQLRAQEEFG  299
                +  +++A  + G
Sbjct  1473  FTSYKFRVKATNDIG  1487


 Score = 49.4 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/148 (17%), Positives = 47/148 (32%), Gaps = 9/148 (6%)

Query  113   PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             PP +P +         +V+  W P S      +   +  +               S  + 
Sbjct  1406  PPSKPVVQQE-DVKARSVLLSWEPGSDGLSPVRYYTIQTREL-PSGRWALHSASVSHNAS  1463

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGI-LQPD-PPANITVTAVARN  230
              F+     P    + Y   +   + +G      ++     +   PD  P  ++VT     
Sbjct  1464  AFTVDRLKP---FTSYKFRVKATNDIGDSEFSEESESLTTLQAAPDEAPTILSVTPHTTT  1520

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYR  258
                + + WQ P     +   L F +RYR
Sbjct  1521  S--VLIRWQPPSEDKINGILLGFRIRYR  1546


 Score = 49.0 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 62/352 (18%), Positives = 112/352 (32%), Gaps = 37/352 (11%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             +   A+               T + G SV L C        A + W   +    S   +
Sbjct  395  TSTYLAVTSIAPNITRGPLD-STVIDGMSVVLACETSGAPRPA-ITWQKGERILASGSVQ  452

Query  74   W----AGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDV---PPEEPQLSCFR  123
                       LL+    + D+G Y+C      G    +  L+V       + PQ     
Sbjct  453  LPRFTLLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQSVI  512

Query  124  KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP-E  182
            K   +++VC  G    P +T + V      +   A    E     +  +  S  ++    
Sbjct  513  KGTQASMVC--GVTHDPRVTVRYVW-----EKDGATLAVETNPRIRLDRNGSLHISQTWS  565

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
            GD   Y   +  A   G   S+    +   +  P  P +   T      R +++TW  P 
Sbjct  566  GDIGTYTCRVLSA---GGNDSRNAHLRVRQL--PHAPEHPVATLSTVERRAINLTWAKPF  620

Query  243  SWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
              NS   R   E+   +E +  +T  +  V       ++        +  +L A  + G+
Sbjct  621  DGNSPLMRYVLEM---SENNAPWTILLASVDPEATSVMVKGLVPARSYQFRLCAVNDVGK  677

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANAT  352
            G++S+   E +  P     +PP          A         I ++    + 
Sbjct  678  GQFSK-DTERVSLPEEPPTAPPQNVI------ASGRTNQSIMIQWQPPPESH  722


 Score = 37.5 bits (85),  Expect = 0.37, Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 62/190 (33%), Gaps = 14/190 (7%)

Query  188   YIVSMCVASSVGSKF-SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH----  242
             Y + M + ++VG    S  Q       +    P N+ + +       L VTW+ P     
Sbjct  1599  YEIRMSIYNAVGEGPLSPPQEVFVGEAVPTAAPQNVAIHS--ATATQLDVTWEPPPLDNQ  1656

Query  243   SWNSSFYRLRF-ELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
             + +   Y++ F E++ R    +  T ++ ++      + +      ++V + A    G G
Sbjct  1657  NGDIQGYKIYFWEVQRRNLTERVKTLFLAEN---SVKLKNLTGYTAYMVSVAAFNAAGDG  1713

Query  302   EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSS  361
               S       G     + S P   + S           D             L  +  + 
Sbjct  1714  PRST---PTRGQTQQAAPSAPGSVKFSELTTTSVNVSWDAPQFPNGPLEGYRLVYEPCTP  1770

Query  362   VPLPTFLVAG  371
             V   + +V  
Sbjct  1771  VDGVSKIVTV  1780


 Score = 34.4 bits (77),  Expect = 2.7, Method: Composition-based stats.
 Identities = 14/100 (14%), Positives = 32/100 (32%), Gaps = 17/100 (17%)

Query  229   RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF----TTWMVKDLQHHCVIHDAWS  284
             R    +++ W             R+ +  R      +         +   +   +     
Sbjct  1839  RYSSAIAIHWSSGDPGKGPI--TRYVIEARPSDEGLWDILIKDIPKEVTSYTFSMDILKP  1896

Query  285   GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAE  324
             G+ +  ++ A  ++G            GTP + S+S PA+
Sbjct  1897  GVSYDFRVIAVNDYG-----------FGTPSSPSQSVPAQ  1925


> sp|Q4W815|EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis 
OX=8355 GN=epor PE=2 SV=1
Length=525

 Score = 58.7 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 72/205 (35%), Gaps = 21/205 (10%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            PEE Q        L++ +C W           A     +      +D  + CQ   E   
Sbjct  50   PEEYQNPHCFTRDLNDFICFWE----GERRKNASFSYSE------DDQIKWCQLRTEVAS  99

Query  174  FSCQLAVPEGDSS--FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
             +    + E   +       + +++    K    +      ++  +PP N+TV     +P
Sbjct  100  NNTWWYICEFPVTDVVLFAGITISAYPCHKCQTAREIYINELVLLNPPLNVTVKEKQ-DP  158

Query  232  RWLSVTWQDPHSWNSSFYRLRFELRYRAERS---KTFTTWMVKDLQHHCVIHDAWSGLRH  288
            R L ++W+ PH      + +  E++Y+   S       T  V+       + D      +
Sbjct  159  RGLLISWKPPH--FQKNHDINNEIKYQVNYSTPGADMQTVEVEAGNTEIFLTDIVPAA-Y  215

Query  289  VVQLRAQEE--FGQGEWSEWSPEAM  311
             V +R + +     G WS+W+    
Sbjct  216  TVTVRCKADGVSYNGYWSDWTAPIT  240


> sp|O88488|PTPRQ_RAT Phosphatidylinositol phosphatase PTPRQ OS=Rattus 
norvegicus OX=10116 GN=Ptprq PE=1 SV=1
Length=2302

 Score = 59.4 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/217 (18%), Positives = 75/217 (35%), Gaps = 30/217 (14%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P   Q+  ++    S+++  W P   P    T   +   +   + A        +   + 
Sbjct  571  PSSIQIINYKNISSSSILLYWDPPEYPNGKITHYTIYATELDTNRA--------FQMTTV  622

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPD-----PPANITVTA  226
              S  +   +   + Y + +  ++ VG    S+           P+      P ++ VT 
Sbjct  623  DNSFLITGLKKY-TRYKMRVAASTHVGESSLSEENDIFVR---TPEDEPESSPQDVQVTG  678

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWSG  285
            V  +P  L + W  P     +   + +E+ Y+        T  VK+      +I D    
Sbjct  679  V--SPSELRLKWSPPE--KPNGIIIAYEVLYQNAD-----TLFVKNTSTTDIIISDLKPY  729

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
              + + +R+    G G  S  S  ++ T  T   S P
Sbjct  730  TLYNISIRSYTRLGHGNQSS-SLLSVRTSETVPDSAP  765


 Score = 56.7 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 47/305 (15%), Positives = 84/305 (28%), Gaps = 33/305 (11%)

Query  30    VARGVLTS-LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQL  88
             V      S LPG  V +    +   +  TV +                      +     
Sbjct  1262  VWLTWSPSPLPGGIVKVYSFKIHEHETDTVFYKNISGLQTDAKLEGLEPVSTYSVSVSAF  1321

Query  89    HDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAV  147
                GN + Y       T      VP     + C  +   S V   W P      +    +
Sbjct  1322  TKVGNGNQYSNVVEFTTQE---SVPEAVRNIECVARDWQS-VSVRWDPPRKTNGIIIHYM  1377

Query  148   LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT  207
             + V    NS     ++P     +               + Y+  +  ++S G        
Sbjct  1378  ITVGG--NSTKVSPRDPTYTFTKLLPN-----------TSYVFEVRASTSAGEGNESRCD  1424

Query  208   FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT-  266
                     P  P N+  + V       ++TW  P +    F   +   + RA++ + +  
Sbjct  1425  ISTLPETVPSAPTNVAFSNVQSTSA--TLTWTKPDTIFGYFQNYKITTQLRAQKCREWEP  1482

Query  267   ---------TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
                       ++ +  Q    +H       +  Q+ A    G    SEW   +  T    
Sbjct  1483  EECIEHQKDQYLYEANQTEETVHGLKKFRWYRFQVAASTNVGYSNASEWI--STQTLPGP  1540

Query  318   SRSPP  322
                PP
Sbjct  1541  PDGPP  1545


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 28/218 (13%), Positives = 70/218 (32%), Gaps = 15/218 (7%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
               P + P    +     S+++  W P   P+   +   +    QN+     Q        
Sbjct  948   GEPSDPPNDVHYVNLSSSSIILFWTPPVKPNGIIQYYSVYY--QNTSGTFVQNFTLLQVT  1005

Query  171   SQKFSCQLA---VPEGDSSFYIVSMCVASSVGS--KFSKTQTFQGCGILQPDPPANITVT  225
              +  +  ++         S+Y   +  ++SVG+  K S          +   P  N+T  
Sbjct  1006  KESDNVTVSARIYRLAIFSYYTFWLTASTSVGNGNKSSDIIHVYTDQDIPEGPVGNLTFE  1065

Query  226   AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWS  284
             ++  +   + V+W+ P   N   +   + L    ++S        +   ++     D   
Sbjct  1066  SI--SSTAIHVSWEPPSQPNGLVF---YYLSLNLQQSPPRHMIPPLVTYENSIDFDDLEK  1120

Query  285   GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                ++ ++       +G    ++ +       +    P
Sbjct  1121  YTDYIFKI--TPSTEKGFSETYTTQLHIKTEEDVPDTP  1156


 Score = 43.6 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 34/233 (15%), Positives = 64/233 (27%), Gaps = 31/233 (13%)

Query  84    RSVQLHDSGNYSCY---------RAGRPAGTVHLLV----DVPPEEPQLSCFRKSPLSNV  130
              S+   D   Y+ Y         +      T  L +    DVP   P ++ F+    +++
Sbjct  1111  NSIDFDDLEKYTDYIFKITPSTEKGFSETYTTQLHIKTEEDVPDTPPIINTFKNLSSTSI  1170

Query  131   VCEWGPR-STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
             +  W P            L ++                   S      +       + Y 
Sbjct  1171  LLSWDPPLKPNGAILGYHLTLQGP---------HANHTFVTSGNH--IVLEELSPFTLYS  1219

Query  190   VSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
                   +  G   S    F       P  PP N+T+  +     ++ +TW    S     
Sbjct  1220  FFAAARTMKGLGPSSIL-FFYTDESAPLAPPQNLTL--INYTSDFVWLTWSP--SPLPGG  1274

Query  249   YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                 +  +     + T     +  LQ    +        + V + A  + G G
Sbjct  1275  IVKVYSFKIHEHETDTVFYKNISGLQTDAKLEGLEPVSTYSVSVSAFTKVGNG  1327


 Score = 42.1 bits (97),  Expect = 0.012, Method: Composition-based stats.
 Identities = 20/126 (16%), Positives = 49/126 (39%), Gaps = 8/126 (6%)

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
             D + Y +++  + S  +  S         + +P PP  +    V  +   L ++W  P 
Sbjct  26   FDGTGYDITLS-SVSATTYSSPVSRTLATNVTKPGPPVFLAGERV-GSAGIL-LSWNTPP  82

Query  243  SWNSSFYRLRFELRYR---AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
              N +   + + ++Y+         +T    K      ++ +   G  + +++ A+   G
Sbjct  83   --NPNGRIISYVVKYKEVCPWMQTAYTRARAKPDSLEVLLTNLNPGTTYEIKVAAENNAG  140

Query  300  QGEWSE  305
             G +S+
Sbjct  141  IGVFSD  146


 Score = 38.6 bits (88),  Expect = 0.16, Method: Composition-based stats.
 Identities = 35/236 (15%), Positives = 76/236 (32%), Gaps = 27/236 (11%)

Query  95   SCYRAGRPAGTVH-LLVDVPPEEPQLS----CFRKSPLSNVVCEWGPRSTP-SLTTKAVL  148
            S +         + + V  P +EP+ S           S +  +W P   P  +     +
Sbjct  644  STHVGESSLSEENDIFVRTPEDEPESSPQDVQVTGVSPSELRLKWSPPEKPNGIIIAYEV  703

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS--KFSKTQ  206
            L +                  ++   +  +       + Y +S+   + +G   + S   
Sbjct  704  LYQNADTL-----------FVKNTSTTDIIISDLKPYTLYNISIRSYTRLGHGNQSSSLL  752

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
            + +    +    P NIT   +  +   + +++  P S   +    ++ +  +   S    
Sbjct  753  SVRTSETVPDSAPENITYKNI--SSGEIEISFLPPRS--PNGIIQKYTIYLKRSNSHEAR  808

Query  267  TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
            T     L     I        +V+++ A    G+G  S   P ++ T      SPP
Sbjct  809  TINTTSLTQ--TIGGLKKYTHYVIEVSASTLKGEGIRSR--PISILTEEDAPDSPP  860


 Score = 37.1 bits (84),  Expect = 0.39, Method: Composition-based stats.
 Identities = 44/311 (14%), Positives = 85/311 (27%), Gaps = 49/311 (16%)

Query  36   TSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
              +PG    L    VE  +   + W          P +  G+  +  ++   L       
Sbjct  396  PDVPGAVFDLQIAEVEATE-IRITWR--------KPRQPNGIISQYRVKVSVLE------  440

Query  96   CYRAGRPAGTVHLLVD----VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
                G       L         P  P++       +          S        +    
Sbjct  441  ---TGVVLENTLLTGQDESISNPMSPEIMNLVDPMIGFYEGSGEMSSDLHSPASFIYNSH  497

Query  152  KFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGC  211
               + PA    E       + +    +     +   Y+V       +      T +    
Sbjct  498  PHNDFPASTRAEEQSSPVVTTRNQ-YMTDITAEQLSYVVR-----RLVPFTEHTISVSAF  551

Query  212  GILQPDPPANITVTAVARNPRWLS-------------VTWQDPHSWNSSFYRLRFELRYR  258
             I+   PP  +TV    + P  +              + W  P     +     + + Y 
Sbjct  552  TIMGEGPPTVLTVRTREQVPSSIQIINYKNISSSSILLYWDPPE--YPNGKITHYTI-YA  608

Query  259  AE--RSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT  316
             E   ++ F    V +     +I       R+ +++ A    G+   SE +   + TP  
Sbjct  609  TELDTNRAFQMTTVDN---SFLITGLKKYTRYKMRVAASTHVGESSLSEENDIFVRTPED  665

Query  317  ESRSPPAENEV  327
            E  S P + +V
Sbjct  666  EPESSPQDVQV  676


 Score = 35.2 bits (79),  Expect = 1.5, Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 63/202 (31%), Gaps = 13/202 (6%)

Query  109   LVDVPPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSP-AEDFQEPCQ  166
             L   P   P+      +    +   W  P       T  ++ V+   +      F +  +
Sbjct  1537  LPGPPDGPPENVHVVATSPFGINISWSEPAVITG-PTFYLIDVKSVDDDDFNISFLKSNE  1595

Query  167   YSQESQKFSCQ-LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT  225
              ++ ++  + +         + ++ ++  A + G   ++        + + DPP N+T  
Sbjct  1596  ENKTTEINNLEVFTRYSVVITAFVGNVSRAYTDGKSSAEVIITTLESVPK-DPPNNMTFQ  1654

Query  226   AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT------FTTWMVKDLQHHCVI  279
              +        +T+  P     +     ++     E   T      F+     D     ++
Sbjct  1655  KIPDEVTKFQLTFLPPSQ--PNGNIRVYQALVYREDDPTAVQIHNFSIIQKTDTSIIAML  1712

Query  280   HDAWSGLRHVVQLRAQEEFGQG  301
                  G  + + + A    G G
Sbjct  1713  EGLKGGHTYNISVYAINSAGAG  1734


> sp|P19235|EPOR_HUMAN Erythropoietin receptor OS=Homo sapiens 
OX=9606 GN=EPOR PE=1 SV=1
Length=508

 Score = 58.7 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/202 (16%), Positives = 69/202 (34%), Gaps = 17/202 (8%)

Query  118  QLSCFRKSPLSNVVCEWGPRSTPSL-TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
            +L CF +  L ++VC W   ++  +         +                ++ + +F C
Sbjct  49   ELLCFTER-LEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWC  107

Query  177  QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
             L   +  S   +  + V ++ G+     +      ++  D P  + V  +A     + +
Sbjct  108  SLPTADTSSFVPLE-LRVTAASGAPR-YHRVIHINEVVLLDAPVGL-VARLADESGHVVL  164

Query  237  TWQDPHSWNSSFYRLRFELRYR-----AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ  291
             W  P         +   +RY         + +     + + +  CV+ +     R+   
Sbjct  165  RWLPPPET-----PMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFA  219

Query  292  LRAQ--EEFGQGEWSEWSPEAM  311
            +RA+  E    G WS WS    
Sbjct  220  VRARMAEPSFGGFWSAWSEPVS  241


> sp|Q9HBE5|IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens 
OX=9606 GN=IL21R PE=1 SV=1
Length=538

 Score = 58.7 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 80/220 (36%), Gaps = 24/220 (11%)

Query  117  PQLSCFRKSPLSNVVC---EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            P L C+    L  V+C    W    +  LT        + ++           ++     
Sbjct  21   PDLVCYT-DYLQTVICILEMWNLHPST-LTLTWQDQYEELKDEATSCSLHRSAHNATHAT  78

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
            ++C + V     +  I S+ +    G+   +  +F     ++P PP N+TVT        
Sbjct  79   YTCHMDVFHF-MADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTF----SGQ  133

Query  234  LSVTWQDPHSWNSSFYRLR----FELRYRAER-----SKTFTTWMVKDLQHHCVIHDAWS  284
             +++W+     + +FY L+    +EL+YR        S       V       +  +   
Sbjct  134  YNISWRS-DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRK  192

Query  285  GLRHVVQLRAQE---EFGQGEWSEWS-PEAMGTPWTESRS  320
               + +Q+RA        QG WSEWS P    T   E + 
Sbjct  193  DSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE  232


> sp|Q98902|L1CAM_TAKRU Neural cell adhesion molecule L1 OS=Takifugu 
rubripes OX=31033 GN=l1cam PE=3 SV=1
Length=1277

 Score = 59.1 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 52/323 (16%), Positives = 92/323 (28%), Gaps = 33/323 (10%)

Query  12   LLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHP  71
            +LA     +               T + G    L C          V W     +     
Sbjct  430  ILANTNVYVIELPPQILTENGNTYTFVEGQKALLECETFGSP-KPKVTWESSSISLLLAD  488

Query  72   SRWAGMGRR-LLLRSVQLHDSGNYSCYRAG---------RPAGTVHLLVDVPPEEPQLSC  121
             R   +    L + +V   D G Y+C   G                +L       PQ   
Sbjct  489  PRVNLLTNGGLEIANVSHDDEGIYTCLVQGSNISVNAEVEVLNRTVILS-----PPQALR  543

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
             +    +   C             + LL  +  +    +     +Y+ +         V 
Sbjct  544  LQPGKTAIFTC----LYVTDPKLSSPLLQWRKNDQKIFESHSDKKYTFD-GPGLIISNVE  598

Query  182  EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
             GD   Y   +     +    S   T   C   +PDPP ++ VT      R +++ W   
Sbjct  599  PGDEGVYTCQIITKLDMVEASS---TLTLCD--RPDPPVHLQVT--NAKHRVVTLNWTPG  651

Query  242  HSWNSSFYRLRFELRYRAERSKT--FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
               NS    L + + +  +  K   +            V    W  + +  ++ A  + G
Sbjct  652  DDNNSPI--LEYVVEFEDQDMKENGWEELKRVAADKKHVNLPLWPYMSYRFRVIAINDQG  709

Query  300  QGEWSEWSPEAMGTPWTESRSPP  322
            + + S+ S +   TP     S P
Sbjct  710  KSDPSKLS-DLYKTPADAPDSNP  731


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 48/315 (15%), Positives = 89/315 (28%), Gaps = 46/315 (15%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRK---PAAGSHPSRWAGMGRRLLLRSVQLHDSGNY  94
             PG++V L C   +   + T+ W +      A    P R       L+L+ V   D+  Y
Sbjct  361  APGETVKLDCQ-ADGIPSPTITWTVNGVPLSATSLEPRRSLTESGSLILKDVIFGDTAIY  419

Query  95   SCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
             C  +   G      ++ V   P  PQ+     +        +       L  +     +
Sbjct  420  QCQASNKHGTILANTNVYVIELP--PQILTENGN-----TYTFVEGQKALLECETFGSPK  472

Query  152  KFQNSPAEDFQEPCQYSQE--SQKFSCQLA-VPEGDSSFYIVSMCVASSVGSKFSKTQTF  208
                  +          +         ++A V   D   Y   +      GS  S     
Sbjct  473  PKVTWESSSISLLLADPRVNLLTNGGLEIANVSHDDEGIYTCLVQ-----GSNISVNAEV  527

Query  209  QGCG-ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
            +     +   PP  + +           +   DP   +         L++R    K F +
Sbjct  528  EVLNRTVILSPPQALRLQPGKTAIFTC-LYVTDPKLSSP-------LLQWRKNDQKIFES  579

Query  268  WMVKDLQ---HHCVIHDAWSGLR--HVVQLRAQEEFGQGEWSEWSPEAMGT-PWTESRSP  321
               K         +I +   G    +  Q+  + +           EA  T    +   P
Sbjct  580  HSDKKYTFDGPGLIISNVEPGDEGVYTCQIITKLDM---------VEASSTLTLCDRPDP  630

Query  322  PAENEVSTPMQALTT  336
            P   +V+     + T
Sbjct  631  PVHLQVTNAKHRVVT  645


 Score = 39.8 bits (91),  Expect = 0.065, Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 58/178 (33%), Gaps = 13/178 (7%)

Query  114   PEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             P  P          S +   W P S P  +     L  RK Q+        P Q    + 
Sbjct  933   PGPPMSMQMTSPSESEITLHWTPPSKPNGILLGYSLQYRKMQSDD-----NPLQVVDIAS  987

Query  173   KFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP  231
                  L +   D  S Y   +   ++ G   S      G   L+  PPANI+++      
Sbjct  988   PEITHLTLKGLDRHSHYQFLLMARTAAGKGLS--IEILGATTLEGLPPANISLS---AEE  1042

Query  232   RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCV-IHDAWSGLRH  288
             R ++++W+      +  +++ +  +   +    +    + +       +     G  +
Sbjct  1043  RSVNLSWEARKRHRTVGFQIHYFSKNGTKNGGKWKKTEMVNSSLQFFQLQGLTPGSHY  1100


> sp|Q9JMB8|CNTN6_MOUSE Contactin-6 OS=Mus musculus OX=10090 GN=Cntn6 
PE=1 SV=2
Length=1028

 Score = 58.7 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 47/302 (16%), Positives = 89/302 (29%), Gaps = 22/302 (7%)

Query  20   LAPRRCPAQEVARGVLTSLPGDSVTLTCP-GVEPEDNATVHWVLRK-----PAAGSHPSR  73
            L  +      V    +    G+S+ L C    +P       W             +H  R
Sbjct  494  LVVKERTIITVPPSKMDVTVGESIVLPCQVSHDPTMEVLFVWYFNGDIIDLKKGVAHFER  553

Query  74   WAG-MGRRLLLRSVQLHDSGNYSCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSN  129
              G     L++R++QL  SG Y C       R +    ++V  PP  P+         + 
Sbjct  554  IGGESVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVADIIVRGPPGPPEDVKVEHISSTT  613

Query  130  VVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYI  189
                W P    +   +   +  +   S               Q ++  +         Y 
Sbjct  614  SQLSWRPGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGQTYNATVVGLSPWVE-YE  672

Query  190  VSMCVASSVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQ--DPHSWN  245
              +   +++G    SK           P+  P NI       +   L +TW+       N
Sbjct  673  FRVVAGNNIGIGEPSKPSELLRTKASVPNVAPGNI--NGGGGSRSELVITWEAIPEELQN  730

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD---AWSGLRHVVQLRAQEEFGQGE  302
               +   + + +R   +  +    V  ++    I+            V++      G+G 
Sbjct  731  GEGFG--YIVMFRPVGTTAWMKERVALVESSKFIYRNESIMPLSPFEVKVGVYNNEGEGS  788

Query  303  WS  304
             S
Sbjct  789  LS  790


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 46/310 (15%), Positives = 97/310 (31%), Gaps = 44/310 (14%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC-  96
              G  +++ C        A++ W                    L + +V   D+G+Y+C 
Sbjct  422  QVGGDISIECK-PNAFPKASISWKRGTENLKQSKRVLFLEDGSLKICNVTRADAGSYTCV  480

Query  97   --------YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVL  148
                      +G        ++ VPP +  ++         + C           T  VL
Sbjct  481  ATNQFGNGKSSGGLVVKERTIITVPPSKMDVTV---GESIVLPC-----QVSHDPTMEVL  532

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSC----QLAVPEGDSSFYIVSMCVASSVGSKFSK  204
             V  F      D ++   + +     S        +  G S  Y+ ++       S  + 
Sbjct  533  FVWYFNG-DIIDLKKGVAHFERIGGESVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVAD  591

Query  205  TQTFQGCGILQ--PDPPANITVTAVARNPRWLSVTWQD-PHSWNSSFYRLRFELRYRAER  261
                    I++  P PP ++ V  ++     L  +W+  P + +       F ++ R   
Sbjct  592  I-------IVRGPPGPPEDVKVEHISSTTSQL--SWRPGPDNNSP---IQIFTIQTRTPF  639

Query  262  SKTFTTW-----MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT  316
            S  +        ++    ++  +      + +  ++ A    G GE S+ S E + T  +
Sbjct  640  SVGWQAVATVPEILNGQTYNATVVGLSPWVEYEFRVVAGNNIGIGEPSKPS-ELLRTKAS  698

Query  317  ESRSPPAENE  326
                 P    
Sbjct  699  VPNVAPGNIN  708


> sp|P29320|EPHA3_HUMAN Ephrin type-A receptor 3 OS=Homo sapiens 
OX=9606 GN=EPHA3 PE=1 SV=2
Length=983

 Score = 58.7 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 35/220 (16%), Positives = 74/220 (34%), Gaps = 16/220 (7%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  P+         ++V+ +W               +   +        EPC  +    
Sbjct  325  PPSSPRN-VISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFL  383

Query  173  K------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPDPPANITV  224
                    +          + Y   +   + V    S  + F    I   Q  P   +T+
Sbjct  384  PRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTI  443

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
                 +   +S++WQ+P   + +   L +E++Y  ++ +  +  +++    +  I     
Sbjct  444  KKDRTSRNSISLSWQEPE--HPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKP  501

Query  285  GLRHVVQLRAQEEFGQGEWS-----EWSPEAMGTPWTESR  319
               +V Q+RA+   G G  S     E SP++       S+
Sbjct  502  DTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ  541


> sp|Q58EX2|SDK2_HUMAN Protein sidekick-2 OS=Homo sapiens OX=9606 
GN=SDK2 PE=1 SV=3
Length=2172

 Score = 59.1 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 60/381 (16%), Positives = 115/381 (30%), Gaps = 38/381 (10%)

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWG  135
                 +    +   G               +   VPPE    P           +V  ++ 
Sbjct  962   TTYTIEVAAMTSKGQ-------GQVSASTISSGVPPELPGPPTNLGISNIGPRSVTLQFR  1014

Query  136   PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
             P      + ++ ++  +       E++    Q S E    S ++       + Y   M  
Sbjct  1015  PGYDGKTSISRWLVEAQVGVVGEGEEWLLIHQLSNEPDARSMEVP-DLNPFTCYSFRMRQ  1073

Query  195   ASSVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFY--R  250
              + VG+   S+           PD  PAN+++   +     L + W        +     
Sbjct  1074  VNIVGTSPPSQPSRKIQTLQAPPDMAPANVSLRTASETS--LWLRWMPLPEMEYNGNPES  1131

Query  251   LRFELRYRAERS--KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
             + ++++Y       KT +  +   ++    I D      + VQ++A    G G WS    
Sbjct  1132  VGYKIKYSRSDGHGKTLSHVVQDRVERDYTIEDLEEWTEYRVQVQAFNAIGSGPWS---Q  1188

Query  309   EAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN----ATSLPVQDSSSVPL  364
               +G       S      VS      ++     + +     N       +  ++  S   
Sbjct  1189  TVVGRTRESVPSS-GPTNVSALATTSSSMLVRWSEVPEADRNGLVLGYKVMYKEKDSDTQ  1247

Query  365   PTF-LVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPV  423
             P F LV G S     L  +   + ++            +  HPP     L      P  +
Sbjct  1248  PRFWLVEGNSSRSAQLTGLGKYVLYEVQVLAFTRIGDGSPSHPPILERTLDDVPGPPMGI  1307

Query  424   LVP---------LISPPVSPS  435
             L P         +  PP +P+
Sbjct  1308  LFPEVRTTSVRLIWQPPAAPN  1328


 Score = 54.0 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 60/352 (17%), Positives = 110/352 (31%), Gaps = 37/352 (11%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             +   A+               T + G SV L C        A + W   +    S   +
Sbjct  391  TSTYLAVTSIAPNITRGPLD-STVIDGMSVVLACETSGAPRPA-ITWQKGERILASGSVQ  448

Query  74   W-----AGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDV---PPEEPQLSCF  122
                     G  LL+    + D+G Y+C      G    +  L+V       + PQ    
Sbjct  449  LPRFTPLESGS-LLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQSV  507

Query  123  RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE  182
             K   +++VC  G    P +T + +   +       E           S   S   +   
Sbjct  508  IKGTQASMVC--GVTHDPRVTIRYIWE-KDGATLGTESHPRIRLDRNGSLHISQTWSGDI  564

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
            G  +  ++      S G   S++   +   +  P  P +   T      R +++TW  P 
Sbjct  565  GTYTCRVI------SAGGNDSRSAHLRVRQL--PHAPEHPVATLSTVERRAINLTWTKPF  616

Query  243  SWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
              NS   R   E+   +E +  +T  +  V        +        +  +L A  + G+
Sbjct  617  DGNSPLIRYILEM---SENNAPWTVLLASVDPKATSVTVKGLVPARSYQFRLCAVNDVGK  673

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANAT  352
            G++S+   E +  P     +PP          A         I ++    + 
Sbjct  674  GQFSK-DTERVSLPEEPPTAPPQNVI------ASGRTNQSIMIQWQPPPESH  718


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/255 (14%), Positives = 80/255 (31%), Gaps = 25/255 (10%)

Query  54    DNATVHWVLRKPAAGSHPSRWAGMGRRLL--LRSVQLHDSGNYSCYRAGRPAGTVHL--L  109
             D     W++      S  ++  G+G+ +L  ++ +     G       G P+    L   
Sbjct  1245  DTQPRFWLVEG--NSSRSAQLTGLGKYVLYEVQVLAFTRIG------DGSPSHPPILERT  1296

Query  110   VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
             +D  P  P    F +   ++V   W P + P      ++L  +  +              
Sbjct  1297  LDDVPGPPMGILFPEVRTTSVRLIWQPPAAP----NGIILAYQITHRLNTTTANTATVEV  1352

Query  170   ESQKFSCQLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPPANITVTA  226
              +       A      S Y+  +   +  G   +  +   T +     +P PP+   V  
Sbjct  1353  LAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKRD--RPQPPSRPMVQQ  1410

Query  227   VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWS  284
                  R + ++W+      S      + ++ R   S  +      V       ++     
Sbjct  1411  EDVRARSVLLSWEPGSDGLSP--VRYYTIQTRELPSGRWALHSASVSHNASSFIVDRLKP  1468

Query  285   GLRHVVQLRAQEEFG  299
                +  +++A  + G
Sbjct  1469  FTSYKFRVKATNDIG  1483


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/148 (17%), Positives = 45/148 (30%), Gaps = 9/148 (6%)

Query  113   PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             PP  P +         +V+  W P S      +   +  +               S  + 
Sbjct  1402  PPSRPMVQQE-DVRARSVLLSWEPGSDGLSPVRYYTIQTREL-PSGRWALHSASVSHNAS  1459

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGI-LQPD-PPANITVTAVARN  230
              F      P    + Y   +   + +G      ++     +   PD  P  ++VT     
Sbjct  1460  SFIVDRLKP---FTSYKFRVKATNDIGDSEFSEESESLTTLQAAPDEAPTILSVTPHTTT  1516

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYR  258
                + + WQ P     +   L F +RYR
Sbjct  1517  S--VLIRWQPPAEDKINGILLGFRIRYR  1542


 Score = 34.0 bits (76),  Expect = 3.8, Method: Composition-based stats.
 Identities = 51/362 (14%), Positives = 105/362 (29%), Gaps = 69/362 (19%)

Query  112   VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPA-EDFQEPCQYSQE  170
             VP   P+      +  + +   W P      +    +   K     A          +  
Sbjct  1622  VPTAAPRNVVVHGATATQLDVTWEPPPLD--SQNGDIQGYKIYFWEAQRGNLTERVKTLF  1679

Query  171   SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
               + S +L    G  + Y+VS+   ++ G     T T        P  P+++  + +   
Sbjct  1680  LAENSVKLKNLTGY-TAYMVSVAAFNAAGDGPRSTPTQGQTQQAAPSAPSSVKFSELTTT  1738

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK-DLQHHC----VIHDAWSG  285
                ++V+W+ P     +     + L Y         + +V  D++ +      + D   G
Sbjct  1739  S--VNVSWEAPQ--FPNGILEGYRLVYEPCSPVDGVSKIVTVDVKGNSPLWLKVKDLAEG  1794

Query  286   LRHVVQLRAQEEFGQGE--------------------------------WSEWSPEAMGT  313
             + +  ++RA+      E                                WS   P     
Sbjct  1795  VTYRFRIRAKTFTYGPEIEANVTTGPGEGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPI  1854

Query  314   PWTESRSPPAENEVST------PMQALTTNKDDDNILFR-----------------DSAN  350
                   + P++  +        P +  +     D +                     S+ 
Sbjct  1855  TRYVIEARPSDEGLWDILIKDIPKEVSSYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSP  1914

Query  351   ATSLPVQDSSSV-PLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYS  409
             + S+P Q ++       FLV    +    +L +  VL  +   K  A K    +     +
Sbjct  1915  SQSVPAQKANPFYEEWWFLVVIALVGLIFILLLVFVLIIRGQSKKYAKKTDSGNSAKSGA  1974

Query  410   LG  411
             LG
Sbjct  1975  LG  1976


> sp|O94856|NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC 
PE=1 SV=4
Length=1347

 Score = 58.7 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 49/288 (17%), Positives = 94/288 (33%), Gaps = 39/288 (14%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC--  96
            G +V L C    +P    TV W+          +R       L +  V   D G+Y+C  
Sbjct  536  GTTVQLECRVKHDPSLKLTVSWLKDDEPLYIG-NRMKKEDDSLTIFGVAERDQGSYTCVA  594

Query  97   -YRAGRPAGTVHLLV------------DVP---PEEPQLSCFRKSPLSNVVCEWGPRSTP  140
                 +     +L V             +P   P+ P+          +V   W P    
Sbjct  595  STELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDAN  654

Query  141  SLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSV  198
            +   T  V+          + FQ    +       S   AV        Y   +   + V
Sbjct  655  NSPITDYVVQF------EEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEV  708

Query  199  GSKFSKTQTFQGCGILQPDPPA----NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE  254
            GS  S              PP     ++      +N   + +TW   ++ ++    LR+ 
Sbjct  709  GS--SHPSLPSERYRTSGAPPESNPGDVKGEGTRKNN--MEITWTPMNATSAFGPNLRYI  764

Query  255  LRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
            +++R   ++  +    V       V+      + + ++++A+ +FG+G
Sbjct  765  VKWRRRETREAWN--NVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKG  810


> sp|P43146|DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 
GN=DCC PE=1 SV=2
Length=1447

 Score = 58.7 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 47/122 (39%), Gaps = 4/122 (3%)

Query  186  SFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW  244
            + Y +     +  G    +   T      +   PP N+++  V  N R + V+W  P S 
Sbjct  592  TEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVV--NSRSIKVSWLPPPSG  649

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
              + +   +++R+R + ++      ++      +      G ++  Q+ A    G G  S
Sbjct  650  TQNGFITGYKIRHR-KTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPS  708

Query  305  EW  306
             W
Sbjct  709  NW  710


 Score = 49.4 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 64/203 (32%), Gaps = 8/203 (4%)

Query  160   DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVA-SSVGSKFSKTQTFQGCGILQPDP  218
              F    +Y  E        A     ++ Y  S+ V  +   S +S T             
Sbjct  888   SFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSA  947

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHH  276
             P ++TV      PR + V+WQ P   N     Y L + L  +      +    +   +  
Sbjct  948   PKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLD-KNIPIDDWIMETISGDRLT  1006

Query  277   CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
               I D      +  +++A+   G G  S+  P    T   E     A ++          
Sbjct  1007  HQIMDLNLDTMYYFRIQARNSKGVGPLSD--PILFRTLKVEHPDKMANDQGRHGD--GGY  1062

Query  337   NKDDDNILFRDSANATSLPVQDS  359
                D N++ R + N   +     
Sbjct  1063  WPVDTNLIDRSTLNEPPIGQMHP  1085


 Score = 49.4 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 66/368 (18%), Positives = 122/368 (33%), Gaps = 54/368 (15%)

Query  10   AALLAAPGA--ALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA  67
              +L+ PG    L   + P+  VA        G    L C  V      +  W+  +   
Sbjct  228  VRILSDPGLHRQLYFLQRPSNVVAIE------GKDAVLEC-CVSGYPPPSFTWLRGEEVI  280

Query  68   GSHPSRWAGMG-RRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP---EEPQLS  120
                 +++ +G   LL+ +V   DSG Y+C   Y+    + +  L V VPP     P   
Sbjct  281  QLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNL  340

Query  121  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
               +S      C    +  P        +       P++ FQ               L V
Sbjct  341  YAYESMDIEFECTVSGKPVP----TVNWMKNGDVVIPSDYFQ------IVGGSNLRILGV  390

Query  181  PEGDSSFYIVSMCVASSVGSKFSK-----TQTFQGCGILQPDPPANITVTAVARNPRWLS  235
             + D  FY       +  G+  +       +       + P  P ++    V  + R++ 
Sbjct  391  VKSDEGFY--QCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVV--PVLVSSRFVR  446

Query  236  VTWQDPHSWNSSF--YRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLR  293
            ++W+ P     +   + + F    R   ++       +       + +      +  ++ 
Sbjct  447  LSWRPPAEAKGNIQTFTVFFS---REGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVV  503

Query  294  AQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM---QALTTNKDDDNILFRDSAN  350
            A        ++EW P     P   +  P  E +V  P+   QA++T+     I +   A 
Sbjct  504  A--------YNEWGPGESSQPIKVATQP--ELQVPGPVENLQAVSTSPTSILITWEPPAY  553

Query  351  ATSLPVQD  358
            A   PVQ 
Sbjct  554  ANG-PVQG  560


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/236 (16%), Positives = 75/236 (32%), Gaps = 43/236 (18%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQ---YSQE  170
            P++P  S   +   + ++  W P   P++  +  ++     +  AE  +   +   YS E
Sbjct  726  PDQPS-SLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIE  784

Query  171  SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPAN---------  221
              + S            Y++S+   ++ G      ++     I  P  P +         
Sbjct  785  RLESSSH----------YVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFP  834

Query  222  -------------ITVTAVARNPRWLSVTWQD---PHSWNSSFYRLRFELRYRAERSKTF  265
                         + V AVA     + V+W D   P +  +S  RL + +R+R   S + 
Sbjct  835  TSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRL-YTVRWRTSFSASA  893

Query  266  TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
                                  +   +   +       S WS  A  T +  + + 
Sbjct  894  KYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRS---STWSMTAHATTYEAAPTS  946


> sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 
GN=unc-22 PE=1 SV=3
Length=7158

 Score = 58.7 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/285 (14%), Positives = 81/285 (28%), Gaps = 15/285 (5%)

Query  22    PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA---GMG  78
                 P        L    G  VT  C  +         W                  G  
Sbjct  5919  SGEGPKIVSPLSDLNEEVGRCVTFECE-ISGSPRPEYRWFKGCKELVDTSKYTLINKGDK  5977

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
             + L++  +   D+  Y+C                   +P++    K        + G   
Sbjct  5978  QVLIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPK-YHGGYEAQKGETI  6036

Query  139   TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV-SMCVASS  197
                +  KA            E  +   ++S  +      L +       Y    + V +S
Sbjct  6037  ELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENS  6096

Query  198   VGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
             VGS  S T       +  P+PP    +  +      + ++W+ P   +       + +  
Sbjct  6097  VGS-DSGTVNVTVADV--PEPPRFPIIENI--LDEAVILSWKPPA-LDGGSLVTNYTIEK  6150

Query  258   RAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQG  301
             R     +++       +  +  I    +G ++  ++ A+ + GQ 
Sbjct  6151  REAMGGSWS--PCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQS  6193


 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 43/328 (13%), Positives = 87/328 (27%), Gaps = 29/328 (9%)

Query  50    VEPEDNATVHWVLRKPAAGSHPSRWAGM--GRRLLLRSVQLHDSGNYSCYRA---GRPAG  104
             ++ E    V W       G   ++        R  L       SG Y+       G  + 
Sbjct  2703  IDGEPAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSV  2762

Query  105   TVHLLVDVPPEEPQLSCFRKSPLS-NVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE  163
             T+++ V   P +P+               +W P             + K           
Sbjct  2763  TINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIW--V  2820

Query  164   PCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGIL------QP  216
             PC      +       V   +    Y   +   +S G   S         IL      +P
Sbjct  2821  PC-----GRSGDTHFTVDSLNKGDHYKFRVKAVNSEG--PSDPLE-TETDILAKNPFDRP  2872

Query  217   DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
             D P          +   + + W  P S +       +++  R +  +      V   Q  
Sbjct  2873  DRPG--RPEPTDWDSDHVDLKWDPPLS-DGGAPIEEYQIEKRTKYGRWEPAITVPGGQTT  2929

Query  277   CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT  336
               + D      +  ++ A  + G  + S+ S   +  P       P  +  +     +  
Sbjct  2930  ATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKP---RNLKPHIDRDALKNLTIKA  2986

Query  337   NKDDDNILFRDSANATSLPVQDSSSVPL  364
              +     +      A ++      +  +
Sbjct  2987  GQSISFDVPVSGEPAPTVTWHWPDNREI  3014


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 45/318 (14%), Positives = 102/318 (32%), Gaps = 28/318 (9%)

Query  50    VEPEDNATVHWVLRKPAAGSHPSRWAGMG----RRLLLRSVQLHDSGNYS---CYRAGRP  102
             V  E   TV W         +  R          +L+++ ++  DSG ++       G  
Sbjct  2996  VSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGED  3055

Query  103   AGTVHLLVDVPPEEPQLSCFRKSPLS-NVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAED  160
               TV + V   P  P            +V   W  P     +  +   ++ K+  +    
Sbjct  3056  EATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIE-NYVIEKYDTASGRW  3114

Query  161   FQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
                    ++ +   +  +         Y   +   ++ G   S      G  + + DP  
Sbjct  3115  ----VPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEG--ESDPLETFGTTLAK-DPFD  3167

Query  221   NITVTAVARNPRW----LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW-MVKDLQH  275
                 T       W    + + W+ P + +       + +  + E S  +     V   Q 
Sbjct  3168  KPGKTNAPEITDWDKDHVDLEWKPPAN-DGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQT  3226

Query  276   HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
             +  + +   G ++  ++RA+ + G G+ S+       +   ++R+ P   + ++  +   
Sbjct  3227  NATVGNLKEGSKYEFRIRAKNKAGLGDPSD-----SASAVAKARNVPPVIDRNSIQEIKV  3281

Query  336   TNKDDDNILFRDSANATS  353
                 D ++    S   T 
Sbjct  3282  KAGQDFSLNIPVSGEPTP  3299


 Score = 54.0 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 44/306 (14%), Positives = 81/306 (26%), Gaps = 21/306 (7%)

Query  40    GDSVTLTCP-GVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYR  98
             G+ + +T P    P+ +  + W        +          +L++ S +  DSG      
Sbjct  4461  GEPLVITIPFTASPQPD--ISWTKEGGKPLAGV-ETTDSQTKLVIPSTRRSDSGPVKIKA  4517

Query  99    A---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
                 G     + + V   P  P+   +           W           A +   K + 
Sbjct  4518  VNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDG---GAEIAGYKIEY  4574

Query  156   SPAEDFQEPCQYSQESQ-KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL  214
                                 +            Y   +   ++VG   S         I 
Sbjct  4575  QEVGSQIW---DKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVG--LSDYCQGVPVVIK  4629

Query  215   QP-DPPANITVTAVARNPR-WLSVTWQDPHSWNSSFYRLRFEL-RYRAERSKTFTTW-MV  270
              P DPP   +   +       +S+ W  P   +     L + + R+       +    M 
Sbjct  4630  DPFDPPGAPSTPEITGYDTNQVSLAWNPPRD-DGGSPILGYVVERFEKRGGGDWAPVKMP  4688

Query  271   KDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTP  330
                   C++        +  ++RA    G GE S  S      P+ E    P    V   
Sbjct  4689  MVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKI  4748

Query  331   MQALTT  336
              +    
Sbjct  4749  TKNSAE  4754


 Score = 51.0 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 63/206 (31%), Gaps = 28/206 (14%)

Query  131   VCEWGPRST--PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ--ESQKFSCQLAVPEGDSS  186
                W P         T  ++         A+D     +Y +  +    +  L V    + 
Sbjct  1907  TLSWNPPDDDGGDPLTGYIV--------EAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNK  1958

Query  187   -FYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP-----RWLSVTWQD  240
               Y   +   ++ G   S+  +      ++   P +                 + + W+ 
Sbjct  1959  GNYKFRVKAVNNEG--ESEPLSADQYTQIKD--PWDEPGKPGRPEITDFDADRIDIAWEP  2014

Query  241   PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
             PH  +       + +  R   +K +         +   I     G  +  ++RA  + G 
Sbjct  2015  PHK-DGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNAS-ISGLKEGKEYQFRVRAVNKAGP  2072

Query  301   GEWSEWSPEAMGTPWTESRSPPAENE  326
             G+ SE S + +  P    +  PA  +
Sbjct  2073  GQPSEPSEKQLAKP----KFIPAWLK  2094


 Score = 47.1 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 40/320 (13%), Positives = 84/320 (26%), Gaps = 35/320 (11%)

Query  23    RRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS---RWAGMGR  79
                P   V               TC  V   +     W+                +    
Sbjct  5530  GSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTA-RWLRNGRELPESSRYRFEASDGVY  5588

Query  80    RLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP  136
             +  ++ V   D+G Y+   +   G    T +L+V  PP         K   + ++     
Sbjct  5589  KFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPP------VIEKDVPNTILPSGDL  5642

Query  137   RSTPSLTTKAVLLVRK-FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD--SSFYIVSMC  193
                    +           N    D   P     E       + +P      +       
Sbjct  5643  VRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDH-ILITIPALSVREAGRYEYTV  5701

Query  194   VASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                S  +         G     P+ P   + ++ +   P   +++W+ P + +       
Sbjct  5702  SNDSGEATTGFWLNVTGL----PEAPQGPLHISNIG--PSTATLSWRPPVT-DGGSKITS  5754

Query  253   FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
             + +  R      + T        + ++   +    +  ++ AQ E G G     +P    
Sbjct  5755  YVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIG-----APLVSE  5809

Query  313   TPWT-----ESRSPPAENEV  327
              P       +  + P   E+
Sbjct  5810  HPIIARLPFDPPTSPLNLEI  5829


 Score = 46.0 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 31/194 (16%), Positives = 60/194 (31%), Gaps = 16/194 (8%)

Query  114   PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
             P +P+    R    +    EW P             V+    S           S++   
Sbjct  5331  PNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIG-YQVQYRDTSSGRWINAKMDLSEQCHA  5389

Query  174   FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ-----PDPPANITVTAVA  228
                      G+  F I+     ++ G  FSK         L+     P PP ++   ++ 
Sbjct  5390  -RVTGLRQNGEFEFRII---AKNAAG--FSKPSPPSERCQLKSRFGPPGPPIHVGAKSIG  5443

Query  229   RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLR  287
             RN    ++TW  P   +       + +  R   S  +T     +++     +        
Sbjct  5444  RN--HCTITWMAPLE-DGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFND  5500

Query  288   HVVQLRAQEEFGQG  301
             +  ++ A    G+G
Sbjct  5501  YEFRVVAINAAGKG  5514


 Score = 40.9 bits (94),  Expect = 0.032, Method: Composition-based stats.
 Identities = 22/171 (13%), Positives = 54/171 (32%), Gaps = 13/171 (8%)

Query  191   SMCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFY  249
              + V + +G        F+     +P  P   + V+ V ++     + W+ P   +    
Sbjct  4221  KLKVKNELG---EDEAIFEVIVQDRPSAPEGPLEVSDVTKDS--CVLNWKPPKD-DGGAE  4274

Query  250   RLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
                + +  R  ++ T+             +     G  +  ++ A+  FG+ +       
Sbjct  4275  ISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEP  4334

Query  310   AMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
              +      +   P   E+      + T+ D  +I +    +    PV    
Sbjct  4335  VLAKDPFGTPGKPGRPEI------VDTDNDHIDIKWDPPRDNGGSPVDHYD  4379


 Score = 40.6 bits (93),  Expect = 0.041, Method: Composition-based stats.
 Identities = 25/187 (13%), Positives = 57/187 (30%), Gaps = 26/187 (14%)

Query  178   LAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSV  236
              +   GD+  Y + +   +  G   +         +  P  P   + +  + +     ++
Sbjct  3918  FSAVRGDTGVYKIIVE--NEHGK-DTAQCNVTVLDV--PGTPEGPLKIDEIHKEG--CTL  3970

Query  237   TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQE  296
              W+ P   N     L + +        T+             ++    G  +  +++A  
Sbjct  3971  NWKPPTD-NGGTDVLHYIVEKMDTSRGTWQEVGTFP-DCTAKVNKLVPGKEYAFRVKAVN  4028

Query  297   EFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPM-----QALTTNKDDDNILFRDSANA  351
               G+ +           P        A+N+   P      +    +KD  +I +  +AN 
Sbjct  4029  LQGESK-----------PLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANN  4077

Query  352   TSLPVQD  358
                PV  
Sbjct  4078  GGAPVTG  4084


 Score = 39.8 bits (91),  Expect = 0.070, Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 58/169 (34%), Gaps = 15/169 (9%)

Query  191   SMCVASSVGSKFSKTQTFQGCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFY  249
              +   +  G    K           P  P   I  T +  +   ++++W+ P   ++   
Sbjct  4911  KISATNKYGKDTCK-LNVFVLD--APGKPTGPIRATDIQADA--MTLSWRPPK--DNGGD  4963

Query  250   RLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
              +   +  +      + T     +     + +  +   +  ++RA+ ++G GE  E    
Sbjct  4964  AITNYVVEKRTPGGDWVTVG-HPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDA  5022

Query  310   AMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD  358
              +     ++   P + E      A+ T+++   + +    +    P+Q 
Sbjct  5023  IVAKNPFDTPGAPGQPE------AVETSEEAITLQWTRPTSDGGAPIQG  5065


 Score = 39.8 bits (91),  Expect = 0.073, Method: Composition-based stats.
 Identities = 40/269 (15%), Positives = 82/269 (30%), Gaps = 42/269 (16%)

Query  192   MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS----  247
             + + +S GS  S +   +     +P  P +I V  +A  P   ++ W  P S   S    
Sbjct  5208  VELENSQGS-DSASIRLKVVD--KPASPQHIRVEDIA--PDCCTLYWMPPSSDGGSPITN  5262

Query  248   FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
             +   + +LR+       +          +  +       R+  ++RA+ ++G  E     
Sbjct  5263  YIVEKLDLRH---SDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSE-----  5314

Query  308   PEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTF  367
                   P   +    A+ +   P Q       D +  + +                +  +
Sbjct  5315  ------PCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPR----DGGSKIIGY  5364

Query  368   LVAGGSLAFGTLL---------CIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERP  418
              V     + G  +         C A V   ++  +       K +       G   P  P
Sbjct  5365  QVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAA------GFSKPSPP  5418

Query  419   RPTPVLVPLISPPVSPSSLGSDNTSSHNR  447
                  L     PP  P  +G+ +   ++ 
Sbjct  5419  SERCQLKSRFGPPGPPIHVGAKSIGRNHC  5447


> sp|Q8AV57|SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 
GN=SDK2 PE=1 SV=2
Length=2177

 Score = 58.7 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/238 (16%), Positives = 71/238 (30%), Gaps = 24/238 (10%)

Query  79    RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSC---FRKSPLSNVVCEWG  135
                 +    +   G            +  +   VPPE P              +V  ++ 
Sbjct  967   TTYTIEVAAMTSKGQ-------GQVSSSTISSGVPPELPGAPTNLGISNIGPRSVTLQFR  1019

Query  136   PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCV  194
             P      +  +   V        E  +    +   ++  +  L VP  +  ++Y   M  
Sbjct  1020  PGYDGKTSI-SRWQVEAQVGQNGEAEEWGLVHQLANEPDARSLEVPNLNPYTYYSFRMRQ  1078

Query  195   ASSVGSKF-SKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFY---  249
              + VG+   S            PD  PAN+T+   +     L + W         +    
Sbjct  1079  VNIVGTSPPSLPSRRIQTLQAPPDVAPANVTLRTASETS--LWLRWMP--LLEQEYNGNP  1134

Query  250   -RLRFELRYRAERS--KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
               + + +RY       +     +   ++    I D      + VQ++A    G G WS
Sbjct  1135  DSVGYRIRYLRSDGQGRAVVHVIHDRVEREYTIEDLEEWTEYRVQVQAFNAIGSGPWS  1192


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/248 (15%), Positives = 72/248 (29%), Gaps = 23/248 (9%)

Query  60    WVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLL---VDVPPEE  116
             W+     + S      G      +R +     G       G P     +L   +D  P  
Sbjct  1256  WLAEGNTSRSAQLTGLGKFMLYEIRVLAFTRIG------DGVP-SRPPILERTLDDVPGP  1308

Query  117   PQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
             P    F +   ++V   W P + P+    A  L  +   + A                  
Sbjct  1309  PVGMLFPEVRTTSVRLIWQPPTAPNGIILAYQLTHRLNTTTANAAVSE----VLGPSTRQ  1364

Query  177   QLAVPEGDSSFYIVSMCVASSVG---SKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
               A      + Y+ S+   +  G   +  +   T +     +P PP+   V       R 
Sbjct  1365  YTATGLQPEATYLFSITAQTRKGWGEAAEALVVTTEKRD--RPQPPSKPLVRQEDVRARS  1422

Query  234   LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK--DLQHHCVIHDAWSGLRHVVQ  291
             + ++W+      S      + ++ R   S  +              V+        +  +
Sbjct  1423  VLLSWEPGSDGLSP--VRFYTVQTRELPSGEWALHPASISHNATAFVVDRLKPFTSYKFR  1480

Query  292   LRAQEEFG  299
             ++A  + G
Sbjct  1481  VKATNDIG  1488


 Score = 46.0 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 31/149 (21%), Positives = 49/149 (33%), Gaps = 11/149 (7%)

Query  113   PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             PP +P L         +V+  W P S      +    V+  +    E    P   S  + 
Sbjct  1407  PPSKP-LVRQEDVRARSVLLSWEPGSDGLSPVR-FYTVQTRELPSGEWALHPASISHNAT  1464

Query  173   KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP---PANITVTAVAR  229
              F      P    + Y   +   + +G      ++      LQ  P   P  ++VT    
Sbjct  1465  AFVVDRLKP---FTSYKFRVKATNDIGDSEYSEESESLTT-LQAAPEEAPTILSVTPHTT  1520

Query  230   NPRWLSVTWQDPHSWNSSFYRLRFELRYR  258
                 + + WQ P     +   L F LRYR
Sbjct  1521  TS--VLIRWQPPSEDKINGILLGFRLRYR  1547


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 60/351 (17%), Positives = 110/351 (31%), Gaps = 43/351 (12%)

Query  18   AALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW---  74
             A+           +   T + G SV L C        A + W   +    S   +    
Sbjct  400  LAVTSIAPNITRGPQD-STVIDGMSVILNCETSGAPRPA-ITWQKGERILASGSVQLPRF  457

Query  75   -AGMGRRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLV-------DVPPEEPQLSCFR  123
                   LL+    L D+G Y+C      G    +  L+V       D P ++  +    
Sbjct  458  TLLESGSLLVSPAHLTDAGTYTCLATNSRGVDEASADLVVWARTRITDPPQDQSVI----  513

Query  124  KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG  183
            K   +++ C  G    PS+  + +    +   +P      P     E+           G
Sbjct  514  KGTKASMSC--GVTHDPSVDVRYIW---EKDGAPLGTESGPRLRLDETGTLHISQTW-SG  567

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHS  243
            D   Y   +  A   G   S++   +   +  P  P +          R +++TW  P  
Sbjct  568  DIGTYTCKVLSA---GGNDSRSAHLRVRQL--PHAPESPVAVLSPLEKRAINLTWAKPFD  622

Query  244  WNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
             NS   R   E+   +E +  +T  +  V       V+        +  +L A  + G+ 
Sbjct  623  GNSPLLRYLVEI---SENNAPWTVLLASVDPELTWVVVRGLVPARSYQFRLCAVNDVGRS  679

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANAT  352
            ++S+   E +  P     +PP          A         I ++    + 
Sbjct  680  QFSK-DTERVSLPEEPPFAPPQNVI------ASGRTNQSIMIQWQPPPESH  723


 Score = 39.4 bits (90),  Expect = 0.088, Method: Composition-based stats.
 Identities = 39/261 (15%), Positives = 78/261 (30%), Gaps = 21/261 (8%)

Query  48    PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGR--RLLLRSVQLHDSGNYSCYRAGRPAGT  105
             PG    +   V+ V               + +  R  +R    +  G       G P+  
Sbjct  1565  PGATWAELTPVYAVHNLSEVSLTQYELDNLSKHRRYEIRMSVYNAVGE------GPPSPP  1618

Query  106   VHLLVD--VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQE  163
               + V   +P   PQ    + +  + +   W P   P+ +    +   K     A+   E
Sbjct  1619  QEVFVGEAMPTGAPQNVAVKAATATQLDVTWEP--PPTESQNGDIQGYKIHFWEAQRQNE  1676

Query  164   PCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
               +        +          + Y VS+   ++ G     T          P  P +I 
Sbjct  1677  SARVKTLFLPETGVKLKNLTGYTSYWVSIAAFNAAGDGPRSTPVTARTQQAAPSAPGSIR  1736

Query  224   VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA----ERSKTFTTWMVKDLQHH-CV  278
              + +      ++V+W+ P     +     + L Y      +      T  VK        
Sbjct  1737  FSELTTTS--VNVSWEPPP--LPNGILEGYRLVYEPCMPVDGVSKIVTVDVKGNSPLWMK  1792

Query  279   IHDAWSGLRHVVQLRAQEEFG  299
             + D   G+ +  ++RA+    
Sbjct  1793  VKDLAEGITYRFRIRAKTFAY  1813


> sp|Q98949|TYRO3_CHICK Tyrosine-protein kinase receptor TYRO3 
OS=Gallus gallus OX=9031 GN=TYRO3 PE=1 SV=1
Length=873

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 50/280 (18%), Positives = 84/280 (30%), Gaps = 39/280 (14%)

Query  40   GDSVTLTC-------PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSG  92
            G  V L C       P +    +  V   + +         W G    L L+SV+  DSG
Sbjct  45   GQPVKLNCSLEGMEDPEMLWIKDGAVVQSVDQVYIPVDEDHWIG---FLSLKSVERTDSG  101

Query  93   NYSCYR--AG--RPAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVCEWGPRSTPSLTTK  145
             Y C     G    +  V L+V+  P    EP+      +   ++ C       P   T 
Sbjct  102  KYWCQVENGGKKEESQQVWLIVEGVPYFTVEPEDVSVSPNAPFHMAC--AAVGPPEPVTI  159

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT  205
               +       P      P   +      S   +                +  G   S+T
Sbjct  160  VWWMGDSRVGLPD---ISPSILNVSGINQSTMFSC------------EAHNVKGLSSSRT  204

Query  206  QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
             T Q   +  P PP N+TV+ V       SV W       +  +    ++    +  +  
Sbjct  205  ATVQIKAM--PLPPLNVTVSQV--TSSNASVVWVPGFDGRAPLHSCTLQVAESPDGQEVS  260

Query  266  TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            T            +        + V+++   E G   ++E
Sbjct  261  TEVAPVPP-FAYGVQGLKHSTNYSVRVQCSNEMGSSPFTE  299


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 56/321 (17%), Positives = 97/321 (30%), Gaps = 45/321 (14%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   V    ++  P     + C  V P +  T+ W +     G      +      +L  
Sbjct  127  PYFTVEPEDVSVSPNAPFHMACAAVGPPEPVTIVWWMGDSRVGLPDISPS------ILNV  180

Query  86   VQLHDSGNYSCY----RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPS  141
              ++ S  +SC     +    + T  + +   P  P      +   SN    W P     
Sbjct  181  SGINQSTMFSCEAHNVKGLSSSRTATVQIKAMPLPPLNVTVSQVTSSNASVVWVPGFDG-  239

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
               +A L     Q + + D QE          F+  +      S+ Y V +  ++ +GS 
Sbjct  240  ---RAPLHSCTLQVAESPDGQEVSTEVAPVPPFAYGVQG-LKHSTNYSVRVQCSNEMGSS  295

Query  202  -FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ--DPHSWNSSFYRLRFELRYR  258
             F++   FQ   +     P NI V         L + W+   P         L + L   
Sbjct  296  PFTERVYFQTLELAPSSTPQNIHVIQRDPG---LVLEWEGVAPDVLKE--NVLGYRL---  347

Query  259  AERSKTFTTWMVKDLQ-----HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW----SPE  309
                  +    V   +         +         ++++      G G WS+     + E
Sbjct  348  -----EWIQDNVTQGEMIVQDTKANLTTWNPLKDLIIRVCVLNSAGCGPWSDLFLLEAQE  402

Query  310  AMGTPWTESRSPPAENEVSTP  330
             MG      R PP       P
Sbjct  403  VMG----GQRQPP-YGTSWVP  418


> sp|P54756|EPHA5_HUMAN Ephrin type-A receptor 5 OS=Homo sapiens 
OX=9606 GN=EPHA5 PE=1 SV=3
Length=1037

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 67/205 (33%), Gaps = 20/205 (10%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  P+ +       ++V  EW P +           +   + +      E C       
Sbjct  357  PPSAPRNA-ISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYL  415

Query  173  K------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKT---QTFQG---CGILQPDPPA  220
                    +  + V     + Y   +   +  G         Q            P P  
Sbjct  416  PRQSGLKNTSVMMVDLLAHTNYTFEIEAVN--GVSDLSPGARQYVSVNVTTNQAAPSPVT  473

Query  221  NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH  280
            N+    +A+N   +S++WQ+P     +   L +E++Y  +  +T  T  +K  +      
Sbjct  474  NVKKGKIAKNS--ISLSWQEPD--RPNGIILEYEIKYFEKDQETSYTI-IKSKETTITAE  528

Query  281  DAWSGLRHVVQLRAQEEFGQGEWSE  305
                   +V Q+RA+   G G +S 
Sbjct  529  GLKPASVYVFQIRARTAAGYGVFSR  553


> sp|P52179|MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 
PE=1 SV=2
Length=1685

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 48/372 (13%), Positives = 102/372 (27%), Gaps = 65/372 (17%)

Query  33   GVLTSLPGDSVTLTCPGVEPED----NATVHWVLRKPAAGSH---PSRWAGMGRRLLLRS  85
             V     G++++L C  V   +       + W              + W+G    L    
Sbjct  412  DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH  471

Query  86   VQLHDSGNYSCY-RAGRPAGTVHLLV----------DVPPEEPQLSCFRKSPLSNVVCEW  134
            +   D G Y+   R G         V            P     + C   +    ++   
Sbjct  472  LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK  531

Query  135  GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV  194
             P            + +    + +      C       KF+        +   YI  +  
Sbjct  532  QPAVDGGSPILGYFIDKCEVGTDSWS---QCND--TPVKFARFPVTGLIEGRSYIFRVRA  586

Query  195  ASSVG----SKFSKTQ-----------------TFQGCGILQ---------PDPPANITV  224
             + +G    S+ S+                    + G  I+          P PP +++V
Sbjct  587  VNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSV  646

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHDA  282
            T       ++ ++W+ P         + + +      ++ +      +        + D 
Sbjct  647  T--EATRSYVVLSWKPPGQ--RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL  702

Query  283  WSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDN  342
              G  +  ++R     G GE SE +   +     +    P +   S              
Sbjct  703  AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV------  756

Query  343  ILFRDSANATSL  354
            + + +S +A  L
Sbjct  757  VSWEESKDAKEL  768


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 51/324 (16%), Positives = 110/324 (34%), Gaps = 30/324 (9%)

Query  14    AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             AA G  ++P  CPA     G LT+  G     + P  + +       +  KP   S PS 
Sbjct  833   AAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDAL-----LGSKPNKPSLPSS  887

Query  74    WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTV---HLLVD---VPPEEPQLSCFRKSPL  127
                +G+  + +  +          +   P G      L       PP  P      +S  
Sbjct  888   SQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFR  947

Query  128   SNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
              ++V  W  P        T   +  R+  +     ++E      ++            ++
Sbjct  948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREAN---VKAVSEEAYKISNLKEN  1004

Query  186   SFYIVSMCVASSVG----SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
               Y   +   +  G    S  S+    +   I  P PP ++  + V ++   L + W+ P
Sbjct  1005  MVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDS--LVLQWKPP  1062

Query  242   ----HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC-VIHDAWSGLRHVVQLRAQE  296
                  +  + ++    +L+    +   +       +++    +     G+ +V ++RA  
Sbjct  1063  VHSGRTPVTGYFV---DLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN  1119

Query  297   EFGQGEWSEWSPEAMGTPWTESRS  320
             + G G+ S+ +   +      ++ 
Sbjct  1120  QAGVGKPSDLAGPVVAETRPGTKE  1143


> sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase 
F OS=Bos taurus OX=9913 GN=PTPRF PE=2 SV=1
Length=1898

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 48/327 (15%), Positives = 96/327 (29%), Gaps = 33/327 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV LTC  V       V W++             G   R +L  
Sbjct  232  PRFSIPPSSQEVMPGGSVNLTCVAVGAP-MPYVKWMMGAEELTKEDEMPVG---RNVLEL  287

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G    T  + V   P+ P      ++  ++V   W        
Sbjct  288  SNVVRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSG-NSEP  346

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
             +   +  R        +          + ++S     P  +   Y   +   +S+G   
Sbjct  347  VSYYGIQYR----PAGAEGPFQEVDGVATTRYSIGGLSPFSE---YAFRVLAVNSIGRGP  399

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
             S+    +        PP  +    ++ +     V W+ P     +     + + Y  + 
Sbjct  400  PSEAVRARTGEQAPSSPPRRVQARMLSASTML--VQWEPPE--EPNGLVRGYRVYYTPDS  455

Query  262  SK---TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES  318
             +    +      D      +     G+ + +++ A    G G      P +        
Sbjct  456  RRPLSAWHKHN-TDAGLLTTVGSLLPGITYSLRVLAFTAVGDG------PPSPTIQVKTQ  508

Query  319  RSPPAENEVSTPMQALTTNKDDDNILF  345
            +  PA+       QA   +     + +
Sbjct  509  QGVPAQ---PADFQAEVDSDTRIQLSW  532


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 98/319 (31%), Gaps = 37/319 (12%)

Query  44   TLTCPGVEPEDNATVHWVLR----KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA  99
             L   G  P+    + W        PAA +   +    G  L + S +  D G Y C   
Sbjct  154  MLCAAGGNPD--PEISWFKDFLPVDPAASNGRIKQLRSGA-LQIESSEESDQGKYECVAT  210

Query  100  GRPAGT----VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQN  155
                       +L V V    P+ S    S          P  + +LT  AV     +  
Sbjct  211  NSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEV------MPGGSVNLTCVAVGAPMPYVK  264

Query  156  SPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
                  +   +      +   +L+     +++   +    SS+G   +   T Q      
Sbjct  265  WMMGAEELTKEDEMPVGRNVLELSNVVRSANY---TCVAISSLGMIEA---TAQVTVKAL  318

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
            P PP ++ VT        +++TW   +S   S+    + ++YR   ++     +      
Sbjct  319  PKPPIDLVVTETTATS--VTLTWDSGNSEPVSY----YGIQYRPAGAEGPFQEVDGVATT  372

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
               I        +  ++ A    G+G  SE           ++ S P        +QA  
Sbjct  373  RYSIGGLSPFSEYAFRVLAVNSIGRGPPSE---AVRARTGEQAPSSP-----PRRVQARM  424

Query  336  TNKDDDNILFRDSANATSL  354
             +     + +        L
Sbjct  425  LSASTMLVQWEPPEEPNGL  443


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 59/179 (33%), Gaps = 10/179 (6%)

Query  183  GDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
               + Y +++   ++ G    SK +     G + P  P  + V+  A N   L   W  P
Sbjct  779  TPETTYSITVAAYTTKGDGARSKPKIVTTTGAV-PGRPT-MMVSTTAMNTALL--QWHPP  834

Query  242  HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                     L + L+YR       +T        H  +     G  ++ +L A+   G G
Sbjct  835  KELPGE--LLGYRLQYRRADEARPSTIDFGKDDQHFTVTGLHKGATYIFRLTAKNRAGLG  892

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
            E  E+  E   TP       P    V     + T    D  +L   +   T+  V    
Sbjct  893  E--EFEKEIT-TPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRD  948


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/204 (17%), Positives = 59/204 (29%), Gaps = 10/204 (5%)

Query  151  RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG  210
             +     AED  E  Q+       S          + Y   +   S +G           
Sbjct  543  YELVYWAAED--EGQQHKVTFDPTSSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEAR  600

Query  211  CGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
                 P  PP    VT V+     + V+W  P + + +    ++ + Y A   +     +
Sbjct  601  TAQSTPSAPPQ--KVTCVSVGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHV  658

Query  270  VKDLQ---HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
            V  +        +        + V +RA  + G G  S  SP  + T       PP + E
Sbjct  659  VDGIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPES--SPVLVRTDEDVPSGPPRKVE  716

Query  327  VSTPMQALTTNKDDDNILFRDSAN  350
            V               +  +    
Sbjct  717  VEPLNSTAVRVSWKLPVPSKQHGQ  740


> sp|A2ABU4|MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 
PE=1 SV=1
Length=1439

 Score = 57.9 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/196 (14%), Positives = 63/196 (32%), Gaps = 12/196 (6%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            P  P          + +V  W P             + +  +  ++      Q       
Sbjct  702  PSAPYDFALLNCGKNEMVIGWKPPKRRGGGKILGYFMDQHDSVESDWHPVNRQ---PIPS  758

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCG---ILQPDPPANITVTAVAR  229
              C++     +  FY       +  G    S   +   C    + +P PP ++ V+ V  
Sbjct  759  RVCKVTNLH-EGHFYEFRARAVNWAGIGELSAPSSLFECKEWTMPEPGPPYDVRVSEVQA  817

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRH  288
                + + W+ P    +      + + ++ + S+ +           H  + D   G ++
Sbjct  818  TS--VMLQWEPPLYIGAGPVT-GYHVSFQEKGSEEWKPVTPDATSDTHLRVSDLQPGKQY  874

Query  289  VVQLRAQEEFGQGEWS  304
            + +++A    G G+ S
Sbjct  875  MFRVQAMNSAGLGQPS  890


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 48/343 (14%), Positives = 95/343 (28%), Gaps = 57/343 (17%)

Query  41   DSVTLTCPGVEP--EDNATVHWVLRKPAAGSHPSR-WAGMGRRLLLRSVQL--HDSGNYS  95
            +  +LTC   +   E    + W        S   R      R+  ++       D G Y+
Sbjct  286  EPFSLTCLFSDDVLEAEQRIQWYRDGRLLRSSTRRQILYADRQASVKVSCAYKEDEGFYT  345

Query  96   CYRAG-----RPAGTVHLLVDVP-----PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK  145
               +        +  V +          P  P            +   W P S       
Sbjct  346  IRVSSPFGPQEQSAYVFIRDAAAEKPGAPGSPLNVRCLNVHRDCLTLTWVPPSDTR---G  402

Query  146  AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL--------------AVPEGDSSFYIVS  191
            + +     +    +  +             C +              A+ +  +S    +
Sbjct  403  STITGYSIEMCQGDSEEWMPCLKAPGGTCRCPIQGLVEGQSYQFRVRAISKAGTSLPSKA  462

Query  192  MCVAS---------------SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
                                 +GSK + ++      +  P  P N+  + +     +  +
Sbjct  463  SEAVVTGDYDAVHKSTEIPYDLGSKITISKNDFEDAVTIPSAPTNVHASEIREA--YAVL  520

Query  237  TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD--LQHHCVIHDAWSGLRHVVQLRA  294
            +W++P         L + L      S T+     +         + D   G  +V ++RA
Sbjct  521  SWEEPR--PRGRAPLTYTLEKSVIGSGTWEAISTETPIKSPRFALLDLEKGKSYVFRVRA  578

Query  295  QEEFGQGEWSEWSPEAM--GTPWTESRSPPAENEVSTPMQALT  335
              ++G  + SE S      G P T    PPA+ +     Q   
Sbjct  579  LNQYGMSDPSEPSEPVALKGKPATLP--PPAQVQAFRNTQTSV  619


 Score = 42.9 bits (99),  Expect = 0.007, Method: Composition-based stats.
 Identities = 45/282 (16%), Positives = 83/282 (29%), Gaps = 18/282 (6%)

Query  49   GVEPEDNATVHWVLRKPAAGSHPSRWAGM----GRRLLLRSVQLHDSGNYSCYRAGRPAG  104
             +E     +  W            R+A +    G+  + R   L+  G         P  
Sbjct  536  TLEKSVIGSGTWEAISTETPIKSPRFALLDLEKGKSYVFRVRALNQYGMSDPSEPSEPVA  595

Query  105  TVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
                   +PP   Q+  FR +  ++V   W P    S      +  R+   S  +     
Sbjct  596  LKGKPATLPP-PAQVQAFRNT-QTSVSLAWEPVDGGSELLGYYIYSREAGASEWQTVNN-  652

Query  165  CQYSQESQKFSCQLAVPEGDSSF-YIVSMCVASSVGSKFSKTQTFQGCGIL-QPDPPANI  222
                +  Q     +        + + +     + VG   + TQ  +    L  P  P + 
Sbjct  653  ----KPIQDTKFTVPGLRTGKEYDFCIRSVSEAGVGESSAATQPVRVKQALATPSAPYDF  708

Query  223  TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHD  281
             +    +N   + + W+ P         L + +         +     + +    C + +
Sbjct  709  ALLNCGKNE--MVIGWKPPKR-RGGGKILGYFMDQHDSVESDWHPVNRQPIPSRVCKVTN  765

Query  282  AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWT-ESRSPP  322
               G  +  + RA    G GE S  S       WT     PP
Sbjct  766  LHEGHFYEFRARAVNWAGIGELSAPSSLFECKEWTMPEPGPP  807


> sp|P22648|FAS2_SCHAM Fasciclin-2 OS=Schistocerca americana OX=7009 
GN=FAS2 PE=1 SV=2
Length=898

 Score = 57.9 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 51/308 (17%), Positives = 100/308 (32%), Gaps = 30/308 (10%)

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAGRPAGTVHLLVDVPP---EEPQLSCF  122
              P     +G+ L++ +V   D G Y C    + G      HL+V+  P   + PQ   +
Sbjct  381  DSPDGRTRIGK-LIISNVLRSDDGLYECIATNKGGEVKKNGHLMVEFKPSFADTPQKEVW  439

Query  123  R-KSPLSNVVCEWGPRSTPSLTTKAVLLVRK-FQNSPAEDFQEPCQYSQESQKFSCQLAV  180
              +    N+ C     S P+ T          F+    ++ Q+       S   S    +
Sbjct  440  GWEQHAVNLTC--LAHSIPNATISWHFNGADLFRGREGQELQQTGYTLFGSGPRSTLQVI  497

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            P     +        +  G+   +    +        P A + V         ++  +  
Sbjct  498  PFNRKMYGNYKCTATNKHGTAVHEIMLREARV-----PSAVLQVKMDVMTATTVTFKFFG  552

Query  241  PHSWNSSFYRLR-FELRYRAERSKTFT-----TWMVKDLQHHCVIHDAWSGLRHVVQLRA  294
            P   N      + + ++Y+ + S+ +      TW V       ++ +     R+  +  A
Sbjct  553  PG--NDGGLPTKNYAVQYK-QDSQGWEDALNRTWPVD---SPYILENLKPQTRYNFRFAA  606

Query  295  QEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
            Q E G G WS  S +   TP   +   P    +     + T N+   +           +
Sbjct  607  QNEVGFGPWS--SQQTHTTPRISAPEEPRLLGLPLSATSGTENEVVVSPYPNRYELRWQV  664

Query  355  PVQDSSSV  362
            P  +   +
Sbjct  665  PADNGEPI  672


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 45/298 (15%), Positives = 78/298 (26%), Gaps = 50/298 (17%)

Query  43   VTLTCPGVEPEDNATVHWVLRKPAA--GSHPSRWAGMGRRL-------LLRSVQLHDS--  91
            V LTC       NAT+ W         G         G  L        L+ +  +    
Sbjct  446  VNLTC-LAHSIPNATISWHFNGADLFRGREGQELQQTGYTLFGSGPRSTLQVIPFNRKMY  504

Query  92   GNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVC----EWGPRSTPSLTT-KA  146
            GNY C    +    VH ++      P      K  +          +GP +   L T   
Sbjct  505  GNYKCTATNKHGTAVHEIMLREARVPSAVLQVKMDVMTATTVTFKFFGPGNDGGLPTKNY  564

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVG-SKFSKT  205
             +  ++      +               S  +       + Y       + VG   +S  
Sbjct  565  AVQYKQDSQGWEDALNRTWPV------DSPYILENLKPQTRYNFRFAAQNEVGFGPWSSQ  618

Query  206  QTFQGCGILQPDPPA--NITVTA---------VARNPRWLSVTWQDPHSWNSS--FYRLR  252
            QT     I  P+ P    + ++A         V+  P    + WQ P         Y ++
Sbjct  619  QTHTTPRISAPEEPRLLGLPLSATSGTENEVVVSPYPNRYELRWQVPADNGEPITHYSVK  678

Query  253  FELRYRAERS--KTF-------TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                          +           ++       +        + V++RA    G  
Sbjct  679  SC----PVEKYDTEWRLLPYPCQEHKLEGQATTFQLESLQPDTHYKVEVRATNAIGNS  732


> sp|P54296|MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 
PE=1 SV=2
Length=1465

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/256 (15%), Positives = 78/256 (30%), Gaps = 18/256 (7%)

Query  75   AGMGRRLLLRSVQLHDSG-NYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCE  133
               G + + R   ++  G + +   +        L V   P  P           ++   
Sbjct  674  LTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTV---PSHPYGITLLNCDGHSMTLG  730

Query  134  WG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
            W  P+ +        +L                  S  S+     +     + S Y   +
Sbjct  731  WKVPKFSGGSP----ILGYYLDKREVHHKNWHEVNSSPSKPTILTVDG-LTEGSLYEFKI  785

Query  193  CVASSVGSKF-SKTQTFQGC---GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
               +  G    S       C    + +P P  ++T   V      L + W+ P  ++ S 
Sbjct  786  AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTS--LVMLWKAP-VYSGSS  842

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHHC-VIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                + + +R E +  + T       +    + D   G  +V ++RA    G G+ S+ S
Sbjct  843  PVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS  902

Query  308  PEAMGTPWTESRSPPA  323
               +      ++   A
Sbjct  903  EPVLVEARPGTKEISA  918


 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 48/326 (15%), Positives = 89/326 (27%), Gaps = 36/326 (11%)

Query  16   PGAALAPRRCPAQEVARGVLTSLP-GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR-  73
            P   +         V        P G    +    +E     +  W            R 
Sbjct  513  PPTGVHASEISRNYVVLSWEPPTPRGKDPLMY--FIEKSVVGSGSWQRVNAQTAVRSPRY  570

Query  74   ---WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLL---VDVPPEEPQLSCFRKSPL  127
                   G+  + R +  +  G      +     T  +    V V P  P      ++  
Sbjct  571  AVFDLMEGKSYVFRVLSANRHG-----LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTK  625

Query  128  SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
            ++VV +W             LL        A          +        +         
Sbjct  626  TSVVVQWDRPKHEE-----DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE-Q  679

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQ-------PDPPANITVTAVARNPRWLSVTWQD  240
            YI  +   ++VG   +     Q   +++       P  P  IT+     +   +++ W+ 
Sbjct  680  YIFRVKAVNAVGMSENS----QESDVIKVQAALTVPSHPYGITLLNCDGHS--MTLGWKV  733

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHD-AWSGLRHVVQLRAQEEFG  299
            P  ++     L + L  R    K +        +   +  D    G  +  ++ A    G
Sbjct  734  P-KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAG  792

Query  300  QGEWSEWSPEAMGTPWTESRSPPAEN  325
             GE S+ S       WT     PA +
Sbjct  793  IGEPSDPSEHFKCEAWTMPEPGPAYD  818


> sp|P54764|EPHA4_HUMAN Ephrin type-A receptor 4 OS=Homo sapiens 
OX=9606 GN=EPHA4 PE=1 SV=1
Length=986

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/214 (15%), Positives = 68/214 (32%), Gaps = 32/214 (15%)

Query  122  FRKSPLSNVVCEWGPRSTPSL-----TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
               +  +++ C   P +  +L      T   L     QN+            ++      
Sbjct  315  RADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDP  374

Query  177  QLAVPEGDSSFY----------IVSMCVASSVGSKFSKTQTFQGCGILQPDP--------  218
                P G    Y           VS+    +  +   +     G     P+P        
Sbjct  375  SKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTV  434

Query  219  ------PANITVTAVARNPRW-LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
                  P++I +       R+ +++ W +P     +   L +E++Y  +     +  +V+
Sbjct  435  TTNQAAPSSIALVQAKEVTRYSVALAWLEPD--RPNGVILEYEVKYYEKDQNERSYRIVR  492

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                +  I        +V  +RA+   G G++SE
Sbjct  493  TAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSE  526


> sp|P35992|PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila 
melanogaster OX=7227 GN=Ptp10D PE=1 SV=4
Length=1990

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/105 (21%), Positives = 38/105 (36%), Gaps = 11/105 (10%)

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
            Y + +   S           FQ      P+PP N+T+  V  N   + V W  P S    
Sbjct  559  YELKVFAVSHDLRSEPH-AYFQAVY---PNPPRNMTIETVRSNS--VLVHWSPPES---G  609

Query  248  FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
             +   + +RYR +  + +             I D   G ++ +Q+
Sbjct  610  EFT-EYSIRYRTDSEQQWVRLPSVR-STEADITDMTKGEKYTIQV  652


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 54/160 (34%), Gaps = 19/160 (12%)

Query  196  SSVGSKFSKT----QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
            +      + T     T+       PDPP+N++V   +       + W  P   + + +++
Sbjct  99   NFWLYYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAI--ILWSPPTQGSYTAFKI  156

Query  252  RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM  311
            +  L      S    T+ V D      + +   G  +  Q++A   +   E    S    
Sbjct  157  KV-LGLSEASSSYNRTFQVNDNTFQHSVKELTPGATY--QVQAYTIYDGKE----SVAYT  209

Query  312  GTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANA  351
               +T   + P +  V         N+    +L++    A
Sbjct  210  SRNFTTKPNTPGKFIVWF------RNETTLLVLWQPPYPA  243


 Score = 41.3 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 23/145 (16%), Positives = 46/145 (32%), Gaps = 12/145 (8%)

Query  151  RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG  210
            +   +      Q     S E   F     + E   +F ++   V+   G   S   T   
Sbjct  345  KYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVS---GKVTSWPATGDV  401

Query  211  CGILQPDPPANITVTAVARNPRWLSVTWQ-DPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
               L+P P  N+      +    + +TW+ DP S         + + Y    +    T  
Sbjct  402  T--LRPLPVRNLRSINDDKTNTMI-ITWEADPASTQDE-----YRIVYHELETFNGDTST  453

Query  270  VKDLQHHCVIHDAWSGLRHVVQLRA  294
            +   +    +     G  + + ++A
Sbjct  454  LTTDRTRFTLESLLPGRNYSLSVQA  478


> sp|P0C5E4|PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ 
OS=Mus musculus OX=10090 GN=Ptprq PE=1 SV=1
Length=2300

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 43/274 (16%), Positives = 88/274 (32%), Gaps = 30/274 (11%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P   Q+  ++    S+++  W P   P    T   +   +   + A        +   + 
Sbjct  569  PSSIQIINYKNISSSSILLYWDPPEYPNGKITHYTIYAMELDTNRA--------FQMTTV  620

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGILQPD-----PPANITVTA  226
              S  +   +   + Y + +  ++ VG    S+           P+      P ++ VT 
Sbjct  621  DNSFLITGLKKY-TRYKMRVAASTHVGESSLSEENDLFVR---TPEDEPESSPQDVKVTD  676

Query  227  VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWSG  285
            V  +P  LS+TW  P     +   + +E+ Y+   +       VK+       + D    
Sbjct  677  V--SPSELSLTWSPPE--KPNGIIIAYEVFYQNADA-----LFVKNTSTTNITLSDLKPY  727

Query  286  LRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILF  345
              + + +++    G G  S  S  ++ T  T   S P                       
Sbjct  728  TLYNISIQSYTRLGHGNQSS-SLLSVRTSETVPDSAPENITYKNISSEEIEIFFLPPRSP  786

Query  346  RDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTL  379
                   ++ ++ S+S    T      +L  G L
Sbjct  787  NGIIQKYTIYLKRSNSHEARTIETTSLTLTIGGL  820


 Score = 49.0 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 40/304 (13%), Positives = 78/304 (26%), Gaps = 31/304 (10%)

Query  30    VARGVLTS-LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQL  88
             V      S LPG  V +    +   +  TV +                      +     
Sbjct  1260  VWLTWSPSPLPGGIVKVYSFKIHEHETDTVFYKNISGFQTDAKLAGLEPVSTYSISVSAF  1319

Query  89    HDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVL  148
                GN + +       T        P+  Q          +V   W P    +      +
Sbjct  1320  TKVGNGNQFSNVVKFTTQE----SVPDAVQNIACVARDWQSVSVMWDPPRKAN-----GI  1370

Query  149   LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTF  208
             ++           +   +                 ++S YI  +  ++S G         
Sbjct  1371  IIHYMITVEGNSTKVSPRDPMY------TFTKLLANTS-YIFEVRASTSAGEGNESQCNV  1423

Query  209   QGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT--  266
                    P  P N   + V      +++ W  P +    F   +   + RA++ + +   
Sbjct  1424  STLPETVPSVPTNTAFSNVQSTS--VTLRWIKPDTILGYFQNYKITTQLRAQKCREWEPE  1481

Query  267   --------TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES  318
                      ++ +  Q    +        +  Q+ A    G G  S W   +  T     
Sbjct  1482  ECVEHQEVQYLYEANQTEDTVRGLKKFQWYRFQVAASTNAGYGNASSWI--STQTLPGPP  1539

Query  319   RSPP  322
               PP
Sbjct  1540  DGPP  1543


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 28/192 (15%), Positives = 56/192 (29%), Gaps = 16/192 (8%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
             DVP   P ++ F+    ++++  W P   P+    A+L                 +    
Sbjct  1149  DVPDTPPIINTFKNLSSTSILLSWDPPLKPN---GAILSYHLTLQG-----THANRTFVT  1200

Query  171   SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVAR  229
             S      +       + Y       +  G   S    F       P  PP N+T+  +  
Sbjct  1201  SGNH--IVLEELSPFTLYSFLAAARTMKGLGPSSIL-FFYTDESAPLAPPQNLTL--INY  1255

Query  230   NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
                ++ +TW    S         +  +     + T     +   Q    +        + 
Sbjct  1256  TSDFVWLTWSP--SPLPGGIVKVYSFKIHEHETDTVFYKNISGFQTDAKLAGLEPVSTYS  1313

Query  290   VQLRAQEEFGQG  301
             + + A  + G G
Sbjct  1314  ISVSAFTKVGNG  1325


 Score = 43.3 bits (100),  Expect = 0.006, Method: Composition-based stats.
 Identities = 20/126 (16%), Positives = 49/126 (39%), Gaps = 8/126 (6%)

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
             D + Y +++   S+  +  S         + +P PP  +    V  +   L ++W  P 
Sbjct  25   FDDTVYDITLSSISAT-TYSSPVSRTLATNVSKPGPPVFLAGERV-GSAGIL-LSWNTPP  81

Query  243  SWNSSFYRLRFELRYR---AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
              N +   + + ++Y+         +T    K      ++ +   G  + +++ A+   G
Sbjct  82   --NPNGRIISYVVKYKEVCPWMQTAYTRVRAKPDSLEVLLTNLNPGTTYEIKVAAENSAG  139

Query  300  QGEWSE  305
             G +S+
Sbjct  140  IGVFSD  145


 Score = 39.4 bits (90),  Expect = 0.087, Method: Composition-based stats.
 Identities = 37/236 (16%), Positives = 74/236 (31%), Gaps = 27/236 (11%)

Query  95   SCYRAGRPAGTVH-LLVDVPPEEPQLS----CFRKSPLSNVVCEWGPRSTP-SLTTKAVL  148
            S +         + L V  P +EP+ S           S +   W P   P  +     +
Sbjct  642  STHVGESSLSEENDLFVRTPEDEPESSPQDVKVTDVSPSELSLTWSPPEKPNGIIIAYEV  701

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS--KFSKTQ  206
                 QN+ A   +     +                 + Y +S+   + +G   + S   
Sbjct  702  FY---QNADALFVKNTSTTNITLSDLKPY--------TLYNISIQSYTRLGHGNQSSSLL  750

Query  207  TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFT  266
            + +    +    P NIT   ++     + + +  P S   +    ++ +  +   S    
Sbjct  751  SVRTSETVPDSAPENITYKNISSEE--IEIFFLPPRS--PNGIIQKYTIYLKRSNSHEAR  806

Query  267  TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
            T   +       I        +V+++ A    G+G  S   P ++ T      SPP
Sbjct  807  TI--ETTSLTLTIGGLKKYTHYVIEVSASTLKGEGVRS--MPISILTEEDAPDSPP  858


 Score = 37.9 bits (86),  Expect = 0.25, Method: Composition-based stats.
 Identities = 26/206 (13%), Positives = 62/206 (30%), Gaps = 21/206 (10%)

Query  109   LVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP-AEDFQEPCQY  167
             L   P   P+      +    +   W   +  +  T  ++ V+   N      F +  + 
Sbjct  1535  LPGPPDGPPENVRVVATSPFGINISWNEPAIITGPTFYLIDVKSVDNDNFNISFVKSNEE  1594

Query  168   SQESQKFSCQLAVPEGDSSFYIVSMCV--ASSVGSK----FSKTQTFQGCGILQPDPPAN  221
             ++ ++    ++       + Y V +     +  G+      S          +  DPP N
Sbjct  1595  NKTTEINDLEV------FTRYSVVITAFVGNVSGAYTDGKSSAEVIITTLESVPKDPPNN  1648

Query  222   ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE-LRYRAERSKTFTTWMVKDLQHHCV--  278
             +T   +        +++  P     +     ++ L YR +         +  +Q      
Sbjct  1649  MTFQKIPDEVTKFQLSFLPPSQ--PNGNIQVYQALVYREDDPTAVQIHNLSIIQKTDTSV  1706

Query  279   ---IHDAWSGLRHVVQLRAQEEFGQG  301
                +     G  + + + A    G G
Sbjct  1707  IAMLEGLKGGHTYNISVYAINSAGAG  1732


 Score = 34.8 bits (78),  Expect = 2.4, Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 45/136 (33%), Gaps = 21/136 (15%)

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLS-------------VTWQDP--HSWNS  246
               T +     ++   PP  +TV    + P  +              + W  P   +   
Sbjct  540  TEHTISVSAFTVMGEGPPTVLTVRTREQVPSSIQIINYKNISSSSILLYWDPPEYPNGKI  599

Query  247  SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
            + Y + + +      ++ F    V +     +I       R+ +++ A    G+   SE 
Sbjct  600  THYTI-YAMELDT--NRAFQMTTVDN---SFLITGLKKYTRYKMRVAASTHVGESSLSEE  653

Query  307  SPEAMGTPWTESRSPP  322
            +   + TP  E  S P
Sbjct  654  NDLFVRTPEDEPESSP  669


> sp|Q90688|MYPC3_CHICK Myosin-binding protein C, cardiac-type 
OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
Length=1272

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 60/169 (36%), Gaps = 19/169 (11%)

Query  188   YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
             Y V++ + +      + T       I +P PP NI +  V      L   W  P   + +
Sbjct  1041  YEVTLQIENM-----TDTVAITIQIIDKPGPPQNIKLADVWGFNVALE--WTPPQD-DGN  1092

Query  248   FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                L + ++   +++  + T      + +CV+ D   G  +  ++ ++   G        
Sbjct  1093  AQILGYTVQKADKKTMEWYTVYDHYRRTNCVVSDLIMGNEYFFRVFSENLCGLS------  1146

Query  308   PEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPV  356
              E   T     ++P    +  T  +  +  + D +   + +    +  V
Sbjct  1147  -ETAATT----KNPAYIQKTGTTYKPPSYKEHDFSEPPKFTHPLVNRSV  1190


 Score = 56.7 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 70/218 (32%), Gaps = 13/218 (6%)

Query  82   LLRSVQLHDSGNY---SCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG-PR  137
            ++   +  D G Y        G     + + V   P+ P+              +W  P 
Sbjct  735  IIEGAEKEDEGVYRVIVKNPVGEDKADITVKVIDVPDPPEAPKISNIGEDYCTVQWQPPT  794

Query  138  STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASS  197
                      +L RK + S     +      +E        A    +   Y + +   +S
Sbjct  795  YDGGQPVLGYILERKKKKSY-RWMRLNFDLLKELT----YEAKRMIEGVVYEMRIYAVNS  849

Query  198  VGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
            +G       +     I  P  P + TV  V  +   +++ W+ P    +      + + Y
Sbjct  850  IGMSRPSPASQPFMPIAPPSEPTHFTVEDV--SDTTVALKWRPPERIGAGGLD-GYIVEY  906

Query  258  RAERSKTFTTWMVK-DLQHHCVIHDAWSGLRHVVQLRA  294
              + S  +T  +     +   +I D  +G +   +++A
Sbjct  907  CKDGSAEWTPALPGLTERTSALIKDLVTGDKLYFRVKA  944


 Score = 42.5 bits (98),  Expect = 0.009, Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 59/189 (31%), Gaps = 15/189 (8%)

Query  40    GDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPS--RWAGMGRRLLLRSVQLHDSGNY-SC  96
             G+++ +  P  + +    + W+       S     R +     L +R  +LH SG Y   
Sbjct  986   GETINIMIP-FQGKPRPKISWMKDGQTLDSKDVGIRNSSTDTILFIRKAELHHSGAYEVT  1044

Query  97    YRAGRPAGTVHLLVDV--PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQ  154
              +      TV + + +   P  PQ          NV  EW P         A +L    Q
Sbjct  1045  LQIENMTDTVAITIQIIDKPGPPQNIKLADVWGFNVALEWTPPQDDG---NAQILGYTVQ  1101

Query  155   NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL  214
              +  +  +    Y    +       +  G+   Y   +   +  G   +   T     I 
Sbjct  1102  KADKKTMEWYTVYDHYRRTNCVVSDLIMGNE--YFFRVFSENLCGLSETAATTKNPAYIQ  1159

Query  215   QPD----PP  219
             +      PP
Sbjct  1160  KTGTTYKPP  1168


> sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila 
melanogaster OX=7227 GN=Lar PE=1 SV=2
Length=2029

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 71/429 (17%), Positives = 137/429 (32%), Gaps = 65/429 (15%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC-  96
            + G ++ L+C  V       V W+              G   R +L+ + + +S NY+C 
Sbjct  247  MLGSNLNLSCIAVGSP-MPHVKWMKGSEDLTPENEMPIG---RNVLQLINIQESANYTCI  302

Query  97   --YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQ  154
                 G+      + V   P  P      +   ++V  EW  +    L  +  ++  K +
Sbjct  303  AASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL--QYYVIQYKPK  360

Query  155  NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTFQGCGI  213
            N+                     +       + Y   +   +++G    S   T      
Sbjct  361  NA------NQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGET  414

Query  214  LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY-----RAERSKTFTTW  268
                 P N+ V  +  +   + +TW+ P +   +     +++ Y     + E   ++ + 
Sbjct  415  KMESAPRNVQVRTL--SSSTMVITWEPPET--PNGQVTGYKVYYTTNSNQPE--ASWNSQ  468

Query  269  MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP----EAMGTPWTESR-----  319
            MV + +    + +      + V+++A    G G  S  +P       G P   S      
Sbjct  469  MVDNSEL-TTVSELTPHAIYTVRVQAYTSMGAGPMS--TPVQVKAQQGVPSQPSNFRATD  525

Query  320  -SPPAENEVSTPMQALTTNKDDDNILFRDS--ANATSLPVQDSSSVPLPTFLVAGGSLAF  376
                A     T     + N     + + D+    A    + +S +  L         L  
Sbjct  526  IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRISNSEAYTL-------DGLYP  578

Query  377  GTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERP---------RPTPVLVPL  427
             TL  I +  R +         EG T+   P    Q VP  P           T + +  
Sbjct  579  DTLYYIWLAARSQ-------RGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSW  631

Query  428  ISPPVSPSS  436
            + PPV  S+
Sbjct  632  LPPPVERSN  640


 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 46/312 (15%), Positives = 94/312 (30%), Gaps = 32/312 (10%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P      G      G +V +TC  +       ++W+  +        R++     L + +
Sbjct  140  PVITQGPGTRVIEVGHTVLMTCKAIG-NPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIEN  198

Query  86   VQLHDSGNYSC----YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPS  141
             +  D G Y C          +   +L V V    P  S   ++    ++      S  +
Sbjct  199  SREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVML-----GSNLN  253

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
            L+  AV                  +      +   QL          I     A+     
Sbjct  254  LSCIAVGSPMPHVKWMKGSEDLTPENEMPIGRNVLQL----------INIQESANYTCIA  303

Query  202  FSKTQTFQGCGILQ----PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRY  257
             S         +++    P  P ++ ++ V      L   W      +  +Y     ++Y
Sbjct  304  ASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLE--WSYKGPEDLQYYV----IQY  357

Query  258  RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
            + + +    + +   +  + V+        +   + A    G+G  S  +P    T  T+
Sbjct  358  KPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPS--APATCTTGETK  415

Query  318  SRSPPAENEVST  329
              S P   +V T
Sbjct  416  MESAPRNVQVRT  427


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/163 (17%), Positives = 58/163 (36%), Gaps = 14/163 (9%)

Query  188   YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
             Y   +  ++ +G      + FQ        PP+NIT+    + P  L VTW  P   + +
Sbjct  882   YEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRF--QTPDVLCVTWDPPTREHRN  939

Query  248   FYRLRFELRYRAE-RSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW  306
                 R+++++  +      +   +   +      +      ++ ++RA  + G G +S+ 
Sbjct  940   GIITRYDVQFHKKIDHGLGSERNMTLRKAVFT--NLEENTEYIFRVRAYTKQGAGPFSD-  996

Query  307   SPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
                      TE             +QA  T++    I +    
Sbjct  997   ----KLIVETERD----MGRAPMSLQAEATSEQTAEIWWEPVT  1031


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/179 (13%), Positives = 55/179 (31%), Gaps = 23/179 (13%)

Query  133   EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
              W P ++        +          +D+Q     ++          V     + Y V++
Sbjct  1026  WWEPVTSRGKLLGYKIFYTMTAVEDLDDWQ-----TKTVGLTESADLVNLEKFAQYAVAI  1080

Query  193   CV--ASSVGSKFSKTQTFQGCGILQP-DPPANITVTAVARNPRWLSVTWQDPHSWNSSFY  249
                  + +G    K         ++P D P N+    V+ +   ++++W  P       Y
Sbjct  1081  AARFKNGLGRLSEK---VTVR--IKPEDVPLNLRAHDVSTHS--MTLSWSPPIRLTPVNY  1133

Query  250   RLRFELRYRAERSKTFTTWMVKDLQ--------HHCVIHDAWSGLRHVVQLRAQEEFGQ  300
             ++ F+       S+ F+   +   +            I++      + V + A      
Sbjct  1134  KISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTINELSPFTTYNVNVSAIPSDYS  1192


 Score = 39.0 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 36/292 (12%), Positives = 93/292 (32%), Gaps = 27/292 (9%)

Query  48   PGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTV-  106
            P VE  +   +++ +     G            L + S+ L +   ++ Y+    AGT  
Sbjct  634  PPVERSNGRIIYYKVFFVEVGREDDEATT--MTLNMTSIVLDELKRWTEYKIWVLAGTSV  691

Query  107  -------HLLV---DVPPEEPQLSCFRKSPLSNVVCEWGPR---STPSLTTKAVLLVRKF  153
                    +++   +  P +PQ         +++   W P        +     +  ++ 
Sbjct  692  GDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQEL  751

Query  154  QNSPAEDFQEPCQ-YSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGC  211
            ++       EP +    ++ +F+     P+   + Y + +   +  G    S     +  
Sbjct  752  RDEGKGFLNEPFKFDVVDTLEFNVTGLQPD---TKYSIQVAALTRKGDGDRSAAIVVKTP  808

Query  212  GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
            G +   P  ++ +         + + W+ P    +      + LR+  +        +  
Sbjct  809  GGVPVRPTVSLKIMEREPIVS-IELEWERPAQ--TYGELRGYRLRWGVKDQALKEEMLSG  865

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA  323
                     +   G+ +  ++      G G+    + +   TP      PP+
Sbjct  866  PQMTKKRFDNLERGVEYEFRVAGSNHIGIGQE---TVKIFQTPEGTPGGPPS  914


 Score = 36.7 bits (83),  Expect = 0.53, Method: Composition-based stats.
 Identities = 23/182 (13%), Positives = 57/182 (31%), Gaps = 10/182 (5%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
            P +P          + V  +W        +     +V        + +     + + S  
Sbjct  515  PSQPSNFRATDIGETAVTLQWT--KPTHSSEN---IVHYELYW-NDTYANQAHHKRISNS  568

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPR  232
             +  L       + Y + +   S  G    +     +    +   PP NIT  A+A +  
Sbjct  569  EAYTLDGLY-PDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNIT--AIATSST  625

Query  233  WLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
             +S++W  P    S+   + +++ +     +      +       V+ +      + + +
Sbjct  626  TISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWV  685

Query  293  RA  294
             A
Sbjct  686  LA  687


> sp|Q1KL86|EPHA2_MACFA Ephrin type-A receptor 2 OS=Macaca fascicularis 
OX=9541 GN=EPHA2 PE=2 SV=1
Length=976

 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 73/196 (37%), Gaps = 25/196 (13%)

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK-------FSCQLAVPEGDSS  186
            W P          V  V   Q  P      PC+ S    +        S  ++  E   +
Sbjct  348  WTPPQDSGGREDIVYSVTCEQCWPESGECGPCESSVRYSEPPHGLTRTSVTVSDLEPHMN  407

Query  187  FYIVSMCVASSV-GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ-DPHSW  244
             Y  ++   + V G   S++       I Q +PP    V    R+   LSV+W   P   
Sbjct  408  -YTFTVEARNGVSGLVTSRSFRTASVSINQTEPPK---VRLEGRSTTSLSVSWSIPPPQQ  463

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
            +  +   ++E+ YR +      ++ V+  +     + D      ++VQ++A  + GQG  
Sbjct  464  SRVW---KYEVTYRKKGDS--NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAG  518

Query  304  SE------WSPEAMGT  313
            S+       SPE  G+
Sbjct  519  SKVHEFQTLSPEGSGS  534


> sp|Q95209|SORL_RABIT Sortilin-related receptor OS=Oryctolagus 
cuniculus OX=9986 GN=SORL1 PE=1 SV=1
Length=2213

 Score = 57.1 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/186 (17%), Positives = 57/186 (31%), Gaps = 14/186 (8%)

Query  122   FRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
             +      NV   W  P+  PS      +  R    S  +  +     +         +  
Sbjct  1562  WTADFSGNVTLTWMRPKKMPSAACVYNVYYRVVGESIWKTLETHSNKTNT-------VLK  1614

Query  181   PEGDSSFYIVSMCVA-SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
                  + Y V + V   S     +   T +    L PD P N+ ++        +   W 
Sbjct  1615  VLKPDTTYQVKVQVQCLSKVHNTNDFVTLRTPEGL-PDAPQNLQLSLHGEEEGVIVGHWS  1673

Query  240   DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
              P   ++      + + Y    SK +T+           I +      + V++ A    G
Sbjct  1674  PPT--HTHGLIREYIVEYSRSGSKVWTSERAASNFTE--IKNLLVNTLYTVRVAAVTSRG  1729

Query  300   QGEWSE  305
              G WS+
Sbjct  1730  IGNWSD  1735


> sp|Q5FW53|MBPHL_MOUSE Myosin-binding protein H-like OS=Mus musculus 
OX=10090 GN=Mybphl PE=1 SV=1
Length=355

 Score = 56.0 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 69/211 (33%), Gaps = 16/211 (8%)

Query  15   APGAALAPR--RCPAQEVARG---VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAA-G  68
            +P   L P     P   + R          G++V L  P ++ +      W     A   
Sbjct  39   SPSLQLLPSIEEHPKIWLPRALKQTYIRKAGETVNLLIP-IQGKPKPQTTWTHNGCALDS  97

Query  69   SHPSRWAGM-GRRLLLRSVQLHDSGNY-SCYRAG--RPAGTVHLLVDVPPEEPQLSCFRK  124
            S  S   G     L +R  Q  DSG Y  C + G  +   T+++LV   P  PQ      
Sbjct  98   SRVSVRNGEHDSILFIREAQRTDSGCYQLCVQLGGLQATATINILVIEKPGPPQSIKLVD  157

Query  125  SPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD  184
               +N   EW P      T      V+K        F    +Y +     SC ++     
Sbjct  158  VWGANATLEWTPPQDTGNTALLGYTVQKADKKSGLWFTVLERYHRT----SCVVSNLIVG  213

Query  185  SSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
            +S Y   +   +  G   +   T     I +
Sbjct  214  NS-YAFRVFAENQCGLSDTAPVTADLAHIQK  243


> sp|Q07498|EPHB3_CHICK Ephrin type-B receptor 3 (Fragment) OS=Gallus 
gallus OX=9031 GN=EPHB3 PE=2 SV=1
Length=988

 Score = 56.7 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/231 (15%), Positives = 73/231 (32%), Gaps = 23/231 (10%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE---  170
            P  P+ S       +++V EW            +  V   + S        C  + E   
Sbjct  312  PSAPR-SVISNVNETSLVLEWSEPQDAGGRDDLLYNVICKKCSVERRLCSRCDDNVEFVP  370

Query  171  -------SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ----PDPP  219
                     +    ++        Y   +   + + SK      F    I      P   
Sbjct  371  RQLGLTGLTERRIYISKVMAHP-QYTFEIQAVNGISSKSPYPPHFASVNITTNQAAPSAV  429

Query  220  ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHCV  278
              + + +   N   ++++W  P     +   L +E++Y  ++ +       V   ++   
Sbjct  430  PTMHLHSSTGNS--MTLSWTPPE--RPNGIILDYEIKYSEKQGQGDGIANTVTSQKNSVR  485

Query  279  IHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVST  329
            +    +  R++VQ+RA+   G G +S   P    T   +  +     E+  
Sbjct  486  LDGLKANARYMVQVRARTVAGYGRYS--LPTEFQTTAEDGSTSKTFQELPL  534


> sp|P29317|EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens 
OX=9606 GN=EPHA2 PE=1 SV=2
Length=976

 Score = 56.7 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 42/195 (22%), Positives = 72/195 (37%), Gaps = 25/195 (13%)

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK-------FSCQLAVPEGDSS  186
            W P          V  V   Q  P      PC+ S    +        S  ++  E   +
Sbjct  348  WTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMN  407

Query  187  FYIVSMCVASSV-GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ-DPHSW  244
             Y  ++   + V G   S++       I Q +PP    V    R+   LSV+W   P   
Sbjct  408  -YTFTVEARNGVSGLVTSRSFRTASVSINQTEPPK---VRLEGRSTTSLSVSWSIPPPQQ  463

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQH-HCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
            +  +   ++E+ YR +      ++ V+  +     + D      ++VQ++A  + GQG  
Sbjct  464  SRVW---KYEVTYRKKGDS--NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAG  518

Query  304  SE------WSPEAMG  312
            S+       SPE  G
Sbjct  519  SKVHEFQTLSPEGSG  533


> sp|Q03137|EPHA4_MOUSE Ephrin type-A receptor 4 OS=Mus musculus 
OX=10090 GN=Epha4 PE=1 SV=2
Length=986

 Score = 56.7 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/214 (15%), Positives = 67/214 (31%), Gaps = 32/214 (15%)

Query  122  FRKSPLSNVVCEWGPRSTPSL-----TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
               +  +++ C   P +  +L      T   L     QN+            ++      
Sbjct  315  RADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDP  374

Query  177  QLAVPEGDSSFYI----------VSMCVASSVGSKFSKTQTFQGCGILQPDP--------  218
                P G    Y           VS+    +  +   +     G     P P        
Sbjct  375  SKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSPDQSVSVTV  434

Query  219  ------PANITVTAVARNPRW-LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
                  P++I +       R+ +++ W +P     +   L +E++Y  +     +  +V+
Sbjct  435  TTNQAAPSSIALVQAKEVTRYSVALAWLEPD--RPNGVILEYEVKYYEKDQNERSYRIVR  492

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                +  I        +V  +RA+   G G++SE
Sbjct  493  TAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSE  526


> sp|Q62234|MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 
PE=1 SV=2
Length=1667

 Score = 56.7 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/218 (14%), Positives = 76/218 (35%), Gaps = 19/218 (9%)

Query  114   PEEPQLSCFRKSPLSNVVCEWGPRSTPSLT--TKAVLLVRKFQNSPAEDFQEPCQYSQES  171
             P  P      +S   ++V  W    T      T   +  R+        ++E      ++
Sbjct  916   PSAPYDITCLESFRDSMVLGWKQPDTTGGAEITGYYVNYREVVGEVPGKWREAN---IKA  972

Query  172   QKFSCQLAVPEGDSSFYIVSMCVASSVG----SKFSKTQTFQGCGILQPDPPANITVTAV  227
                +        +++ Y   +   +  G    S  S+    +   I  P PP ++ ++ V
Sbjct  973   VSDAAYKISNLKENTLYQFQVSAMNIAGLGAPSTVSECFKCEEWTIAVPGPPHSVKLSEV  1032

Query  228   ARNPRWLSVTWQDP----HSWNSSFYRLRFELRYRAERSKTFT-TWMVKDLQHHCVIHDA  282
              +N   L + W+ P     +  + ++    +L+  + +   +        +  +  +   
Sbjct  1033  RKNS--LVLQWKPPVYSGRTPVTGYFV---DLKEASAKDDQWRGLNEAAIVNKYLRVQGL  1087

Query  283   WSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
               G  +V ++RA  + G G+ S+ +   +      ++ 
Sbjct  1088  KEGTSYVFRVRAVNQAGVGKPSDLAGPVVAETRPGTKE  1125


 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 52/373 (14%), Positives = 100/373 (27%), Gaps = 67/373 (18%)

Query  33   GVLTSLPGDSVTLTCPGVEPED----NATVHWVLRK-PAAGSH--PSRWAGMGRRLLLRS  85
             V     G++++L C  V   +       V W     P + S      W+G    L    
Sbjct  392  DVSFGREGETMSLGCRVVITPEIKHFQPEVQWYRNGAPVSPSKWVQPHWSGDRATLTFSH  451

Query  86   VQLHDSGNYSCY-RAGRPAGTVHLLVDV---------PPEEP--QLSCFRKSPLSNVVCE  133
            +   D G Y+   R G         V V          P  P   +S         +   
Sbjct  452  LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVVSLDANKDYIIIS-W  510

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
              P            + +    +   D    C       KF+        +   YI  + 
Sbjct  511  KQPAVDGGSPILGYFIDKCEVGT---DTWSQCND--TPVKFARFPVTGLIEGRSYIFRVR  565

Query  194  VASSVG----SKFSKTQT-FQGCGI-------------------------LQPDPPANIT  223
              +  G    S+ S+                                   + P PP +++
Sbjct  566  AVNKTGIGLPSRVSEPVAALDPAEKARLKSHPSAPWTGQIIVTEEEPTEGVIPGPPTDLS  625

Query  224  VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQHHCVIHD  281
            VT       ++ ++W+ P         + + +      ++ +      +        + D
Sbjct  626  VT--EATRSYVVLSWKPPGQ--RGHEGIMYFVEKCDVGAENWQRVNTELPVKSPRFALFD  681

Query  282  AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDD  341
               G  +  ++R     G GE SE +   +     +    P +   S             
Sbjct  682  LVEGKSYRFRVRCSNSAGVGEPSETTEVTVVGDKLDIPKAPGKIIPSRNTDTSVV-----  736

Query  342  NILFRDSANATSL  354
             + + +S +A  L
Sbjct  737  -VSWEESRDAKEL  748


> sp|O08680|EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus 
OX=10116 GN=Epha3 PE=2 SV=1
Length=984

 Score = 56.0 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 35/219 (16%), Positives = 73/219 (33%), Gaps = 16/219 (7%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  P+         ++V+ +W               +   +        EPC  +    
Sbjct  325  PPSAPRN-VISNINETSVILDWSWPLDTGGRKDITFNIICKKCGWNVRQCEPCSPNVRFL  383

Query  173  K------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPDPPANITV  224
                    +          + Y   +   + V    S  + F    I   Q  P   +T+
Sbjct  384  PRQLGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSSPPRQFAAVSITTNQAAPSPVMTI  443

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
                 +   +S++WQ+P   + +   L +E++Y  ++ +  +  +++    +  I     
Sbjct  444  KKDRTSRNSISLSWQEPE--HPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKP  501

Query  285  GLRHVVQLRAQEEFGQGEWS-----EWSPEAMGTPWTES  318
               +V Q+RA+   G G  S     E SP++       S
Sbjct  502  DTTYVFQIRARTAAGYGTNSRKFEFENSPDSFSISGENS  540


> sp|Q5PQM4|MBPHL_RAT Myosin-binding protein H-like OS=Rattus norvegicus 
OX=10116 GN=Mybphl PE=1 SV=1
Length=355

 Score = 55.2 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 44/212 (21%), Positives = 67/212 (32%), Gaps = 18/212 (8%)

Query  15   APGAALAPR--RCPAQEVARG---VLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS  69
            +P   L P     P   + R          G++V L  P        T+ W     A   
Sbjct  39   SPSLQLLPSIEEHPKIWLPRALRQTYIRKVGETVNLLIPFQGKPKPQTI-WTHNGSAL-D  96

Query  70   HPSRWAGMG---RRLLLRSVQLHDSGNY-SCYRAG--RPAGTVHLLVDVPPEEPQLSCFR  123
            +       G     L +R  Q  DSG Y  C + G  +   T+++LV   P  PQ     
Sbjct  97   NSRVSVRNGEHDSILFIREAQRTDSGCYQLCVQLGGLQATATINILVIEKPGPPQSIKLV  156

Query  124  KSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG  183
                +N   EW P      T      V+K        F    +Y +     SC ++    
Sbjct  157  DVWGANATLEWTPPQDTGNTALLGYTVQKADKKSGLWFTVLERYHRT----SCIVSDLIV  212

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ  215
             +S Y   +   +  G   +   T     I +
Sbjct  213  GNS-YAFRVFAENQCGLSDTAPVTADLAHIQK  243


> sp|A0MSX9|IL7RA_HORSE Interleukin-7 receptor subunit alpha OS=Equus 
caballus OX=9796 GN=IL7R PE=2 SV=1
Length=458

 Score = 55.2 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 49/129 (38%), Gaps = 17/129 (13%)

Query  196  SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF--  253
              +G K    Q       ++P+ P ++ V        ++        ++N+S  + ++  
Sbjct  109  VKLGGKHITCQKLNIVKRVKPEAPFDVKVIYREEANEFV-------VTFNTSHLQKKYVK  161

Query  254  ----ELRYR-AERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE--FGQGEWSEW  306
                E+ YR  +    +    +   +   +         + +++R+     + +G WSEW
Sbjct  162  DLLHEVVYRLEKNENDWMHVNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEW  221

Query  307  SPEAM-GTP  314
            SP +   TP
Sbjct  222  SPSSHFRTP  230


> sp|Q05695|L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus 
norvegicus OX=10116 GN=L1cam PE=1 SV=3
Length=1259

 Score = 56.0 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 52/372 (14%), Positives = 107/372 (29%), Gaps = 64/372 (17%)

Query  12   LLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHP  71
            LLA     +                ++ G +  L C         +V W+  +       
Sbjct  412  LLANAYIYVVQLPARILTKDNQTYMAVEGSTAYLLCKAFGAP-VPSVQWLDEEGTTVLQD  470

Query  72   SR--WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEE-------PQLSCF  122
             R      G  L +R +Q +D+G Y C  A      V +L ++  +E       P+ +  
Sbjct  471  ERFFPYANGH-LGIRDLQANDTGRYFCQAA-NDQNNVTILANLQVKEATQITQGPRSTIE  528

Query  123  RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP----------CQYSQESQ  172
            +K       C+      PSL                 D  +                +  
Sbjct  529  KKGARVTFTCQ--ASFDPSLQASITWRGDGRDLQERGDSDKYFIEDGQLVIKSLDYSDQG  586

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN-P  231
             +SC  +    +       +   + +    S            P P  ++ ++       
Sbjct  587  DYSCVASTELDE-------VESRAQLLVVGS------------PGPVPHLELSDRHLLKQ  627

Query  232  RWLSVTWQDPHSWNSSFYRLRFELRYRAER---SKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              + ++W      NS     ++++ +  +     K F+   V   Q    +      + +
Sbjct  628  SQVHLSWSPAEDHNSPIE--KYDIEFEDKEMAPEKWFSLGKVPGNQTSTTLK-LSPYVHY  684

Query  289  VVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPA-----------ENEVSTPMQALTTN  337
              ++ A  ++G GE S  S   + TP       P                  P++ +  N
Sbjct  685  TFRVTAINKYGPGEPSPVSETVV-TPEAAPEKNPVDVRGEGNETNNMVITWKPLRWMDWN  743

Query  338  --KDDDNILFRD  347
              +    + +R 
Sbjct  744  APQIQYRVQWRP  755


> sp|P54760|EPHB4_HUMAN Ephrin type-B receptor 4 OS=Homo sapiens 
OX=9606 GN=EPHB4 PE=1 SV=2
Length=987

 Score = 55.6 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 51/118 (43%), Gaps = 7/118 (6%)

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQPD---PPANITVTAVARNPRWLSVTWQDPHSW  244
            Y   +   + V S  +    F+    +  D   PPA   +     +P  LS+ W  P + 
Sbjct  402  YTFEVTALNGVSSLATGPVPFEPVN-VTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRA-  459

Query  245  NSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
              S   L +E++Y  + ++  ++   +K  ++   +     G  ++VQ+RA+ E G G
Sbjct  460  -PSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYG  516


> sp|P24394|IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo 
sapiens OX=9606 GN=IL4R PE=1 SV=1
Length=825

 Score = 55.6 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 46/211 (22%), Positives = 76/211 (36%), Gaps = 16/211 (8%)

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVR-KFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
                 +S   CEW      + +T+  LL +  F  S A                     V
Sbjct  34   CVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDV  93

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
               D+  Y + +     +  K S    F+    ++P  P N+TV         L +TW +
Sbjct  94   VSADN--YTLDLWAGQQLLWKGS----FKPSEHVKPRAPGNLTVHT--NVSDTLLLTWSN  145

Query  241  PHSWNSS-FYRLRFELRYRAERSK-TFTTWMVKDLQHHCVI--HDAWSGLRHVVQLRAQE  296
            P+  ++  +  L + +   +E     F  + V  L+    I      SG+ +  ++RA  
Sbjct  146  PYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWA  205

Query  297  EFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
            +     WSEWSP    T W  S   P E  +
Sbjct  206  QCYNTTWSEWSP---STKWHNSYREPFEQHL  233


> sp|Q02173|MPSF_CHICK M-protein, striated muscle OS=Gallus gallus 
OX=9031 PE=2 SV=1
Length=1450

 Score = 55.6 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 46/330 (14%), Positives = 89/330 (27%), Gaps = 73/330 (22%)

Query  33   GVLTSLPGDSVTLTCPGVEPEDNATV----HWVLRKPAAGSHPSRWAGMGR---RLLLRS  85
            GV  +  G+++TL C  +   +   +     W                 G     L    
Sbjct  273  GVTFATEGETLTLKCSVLVTPELKRLRPRAEWYRDDVLIKDSKWTKLYFGEGQAALSFTH  332

Query  86   VQLHDSGNYSCY---RAGRPAGTVHLLV--------DVPPEEPQLSC-FRKSPLSNVVCE  133
            +   D G Y+     + G    +  L V          P     + C         V   
Sbjct  333  LNKDDEGLYTLRMVTKGGVNECSAFLFVRDADALIAGAPGAPMDVKCHDANRDYVIVT--  390

Query  134  WGPRSTPSL-TTKAVLLVRKFQNSPA-----EDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
            W P +T S        + +            +   + C+Y                +   
Sbjct  391  WKPPNTTSQNPVIGYFVDKCEVGLENWVQCNDAPVKICKYPVTG----------LYEGRS  440

Query  188  YIVSMCVASSVG----SKFSKTQT-FQGCG-------------------------ILQPD  217
            YI  +   +S G    S+ S+                                  I  P 
Sbjct  441  YIFRVRAVNSAGISRPSRVSEPVAALDPVDLERTQTVHVDEGRKIVISKDDLEGDIQIPG  500

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--VKDLQH  275
            PP N+  + +++   ++ ++W  P         L + +      S ++      V     
Sbjct  501  PPTNVHASEISKT--YVVLSWDPP--VPRGREPLTYFIEKSMVGSGSWQRVNAQVAVKSP  556

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
               + D   G  +V ++ +  + G  + SE
Sbjct  557  RYAVFDLAEGKPYVFRVLSANKHGISDPSE  586


 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 40/253 (16%), Positives = 79/253 (31%), Gaps = 18/253 (7%)

Query  75   AGMGRRLLLRSVQLHDSG-NYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCE  133
               G + + R   ++  G + +   +        L     P  P           ++   
Sbjct  662  LETGEQYIFRVKAVNAVGFSENSQESEAIKVQAALTC---PSYPHGITLLNCDGHSMTLG  718

Query  134  WG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
            W  P+ +         + ++  N            S+              + +FY   +
Sbjct  719  WKAPKYSGGSPILGYYIDKREANHKNWHEVNSSVISRT-----IYTVEDLTEDAFYEFKI  773

Query  193  CVASSVGS-KFSKTQTFQGCG---ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSF  248
              A+ VG    S       C    + +P P  ++TV  V      L + W+ P     S 
Sbjct  774  AAANVVGIGHPSDPSEHFKCKAWTMPEPGPAYDLTVCEVRNTS--LVLLWKAPVYEGKSP  831

Query  249  YRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWS  307
                + + Y+   ++ + T   K   H    + D   G  +V ++RA  + G G+ SE S
Sbjct  832  IT-GYLVDYKEVDTEDWITANEKPTSHRYFKVTDLHQGHTYVFKVRAVNDAGVGKSSEIS  890

Query  308  PEAMGTPWTESRS  320
                      ++ 
Sbjct  891  EPVFVEASPGTKE  903


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 44/305 (14%), Positives = 88/305 (29%), Gaps = 35/305 (11%)

Query  43   VTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGM----------------GRRLLLRSV  86
            V L+     P     + + + K   GS   +                    G+  + R +
Sbjct  515  VVLSWDPPVPRGREPLTYFIEKSMVGSGSWQRVNAQVAVKSPRYAVFDLAEGKPYVFRVL  574

Query  87   QLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKA  146
              +  G         P     ++V   P  P      ++  ++VV +W            
Sbjct  575  SANKHGISDPSEITEPIQPQDIVV--VPSAPGRVVATRNTKTSVVVQWDKPKHEE-----  627

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ  206
             L       S     Q      +        +   E     YI  +   ++VG   +  +
Sbjct  628  NLYGYYIDYSVVGSNQWEPANHKPINYNRFVVHGLETGE-QYIFRVKAVNAVGFSENSQE  686

Query  207  TFQGCGILQ-----PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
            +      +Q     P  P  IT+     +   +++ W+ P  ++     L + +  R   
Sbjct  687  SEAI--KVQAALTCPSYPHGITLLNCDGHS--MTLGWKAP-KYSGGSPILGYYIDKREAN  741

Query  262  SKTFTTWMVKDL-QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS  320
             K +       + +    + D      +  ++ A    G G  S+ S       WT    
Sbjct  742  HKNWHEVNSSVISRTIYTVEDLTEDAFYEFKIAAANVVGIGHPSDPSEHFKCKAWTMPEP  801

Query  321  PPAEN  325
             PA +
Sbjct  802  GPAYD  806


 Score = 40.6 bits (93),  Expect = 0.040, Method: Composition-based stats.
 Identities = 15/102 (15%), Positives = 36/102 (35%), Gaps = 12/102 (12%)

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNS----SFYRLRFELRYRAERSKTFTTWMVK  271
            P  P +  V     N  ++ VTW+ P++ +      ++  + E+       + +      
Sbjct  371  PGAPMD--VKCHDANRDYVIVTWKPPNTTSQNPVIGYFVDKCEV-----GLENWVQCNDA  423

Query  272  DLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
             ++     +   + G  ++ ++RA    G    S  S     
Sbjct  424  PVKICKYPVTGLYEGRSYIFRVRAVNSAGISRPSRVSEPVAA  465


> sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 
GN=sls PE=1 SV=3
Length=18141

 Score = 55.6 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 35/197 (18%), Positives = 61/197 (31%), Gaps = 21/197 (11%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
              PP  P  +       ++    W P  T            K      E  +E     +   
Sbjct  17760  PPRGP--TTVSGMNDTSFNLAWEPSETDG--------GSKIIEYIVEIREETETTYRSVG  17809

Query  173    KFSCQLAVPEGDSSF----YIVSMCVASSVGSKFSKTQT---FQGCGILQPDPPANITVT  225
                   +     +       Y   +   + VG+  +   T     G  I  P PP N+   
Sbjct  17810  VTLGTVTNIHVEKVVRNKGYFFRIYARNEVGTSEAFETTEKIVLGRKITPPSPPQNLRAP  17869

Query  226    AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL-QHHCVIHDAWS  284
               V    R +++ W+ P     S     + +  R+  S  +T  +  D  Q H  I +   
Sbjct  17870  DV--TSRSVTLDWEVPARNGGSEIT-GYCVEKRSSTSTNWTKVITLDAHQLHYTIDNLKE  17926

Query  285    GLRHVVQLRAQEEFGQG  301
                 +  ++ A+ E G G
Sbjct  17927  KCEYWFRVSAENEVGLG  17943


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/247 (15%), Positives = 73/247 (30%), Gaps = 27/247 (11%)

Query  55     NATVHWVLR-KPAAGSHPSRWA--GMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVD  111
              +  V W  + KP   +        G  RRL++      D+G  SC  A     +  L V+
Sbjct  17214  DVEVTWCKKGKPIKPNQKHEVFVEGTVRRLVIHDASDEDAGEISC-VAENVTSSTKLCVE  17272

Query  112    ---VPP----EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEP  164
                 +PP    ++ Q    +++                + T       +    P      P
Sbjct  17273  ELKLPPVITSDKDQTIKVKENDDVTFT-----VKYTGVPTPEACWTTRKVVIPKSKRTIP  17327

Query  165    CQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITV  224
                  Q ++       V + D   Y V +   + VG   +            P  P     
Sbjct  17328  TIDEQSAKLT--IKKVVDDDEGEYTVKLV--NPVGEAEASLHLVIMRKPTAPGTPQ----  17379

Query  225    TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
                +      +++ W+ P   +     + + L Y+  + + +T            I     
Sbjct  17380  -PLEIMHDSITLYWKAPED-DGKSEIIEYILEYQDVKEEKWTEIRKIKDTT-YTISKLKI  17436

Query  285    GLRHVVQ  291
                 +V +
Sbjct  17437  DTEYVFR  17443


 Score = 40.9 bits (94),  Expect = 0.034, Method: Composition-based stats.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 4/66 (6%)

Query  54     DNATVHWVLRKPAAGSHPSRWA----GMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLL  109
              +   V W                   G  RRL++R V +HD G Y+C   G+      ++
Sbjct  17033  EATEVTWYKDGEKITPENKNVEFIKDGKARRLVIRDVTIHDEGQYTCKIEGQECSCELVV  17092

Query  110    VDVPPE  115
              +++PPE
Sbjct  17093  IELPPE  17098


 Score = 40.6 bits (93),  Expect = 0.035, Method: Composition-based stats.
 Identities = 36/215 (17%), Positives = 63/215 (29%), Gaps = 33/215 (15%)

Query  113    PPEEPQLSCFRKSPLSNVVCEWG-PRSTPSLT----------------TKAVLLVRKFQN  155
              PP  PQ          +V  +W  P                       TK + L     +
Sbjct  17859  PPSPPQNLRAPDVTSRSVTLDWEVPARNGGSEITGYCVEKRSSTSTNWTKVITLDAHQLH  17918

Query  156    SPAEDFQEPCQYSQESQ-KFSCQLAVPEGDSSFYIVS-----MCVASSVGSKFSKTQTFQ  209
                 ++ +E C+Y      +    L  P    S  + +     + V  + GS       F 
Sbjct  17919  YTIDNLKEKCEYWFRVSAENEVGLGAPAVTESISLKTHASEFILVVRNCGSYTE----FG  17974

Query  210    GCGILQPDPPAN-ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW  268
                  + P PP   +    +A N       W  P S +     L + +  R  +   +   
Sbjct  17975  FLKAV-PSPPTGPLEARVLAANAHIFE--WGLPES-DGGAPLLGYHIAIRDMKKTMWIEV  18030

Query  269    MVKDLQ-HHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                         I D      +++++ A+ E G  E
Sbjct  18031  GRVPAGVLKFQIRDLQENHEYMIRIFAKNEIGLSE  18065


> sp|Q9JHX3|IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus 
OX=10090 GN=Il21r PE=2 SV=1
Length=529

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 40/216 (19%), Positives = 76/216 (35%), Gaps = 21/216 (10%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF--QEPCQYSQESQKFSC  176
            L+C+    L  + C    RS               +    E F       ++     ++C
Sbjct  23   LTCYT-DYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTC  81

Query  177  QLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
             + + +  S   +IV++      G+   +  +F     ++P PP N+TV    R      
Sbjct  82   HMRLSQFLSDEVFIVNVTD--QSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYD----  135

Query  236  VTWQDPHSWNSSFYR---LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS-----GLR  287
            ++W   +   S++     L++EL+YR  R       + K +                   
Sbjct  136  ISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSS  195

Query  288  HVVQLRAQEEFG---QGEWSEWSPEAMGTPWTESRS  320
            + +Q+RA  + G   +G WSEWS   +         
Sbjct  196  YQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPE  231


> sp|P14781|CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 
PE=1 SV=1
Length=1010

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 52/329 (16%), Positives = 104/329 (32%), Gaps = 31/329 (9%)

Query  40   GDSVTLTC-PGVEPEDNATVHWVLRK-----PAAGSHPSR--WAGMGRRLLLRSVQLHDS  91
            G++ T+ C    +P  + T  W L            H  R         LL+++VQL  +
Sbjct  510  GENATMQCIASHDPTLDLTFIWSLNGFVIDFEKEHEHYERNVMIKSNGELLIKNVQLRHA  569

Query  92   GNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVL  148
            G Y+C         + +  L+V  PP  P      +   + V   W   +          
Sbjct  570  GRYTCTAQTIVDNSSASADLVVRGPPGPPGGIRIEEIRDTAVALTWSRGTDNHSPISKYT  629

Query  149  LVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQT  207
            +  K   S      +      E    S ++         Y   +   +++G+   S    
Sbjct  630  IQSKTFLSEEWKDAKTEPSDIEGNMESARVIDLIPWME-YEFRIIATNTLGTGEPSMPS-  687

Query  208  FQGCGILQPDPPANITVTAV---ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT  264
                 I     P N+  + V     + R L++TW              + + ++    K 
Sbjct  688  ---QRIRTEGAPPNVAPSDVGGGGGSNRELTITWMPLSREYHYGNNFGYIVAFKPFGEKE  744

Query  265  FTTWMVKDLQ-HHCVIHD--AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
            +    V + +    V  D       ++ V+++A    G G +S          ++   +P
Sbjct  745  WRRVTVTNPEIGRYVHKDESMPPSTQYQVKVKAFNSKGDGPFS-----LTAVIYSAQDAP  799

Query  322  PAENEVSTPMQALTTNKDDDNILFRDSAN  350
                EV T +     +  + ++ +     
Sbjct  800  ---TEVPTDVSVKVLSSSEISVSWHHVTE  825


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 30/201 (15%), Positives = 65/201 (32%), Gaps = 22/201 (11%)

Query  130  VVCEWGP-RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG--DSS  186
            +   W P             +V        E  +     +  + +    +   E    S+
Sbjct  714  LTITWMPLSREYHYGNNFGYIVAFKPFGEKEWRRV----TVTNPEIGRYVHKDESMPPST  769

Query  187  FYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
             Y V +   +S G   FS T           + P +++V  +  +   +SV+W      +
Sbjct  770  QYQVKVKAFNSKGDGPFSLTAVIYSAQDAPTEVPTDVSVKVL--SSSEISVSWHHVTEKS  827

Query  246  SSFYRLRFELRYRAERSKTF--TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
                   +++RY A   K        V + ++   + +     R+ + + A    G G  
Sbjct  828  VEG----YQIRYWAAHDKEAAAQRVQVSNQEYSTKLENLKPNTRYHIDVSAFNSAGYG--  881

Query  304  SEWSPEAMGTPWTESRSPPAE  324
                P +        ++PP++
Sbjct  882  ----PPSRTIDIITRKAPPSQ  898


> sp|Q863Z5|IL4RA_PIG Interleukin-4 receptor subunit alpha OS=Sus 
scrofa OX=9823 GN=IL4R PE=2 SV=1
Length=830

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/204 (18%), Positives = 60/204 (29%), Gaps = 14/204 (7%)

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
                 +S   CEW      +    A   +         +    C       +        
Sbjct  41   CLSDYVSTSTCEWRMAGPVN--CSAEFRLSYQLKFFNTENHTTC---VPENRAGSVCVCH  95

Query  182  EGDSSFYIVSMCVASSV-GSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV-TWQ  239
                S  IV         G +     +F+    ++P  P N+ V     N     + TW 
Sbjct  96   MLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMV---HANISHTWLLTWS  152

Query  240  DPHSWNSSFYR-LRFELRYRAERSKT-FTTWMVK--DLQHHCVIHDAWSGLRHVVQLRAQ  295
            +P+   S  Y  L + +    E   T F  + V           +   SG  +  +++A 
Sbjct  153  NPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAW  212

Query  296  EEFGQGEWSEWSPEAMGTPWTESR  319
             +     WSEWSP      + E  
Sbjct  213  AQRYNSTWSEWSPSVKWLNYYEEP  236


> sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase 
F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
Length=1909

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/274 (15%), Positives = 87/274 (32%), Gaps = 24/274 (9%)

Query  26   PAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS  85
            P   +       +PG SV LTC  V       V W+  +           G   R +L  
Sbjct  233  PRFSIPPTNHEVMPGGSVNLTCVAVGAP-MPYVKWMTGEVELTKDEEMPVG---RNVLEL  288

Query  86   VQLHDSGNYSC---YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSL  142
              +  S NY+C      G    T  + V   P+ P      ++  ++V   W     P  
Sbjct  289  TNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSG-NPEP  347

Query  143  TTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK-  201
             +  ++  R   +    D          + ++S     P  +   Y   +   +++G   
Sbjct  348  VSYYIIQYRAKTS----DTNFQEVDGVATTRYSIGGLSPYSE---YEFRVMAVNNIGRGP  400

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA--  259
             S+    +        PP ++    ++ +     V W+ P     +     + + Y +  
Sbjct  401  PSEPVETRTGEQAPSSPPLHVQARMLSASTML--VQWEPPE--EPNGQIRGYRIYYTSDL  456

Query  260  -ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
                  +      D +    I    +G+ + +++
Sbjct  457  DAPLSAWQKHNTDDSRL-TTISSLTTGITYSLRV  489


 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 79/279 (28%), Gaps = 32/279 (11%)

Query  75   AGMGRRLLLRSVQLHDSGNYSCYRAGRP--AGTVHLLVDVPPEEPQLSCFRKSPLSNVVC  132
               G    LR +     G       G P     V     VP +        +     ++ 
Sbjct  479  LTTGITYSLRVLGFTSVG------DGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLT  532

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
               P   P    K  L         A+      +                   + Y  S+
Sbjct  533  WLWPVQDP--IIKYELQY-----WEADS---DNKIHVTFDPAGSYAVEGLKPDTLYKFSL  582

Query  193  CVASSVGS-KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
               S +G   F+     +        PP ++ + +++     + V+W  P + +     +
Sbjct  583  AARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTS--IKVSWVAPPAASRHGAIV  640

Query  252  RFELRYRAERSKTFTTWMVKDLQ---HHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP  308
            R+ + Y+A   +      V D+      CV+        + V +RA  + G G      P
Sbjct  641  RYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPG------P  694

Query  309  EAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRD  347
            E+       +   P        ++    N     + ++ 
Sbjct  695  ESTAVRIRTNEDVP--GAPPRKLEVEALNSTAIRVTWKP  731


 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 56/297 (19%), Positives = 92/297 (31%), Gaps = 37/297 (12%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRS-------VQLHDSGN  93
             + T+ C       +  + W          P    G GR   LRS        +  D G 
Sbjct  152  RTTTMLC-AASGNPDPEITWFKDF-----LPVDINGNGRIKQLRSGALQIENSEESDQGK  205

Query  94   YSCYRAGRPAGT----VHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLL  149
            Y C              +L V V    P+ S    +          P  + +LT  AV  
Sbjct  206  YECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEV------MPGGSVNLTCVAVGA  259

Query  150  VRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQ  209
               +      + +          +   +L      +++   +    SS+G   +   T Q
Sbjct  260  PMPYVKWMTGEVELTKDEEMPVGRNVLELTNIRQSTNY---TCVAISSLGMIEA---TAQ  313

Query  210  GCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM  269
                  P PP ++TVT        +++TW    S N       + ++YRA+ S T    +
Sbjct  314  VSVKALPKPPTSLTVTETTATS--VTLTW---DSGNPEPVS-YYIIQYRAKTSDTNFQEV  367

Query  270  VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
                     I        +  ++ A    G+G  SE  P    T      SPP   +
Sbjct  368  DGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSE--PVETRTGEQAPSSPPLHVQ  422


 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 68/228 (30%), Gaps = 20/228 (9%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWGPRSTP---SLTTKAVLLVRKFQNSPAEDFQE----  163
            DVP   P+         + +   W P  +           ++  + +N            
Sbjct  706  DVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQVIYSRLENGEPRGHPNIMDV  765

Query  164  ---PCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQPDPP  219
                 Q+  E       +       + Y V++   ++ G    SK +     G + P  P
Sbjct  766  ALPEAQWKIEESTEYEAVIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAV-PGKP  824

Query  220  ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVI  279
              I  T V        + WQ P         + + LRY+    + +          H  +
Sbjct  825  TMIISTTVGNTAL---IQWQPPKDMVGE--LMGYRLRYKRLEEENYEIREFSRTDDHHTV  879

Query  280  HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEV  327
             D   G  +   L A+   G G   E   + +GTP       P   +V
Sbjct  880  TDLHKGATYSFHLSARNRAGLG---EEYVKDIGTPEDVPSGFPLNLQV  924


 Score = 46.3 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 57/202 (28%), Gaps = 23/202 (11%)

Query  99   AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRST-PSLTTKAVLLVRKFQNSP  157
              R    V       P +P +     +  +  + +W P            L  ++ +   
Sbjct  806  GARSKAKVVTTTGAVPGKPTMI-ISTTVGNTALIQWQPPKDMVGELMGYRLRYKRLEEEN  864

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             E  +                       + Y   +   +  G             I  P+
Sbjct  865  YEIREFSRTDDH-------HTVTDLHKGATYSFHLSARNRAGLGEEY-----VKDIGTPE  912

Query  218  --P---PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
              P   P N+ V  +  +   L  TW+ P     +   + + + YR   SK  +T    D
Sbjct  913  DVPSGFPLNLQVVGLTTSTTRL--TWEPPALSERNGRIIHYIVVYRDINSKQNSTNRTSD  970

Query  273  LQHHCVIHDAWSGLRHVVQLRA  294
             Q    I        + ++++A
Sbjct  971  TQ--MTIQGLRPDTTYDIRVQA  990


> sp|P11276|FINC_MOUSE Fibronectin OS=Mus musculus OX=10090 GN=Fn1 
PE=1 SV=4
Length=2477

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 43/243 (18%), Positives = 82/243 (34%), Gaps = 24/243 (10%)

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DS  185
             S+ V  W   S     T +   V    +   ++         +    +  + +P+    
Sbjct  732  ASSFVVSWVSASD----TVSGFRVEYELSEEGDE-----PQYLDLPSTATSVNIPDLLPG  782

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              YIV++   S  G +     T Q      PD P + TV  V      + V W  P +  
Sbjct  783  RKYIVNVYQISEEGKQSLILSTSQTTA---PDAPPDPTVDQVDDTS--IVVRWSRPQAPI  837

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            +      + + Y      + T   + +  +   + D   G+++ + + A EE  +     
Sbjct  838  TG-----YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVF  892

Query  306  WSPEAMGTPWTESRSPPAENEVSTPMQALT----TNKDDDNILFRDSANATSLPVQDSSS  361
               E  GTP +++  PP + +             T  D     +R      SLP +    
Sbjct  893  IQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQR  952

Query  362  VPL  364
            +P+
Sbjct  953  LPV  955


 Score = 46.0 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 62/186 (33%), Gaps = 20/186 (11%)

Query  112   VPPEEPQLS--CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ  169
             V PE PQL+   F     S++   W P         + ++  +     A +     +   
Sbjct  1262  VVPEVPQLTDLSFVDITDSSIGLRWTP------LNSSTIIGYRITVVAAGEGIPIFEDFV  1315

Query  170   ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
             +S      +   E    + I  + + +      S   T      +   PP ++  T +  
Sbjct  1316  DSSVGYYTVTGLEPGIDYDISVITLINGG---ESAPTTLTQQTAVP--PPTDLRFTNIG-  1369

Query  230   NPRWLSVTWQDPHSWNSSFYRLRFELRYRA-ERSKTFTTWMVKDLQHHCVIHDAWSGLRH  288
              P  + VTW  P S   +       +RY   +  +      +    +  V+ +   G  +
Sbjct  1370  -PDTMRVTWAPPPSIELTNLL----VRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEY  1424

Query  289   VVQLRA  294
             +V + +
Sbjct  1425  LVSVSS  1430


 Score = 40.9 bits (94),  Expect = 0.030, Method: Composition-based stats.
 Identities = 40/228 (18%), Positives = 79/228 (35%), Gaps = 37/228 (16%)

Query  129   NVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFY  188
             +    W     P   T  ++      +        P Q      + S  L       + Y
Sbjct  1463  SFTVHWVAPRAP--ITGYIIRHHAEHSVG-----RPRQDRVPPSRNSITLT-NLNPGTEY  1514

Query  189   IVSMCVASSVGSKFSKT---QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
             +VS+   +  G + S     Q      I     P ++ V  +A  P  L ++W+ P   +
Sbjct  1515  VVSIIAVN--GREESPPLIGQQATVSDI-----PRDLEV--IASTPTSLLISWEPPA-VS  1564

Query  246   SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
               +YR+ +        +     + V   +    I++   G  + + L A    G+G+   
Sbjct  1565  VRYYRITYG---ETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAV--TGRGD---  1616

Query  306   WSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNIL--FRDSANA  351
              SP +     ++  S   + E+  P Q   T+  D++I   +  S + 
Sbjct  1617  -SPAS-----SKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSP  1658


 Score = 36.7 bits (83),  Expect = 0.53, Method: Composition-based stats.
 Identities = 34/142 (24%), Positives = 49/142 (35%), Gaps = 19/142 (13%)

Query  183   GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
                  Y+  +        + S   T Q    L  D P N+    V    R + VTW  P 
Sbjct  967   SPGVTYLFKVFAVHQG--RESNPLTAQQTTKL--DAPTNLQ--FVNETDRTVLVTWTPPR  1020

Query  243   SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
             +  + + RL   L  R  + K +    V  L     + +   G  + V L A +   Q  
Sbjct  1021  ARIAGY-RLTAGL-TRGGQPKQYN---VGPLASKYPLRNLQPGSEYTVTLVAVKGNQQ--  1073

Query  303   WSEWSPEAMG--TPWTESRSPP  322
                 SP+A G  T     RS P
Sbjct  1074  ----SPKATGVFTTLQPLRSIP  1091


 Score = 36.7 bits (83),  Expect = 0.65, Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 33/83 (40%), Gaps = 8/83 (10%)

Query  213   ILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM--  269
             ++ P  PP N+ + A   +   L+V+W+   + + +     + +       +  T+    
Sbjct  1169  VVTPLSPPTNLHLEA-NPDTGVLTVSWERSTTPDITG----YRITTTPTNGQQGTSLEEV  1223

Query  270   VKDLQHHCVIHDAWSGLRHVVQL  292
             V   Q  C   +   GL + V +
Sbjct  1224  VHADQSSCTFENLNPGLEYNVSV  1246


> sp|P32004|L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo 
sapiens OX=9606 GN=L1CAM PE=1 SV=2
Length=1257

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 49/362 (14%), Positives = 112/362 (31%), Gaps = 44/362 (12%)

Query  12   LLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHP  71
            LLA     +                ++ G +  L C         +V W+          
Sbjct  413  LLANAYIYVVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAP-VPSVQWLDEDGTTVLQD  471

Query  72   SRWAGMGR-RLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEE-------PQLSCFR  123
             R+       L +R +Q +D+G Y C  A      V ++ ++  ++       P+ +  +
Sbjct  472  ERFFPYANGTLGIRDLQANDTGRYFC-LAANDQNNVTIMANLKVKDATQITQGPRSTIEK  530

Query  124  KSPLSNVVC--EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
            K       C   + P   PS+T +             ++  +  +Y  E  +     ++ 
Sbjct  531  KGSRVTFTCQASFDPSLQPSITWRG-------DGRDLQELGDSDKYFIEDGRLVIH-SLD  582

Query  182  EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN-PRWLSVTWQD  240
              D   Y  S   ++ +    S+ Q         P P   + ++ +       + V+W  
Sbjct  583  YSDQGNY--SCVASTELDVVESRAQLLVVGS---PGPVPRLVLSDLHLLTQSQVRVSWSP  637

Query  241  PHSWNSSFYRLRFELRYRAERS--KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
                N+     ++++ +  +    + + +                  + +  ++ A  ++
Sbjct  638  AEDHNAPIE--KYDIEFEDKEMAPEKWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKY  695

Query  299  GQGEWSEWSPEAMGTPWTESRSPPA-----------ENEVSTPMQALTTN--KDDDNILF  345
            G GE S  S   + TP       P                  P++ +  N  +    + +
Sbjct  696  GPGEPSPVSETVV-TPEAAPEKNPVDVKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQW  754

Query  346  RD  347
            R 
Sbjct  755  RP  756


> sp|P57097|MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus 
OX=10116 GN=Mertk PE=2 SV=1
Length=994

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 45/303 (15%), Positives = 92/303 (30%), Gaps = 49/303 (16%)

Query  41   DSVTLTC----PGVEPEDNATVHWVLRKPAAGSHPS--------RWAGMGRRLLLRSVQL  88
             SV   C    P V  E      W   K   G+H S            +     + SVQ 
Sbjct  103  KSVKFNCSINIPNVYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQR  162

Query  89   HDSGNYSCY--RAGRPAGTVHLLV---DVP--PEEPQLSCFRKSPLSNVVCEWGPRSTPS  141
             D+G+Y C      R   +  + V    +P   ++P+     ++   N+ C+      P 
Sbjct  163  SDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQ---AVGPP  219

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSK  201
                   +    + +   + + P   +      +   +                +  G  
Sbjct  220  EPVNIFWVQNSSRVNENPE-RSPSVLTVAGLTETAVFSC------------EAHNDKGLT  266

Query  202  FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE-LRYRAE  260
             SK    Q    + P PP  + +  +      + V+W         +  L+   ++ +  
Sbjct  267  VSK--GVQINIKVIPSPPTEVHI--LNSTAHSILVSWVP---GFDGYSPLQNCSIQVKEA  319

Query  261  RSKTFTTWMVKDLQHH---CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTE  317
               +  + MV +         +    +   + V +  + E G   WS  SP  + +    
Sbjct  320  DQLSNGSVMVFNTSASPHLYEVQQLQALANYSVTVSCRNEIG---WSAVSPWILASTTEG  376

Query  318  SRS  320
            + +
Sbjct  377  APA  379


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 47/361 (13%), Positives = 91/361 (25%), Gaps = 54/361 (15%)

Query  44   TLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY----RA  99
             LTC  V P +   + WV        +P R        +L    L ++  +SC     + 
Sbjct  210  NLTCQAVGPPEPVNIFWVQNSSRVNENPERSPS-----VLTVAGLTETAVFSCEAHNDKG  264

Query  100  GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPA  158
               +  V + + V P  P       S   +++  W P            + V++      
Sbjct  265  LTVSKGVQINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADQLSN  324

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-  217
                        S              + Y V++   + +G                P  
Sbjct  325  GSVMV----FNTSASPHLYEVQQLQALANYSVTVSCRNEIGWSAVSPWILASTTEGAPAV  380

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
             P NITV  +  +   L + W  P         + + +            W         
Sbjct  381  APLNITV-FLNESSNNLEIRWTKPPIKRQDGELVGYRI---------SHVWESAGTSKEL  430

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
                            ++E    G W++   +      T   +   +  +    + +   
Sbjct  431  ----------------SEEVSQNGSWAQVPVQMHNATCTVRIAVITKGGIGPFSEPVDV-  473

Query  338  KDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRAL  397
                      +    S      SS P P    +   L      C  +++       L   
Sbjct  474  ----------AIPEHSRVDYAPSSTPAPGNTESM--LIILGCFCGFVLMGLILYLSLAIK  521

Query  398  K  398
            +
Sbjct  522  R  522


> sp|P0DSP1|SORL_RAT Sortilin-related receptor OS=Rattus norvegicus 
OX=10116 GN=Sorl1 PE=1 SV=1
Length=2215

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/187 (17%), Positives = 60/187 (32%), Gaps = 16/187 (9%)

Query  122   FRKSPLSNVVCEWG-PRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
             +      +V   W  P+  PS +    +  R       E   +  +          ++  
Sbjct  1563  WIADFSGDVTLTWTRPKKMPSASCVYNVYYR----VVGESIWKTLETHSNKTSTVLKVLK  1618

Query  181   PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ--PDPPANITVTAVARNPRWLSVTW  238
             P+   + Y V + V     SK   T  F      +  PD P N+ ++  +     +   W
Sbjct  1619  PD---TTYQVKVQV--HCLSKVHNTNDFVTLRTPEGLPDAPRNLQLSLNSEEEGVILGHW  1673

Query  239   QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
               P   ++      + + Y    SK + +           I +      + V++ A    
Sbjct  1674  APP--VHTHGLIREYIVEYSRSGSKMWASQRAASNSTE--IKNLLLNALYTVRVAAVTSR  1729

Query  299   GQGEWSE  305
             G G WS+
Sbjct  1730  GIGNWSD  1736


> sp|P28192|PTP4_CAEEL Tyrosine-protein phosphatase 4 OS=Caenorhabditis 
elegans OX=6239 GN=ptp-4 PE=2 SV=3
Length=1159

 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/200 (16%), Positives = 62/200 (31%), Gaps = 14/200 (7%)

Query  102  PAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDF  161
            P  T   L + P   PQ+   R      V     P    +      L++   Q       
Sbjct  226  PETTFRTLGESPNRPPQIQKIRNITSECVEVTITPPDEMNGELDKYLVL--IQAVNETIP  283

Query  162  QEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPAN  221
            ++       S   +         S+ Y +++   +  G+    T  F     +    P+ 
Sbjct  284  RKMTFDKPTSTPLTI---CALSPSTDYALAIEADNGFGTSPQATLVFHTEDSVPNWSPST  340

Query  222  ITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF--TTWMVKDLQHHCVI  279
            IT   V   P  ++V W  P    +    +++ L Y+A+    +      V        +
Sbjct  341  ITTLPVVGKPE-ITVLWPAPPLNATEK-VIKYHLYYKAKNEDQWKIEHLNVSPNGVKSKL  398

Query  280  H-----DAWSGLRHVVQLRA  294
                  D     ++ +++ A
Sbjct  399  FKYRLVDLNPNTQYRIRVSA  418


 Score = 49.0 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 55/342 (16%), Positives = 91/342 (27%), Gaps = 43/342 (13%)

Query  24   RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLL  83
              P              DS+  +       D++   WV         P         L +
Sbjct  52   ETPRLVRRLDWFQD---DSLVASYQQDILADSSRQWWVSDGRYQLIRPF------YTLRV  102

Query  84   RSVQLHDSGNYSCYRAGRPAGTVH----------LLVDVPPEEPQLSCFRKSPLSNVVCE  133
              V   DSG Y C     P  +            ++  V P  P++  F      ++   
Sbjct  103  SPVTPEDSGTYRCRLETDPLFSSPQSTATQELAVMVKPVAPSSPEIKTFTNR---SITLV  159

Query  134  WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
            W   +  +        V     S    F      +  +      +       + Y  S+ 
Sbjct  160  WTHNAARAHRPILRFSVSVRTVSDNTRFVMAAPSNATT-----VIVDNLSPYTLYAFSVR  214

Query  194  VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
              +S GS     +T        P+ P  I           + VT   P   N      ++
Sbjct  215  AENSAGSSDFGPETTFRTLGESPNRPPQIQ-KIRNITSECVEVTITPPDEMNGELD--KY  271

Query  254  ELRYRAERSKT-FTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
             +  +A            K       I        + + + A  + G G     SP+A  
Sbjct  272  LVLIQAVNETIPRKMTFDKPTSTPLTICALSPSTDYALAIEA--DNGFGT----SPQATL  325

Query  313  TPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSL  354
               TE  S P  +  ST        K +  +L+     A  L
Sbjct  326  VFHTED-SVPNWS-PSTITTLPVVGKPEITVLW----PAPPL  361


> sp|Q8QFP9|TYRO3_XENLA Tyrosine-protein kinase receptor TYRO3 
OS=Xenopus laevis OX=8355 GN=tyro3 PE=1 SV=1
Length=880

 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 47/312 (15%), Positives = 97/312 (31%), Gaps = 81/312 (26%)

Query  81   LLLRSVQLHDSGNYSC---YRAGRPAG-TVHLLVDVPP----EEPQLSCFRKSPLSNVVC  132
            L L++V+  D+G Y C   +   +     + ++V+  P    E   LS    SP  N+ C
Sbjct  88   LSLKNVERPDAGKYWCEAEHSGRKSVSDAIWIMVEGVPYFTLEPKDLSVTPNSPF-NMTC  146

Query  133  ------------EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
                         W                                   E   FSC    
Sbjct  147  AAVGPPEPLVIIWW----VGDSPLGKSESSPSVLQMSG---------IHERTAFSC----  189

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
                           ++ G   S+T   +  G+  P PP N+T++ V  +    +VTW  
Sbjct  190  ------------EAHNAKGVSSSRTAIVEVKGL--PYPPFNVTISKVTGSTA--TVTWFP  233

Query  241  PHSWNSSFYRLRFE-LRYRAER-SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
                 +SF  ++   ++ ++   ++   + ++       ++ +      H V+++   E 
Sbjct  234  ---GFNSFSLIKSCTIQVQSLHGNREMYSRLISAPPFAVLLDELQPLTNHSVRVQCTNEM  290

Query  299  GQGEWSEW---------------------SPEAMGTPWTE-SRSPPAENEVSTPMQALTT  336
            G   ++EW                     +  ++   W E        N +   +Q    
Sbjct  291  GASPFTEWRTFHTKETVPQLLPQNVHMTKTETSLLLDWEEVEPDREGYNILGFKVQWEQE  350

Query  337  NKDDDNILFRDS  348
            N     +  +++
Sbjct  351  NATQGELFVQEN  362


> sp|Q92673|SORL_HUMAN Sortilin-related receptor OS=Homo sapiens 
OX=9606 GN=SORL1 PE=1 SV=2
Length=2214

 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/186 (16%), Positives = 57/186 (31%), Gaps = 14/186 (8%)

Query  122   FRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
             +      +V   W  P+  PS +    +  R    S  +  +     +         +  
Sbjct  1563  WTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNT-------VLK  1615

Query  181   PEGDSSFYIVSMCVA-SSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQ  239
                  + Y V + V   S     +   T +    L PD P N+ ++        +   W 
Sbjct  1616  VLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGL-PDAPRNLQLSLPREAEGVIVGHWA  1674

Query  240   DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
              P   ++      + + Y    SK + +           I +      + V++ A    G
Sbjct  1675  PP--IHTHGLIREYIVEYSRSGSKMWASQRAASNFTE--IKNLLVNTLYTVRVAAVTSRG  1730

Query  300   QGEWSE  305
              G WS+
Sbjct  1731  IGNWSD  1736


> sp|Q63HQ2|EGFLA_HUMAN Pikachurin OS=Homo sapiens OX=9606 GN=EGFLAM 
PE=1 SV=2
Length=1017

 Score = 54.0 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 48/303 (16%), Positives = 88/303 (29%), Gaps = 34/303 (11%)

Query  130  VVCEWGPRSTPSLTT-KAVLLVRKF-QNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSF  187
               +W     P        +   +   +   ++       S++    + ++       + 
Sbjct  51   FSIQWKMPRHPGSPILGYTVFYSEVGADKSLQEQLHSVPLSRDI-PTTEEVIGDLKPGTE  109

Query  188  YIVSMCVASSVGSKF-SKTQTFQGCG---ILQPDPPANITVTAVARNPRWLSVTWQD---  240
            Y VS+   S  G    S  +          L P  P    V  V  +   ++++W+    
Sbjct  110  YRVSIAAYSQAGKGRLSSPRHVTTLSQDSCLPPAAPQQPHVIVV--SDSEVALSWKPGAS  167

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
              S    +Y + F    R +  K +T+   +      VI        +   +RA    G 
Sbjct  168  EGSAPIQYYSVEF---IRPDFDKKWTSIHERIQMDSMVIKGLDPDTNYQFAVRAMNSHGP  224

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS  360
               S W  + + T   E            P         +D+  F D  +   L +    
Sbjct  225  SPRS-WPSDIIRTLCPEEAGSGRYG----PRYITDMGAGEDDEGFEDDLD---LDISFEE  276

Query  361  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP  420
              PLP     GG+  F         +  KK          +       SL  +    P+P
Sbjct  277  VKPLPA--TKGGNKKFL--------VESKKMSISNPKTISRLIPPTSASL-PVTTVAPQP  325

Query  421  TPV  423
             P+
Sbjct  326  IPI  328


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 57/155 (37%), Gaps = 19/155 (12%)

Query  213  ILQPD---PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR--AERSKTFTT  267
            I +P    PP +I + A+  N    S+ W+ P   +     L + + Y            
Sbjct  29   IRKPGKVGPPLDIKLGAL--NCTAFSIQWKMPR--HPGSPILGYTVFYSEVGADKSLQEQ  84

Query  268  WMVKDL-----QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                 L         VI D   G  + V + A  + G+G  S  SP  + T   +S  PP
Sbjct  85   LHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQAGKGRLS--SPRHVTTLSQDSCLPP  142

Query  323  AENEVSTPMQALTTNKDDDNILFRDSANATSLPVQ  357
            A  +       +  +  +  + ++  A+  S P+Q
Sbjct  143  AAPQQPH---VIVVSDSEVALSWKPGASEGSAPIQ  174


> sp|O88307|SORL_MOUSE Sortilin-related receptor OS=Mus musculus 
OX=10090 GN=Sorl1 PE=1 SV=3
Length=2215

 Score = 54.4 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 60/187 (32%), Gaps = 16/187 (9%)

Query  122   FRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV  180
             +      +V   W  P+  PS +    +  R       E   +  +          ++  
Sbjct  1563  WTADFSGDVTLTWMRPKKMPSASCVYNVYYR----VVGESIWKTLETHSNKTSTVLKVLK  1618

Query  181   PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ--PDPPANITVTAVARNPRWLSVTW  238
             P+   + Y V + V     +K   T  F      +  PD P N+ ++  +     +   W
Sbjct  1619  PD---TTYQVKVQV--HCLNKVHNTNDFVTLRTPEGLPDAPRNLQLSLNSEEEGVILGHW  1673

Query  239   QDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
               P   ++      + + Y    SK + +           I +      + V++ A    
Sbjct  1674  APP--VHTHGLIREYIVEYSRSGSKMWASQRAASNSTE--IKNLLLNALYTVRVAAVTSR  1729

Query  299   GQGEWSE  305
             G G WS+
Sbjct  1730  GIGNWSD  1736


> sp|Q90478|L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) 
OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
Length=1197

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 44/265 (17%), Positives = 98/265 (37%), Gaps = 23/265 (9%)

Query  44   TLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC---YRAG  100
             L  P V+   +      +    +        G  + L    VQ+ D G YSC       
Sbjct  479  NLKSPTVQWNKDGH---KITASTSNDKYHEIEGSLKVL---DVQMEDMGIYSCEVSTTLD  532

Query  101  RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAE  159
                + ++ V   P+ PQ     +    +V   W P    +   T+ V+ + + +     
Sbjct  533  SDTASGYITVQDKPDPPQSLKLSEKMERSVTISWMPSVENNSPVTEYVIEMNEGETPDEG  592

Query  160  DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTF-QGCGILQPDP  218
             +Q+    SQ+   +    +      S Y   +   +S+G+      +        +PD 
Sbjct  593  QWQKYRSVSQDIDSWRSICSY-----SKYHFQIRAVNSIGTSAPTESSLSYSTPAAKPDT  647

Query  219  -PANITVTAVARNPRWLSVTWQ--DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
             P N  V  ++ +P+ + ++WQ  D   +N   ++ +   R  A+    +T   V +   
Sbjct  648  NPEN--VMTLSTDPKSMIISWQEMDRRQFNGPGFQYKVFWRRAADSGAHWTESSVSN--P  703

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQ  300
              ++++  + +   ++++A  + G 
Sbjct  704  PLMVNNTGTFVSFEIKVQAVNDLGA  728


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 37/196 (19%), Positives = 64/196 (33%), Gaps = 22/196 (11%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRK---PAAGSHPSRWAGMGRRLLLRSVQLHDSGNY  94
             PG++V L C   +      + W +           P R    G+ L+L +V+  D+  Y
Sbjct  280  APGETVRLDCK-ADGIPAPNITWSINGVPVSGTDVDPRRRVSSGK-LILSNVEFSDTAVY  337

Query  95   SCY---RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR  151
             C    + G      H+ V   P +  L+   +   +          T  L  +      
Sbjct  338  QCEAVNKHGSILINTHVHVVELPAQ-ILTPDERLYQATA------GQTVMLDCRTFGSPL  390

Query  152  KFQNSPAEDFQ---EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTF  208
               +    D        + SQ +        V E DS+ Y  S+   +   S  +  +  
Sbjct  391  PKIHWEILDSIPALSNAKISQTTNGSLKISNVSEEDSNRYTCSVSETN--KSISADVEVL  448

Query  209  QGCGILQPDPPANITV  224
                I+   PP N+ V
Sbjct  449  NRTKIV--GPPQNLHV  462


> sp|Q9P232|CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 
PE=1 SV=3
Length=1028

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 47/324 (15%), Positives = 96/324 (30%), Gaps = 21/324 (6%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRK-----PAAGSHPSRWAGMGR-RLLLRSVQLHDSG  92
            G+SV L C    +P  +    W            GSH  +  G     L++R++QL  SG
Sbjct  514  GESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSGDLMIRNIQLKHSG  573

Query  93   NYSC--YRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLL  149
             Y C         +    L+V   P  P+     +   +     W           +  +
Sbjct  574  KYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVISYSI  633

Query  150  VRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQTF  208
              +   S             + +  +  +         Y   +  ++ +G    S     
Sbjct  634  QARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVE-YEFRVVASNKIGGGEPSLPSEK  692

Query  209  QGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW  268
                   P+ P +  V     +   L +TW        +     + + +R     T+   
Sbjct  693  VRTEEAVPEVPPS-EVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQT  751

Query  269  MVK---DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
            +V      ++            + V++      G+G +S            E     A +
Sbjct  752  VVTSPDTPRYVFRNESIVPYSPYEVKVGVYNNKGEGPFS----PVTTVFSAEEEPTVAPS  807

Query  326  EVSTPMQALTTNKDD-DNILFRDS  348
            +VS    + +  +   + I ++ S
Sbjct  808  QVSANSLSSSEIEVSWNTIPWKLS  831


 Score = 43.6 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 53/153 (35%), Gaps = 8/153 (5%)

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSW  244
            S Y V + V ++ G       T       +P   P+ ++  ++  +   + V+W      
Sbjct  772  SPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSL--SSSEIEVSWNTIPWK  829

Query  245  NSSFYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
             S+ + L +E+RY     + ++ +   V   +    +    S L +   +RA    G G 
Sbjct  830  LSNGHLLGYEVRYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGP  889

Query  303  WSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
            +S        T      S P  N V        
Sbjct  890  FSA---TVNVTTKKTPPSQPPGNVVWNATDTKV  919


> sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans 
OX=6239 GN=ttn-1 PE=1 SV=2
Length=18562

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/335 (17%), Positives = 107/335 (32%), Gaps = 35/335 (10%)

Query  27     AQEVARGVLTSLP-------GDSVTLTCPGVEPEDNATVHWVLRKPA---AGSHPSRWAG  76
               +E+    +  LP       G  VT++     P D + V W+           +     G
Sbjct  13959  VEELPVDFVKYLPRKTSGKEGQEVTISVTLNHPIDISKVVWLKDGKPLEINKDYSIDTVG  14018

Query  77     MGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPL-----SNVV  131
                  L LR  +  DSG Y     G    + HL +     +P L    ++        +  
Sbjct  14019  CSVSLTLRRAKYEDSGKYKVVCDGVD-CSTHLSIQ---GKPVLKNVSETKPVITVDKDDQ  14074

Query  132    CEWGPRSTPSLTTKAVLLVRKFQ-NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV  190
                       +      + V             +      +  K    ++  +     Y V
Sbjct  14075  FSLLVAYDSNPEASFSMTVDGKDLEFDGRSRIDVVDDGLKLTKRG--VSKTDAGE--YEV  14130

Query  191    SMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR  250
               +   +  G      Q F       P  P +++V  V      L + W  P   ++    
Sbjct  14131  KL--KNEFGEVA---QKFDVKVNDTPSAPGDVSV--VKAESDCLHIEWTAPTE-DNGAEV  14182

Query  251    LRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
                + +  +    + F     V   +   V+ D      ++V++ A  +FG GE+ E  P 
Sbjct  14183  TSYVIEKKESGRRKFHKVATVNGKKTSYVVDDLEIETPYIVRIAAVNKFGTGEFIETKPV  14242

Query  310    AMGTPWTES--RSPPAENEVSTPMQALTTNKDDDN  342
                G+P+       PP  + V++   +L+  K  ++
Sbjct  14243  QTGSPFQVPTVEFPPTIDNVTSTSCSLSWPKPIED  14277


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 73/220 (33%), Gaps = 27/220 (12%)

Query  99     AGRPAGTVHLLVDVPPEEPQLS---CFRKSPLSNVVCEW-GPRSTPSLTTKAVLLVRKFQ  154
               G    T  +    P + P +           ++    W  P             V K +
Sbjct  14233  TGEFIETKPVQTGSPFQVPTVEFPPTIDNVTSTSCSLSWPKPIEDGGSP-VYGYDVYKRE  14291

Query  155    NSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQT---FQGC  211
              N   E  +   +    ++ F+            Y   +   +  G + +           
Sbjct  14292  N-EGEWQKMNGEELVFTESFNV---RALSSGKEYEFKIEACNEAGLRSNSNVVSKKLTVE  14347

Query  212    GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
              G++ P+   ++ +  V  N + + VTW+             F ++Y+++ S  + +  + 
Sbjct  14348  GLV-PEIILDMPMVKVLDNDK-VEVTWKSDGEK-------EFVVQYKSDGSSIWASVDIG  14398

Query  272    D------LQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
                         C+I     G+ +V ++ A+ + G GE+SE
Sbjct  14399  GPRSESAATSKCIIDGLREGIPYVFRVAARNQHGTGEFSE  14438


 Score = 40.9 bits (94),  Expect = 0.032, Method: Composition-based stats.
 Identities = 46/355 (13%), Positives = 102/355 (29%), Gaps = 73/355 (21%)

Query  14     AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
               +    +     P  E  + ++    GD   L+    EP   ++V+W           + 
Sbjct  15271  VSIAVTVKLPEVPKVEAEQSIVEVKVGDVAKLSAKISEPA--SSVNWTKDDKPIKEDGNV  15328

Query  74     WAGMG----RRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLV-----DVP--PEEPQL  119
               A +      +L +       SG Y       AG+    + L +       P  P  P +
Sbjct  15329  KAQLSPDGTAQLTISKTDSAHSGIYKLNVENDAGKGKVEIALRIKGAAKGAPGIPTGPIV  15388

Query  120    SCFRKSPLSNVVCEWGPRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
                      +       P +      T   +  ++ +N   +   +  +   ++       
Sbjct  15389  FDDVTESSAEFS-WKAPENNGGCEITGYNVERKESKNKGWKQCGKTKELKFKADGLE---  15444

Query  179    AVPEGDSSFYIVSMCVASSVG-------------------------------SKFSKTQT  207
                   + + Y V +   +++G                                  S   +
Sbjct  15445  -----EGTDYDVKVSAVNTMGTGSALEGKITTLKKKEETGKQKSEKSESDEKKSESDKVS  15499

Query  208    FQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKT-FT  266
               +   I +P          V+     +++ W   +        + + ++ +   SK  + 
Sbjct  15500  -ELKQIGKP--------EYVSSTATSIALKWTSDND------EVTYTVQMKEANSKRPWA  15544

Query  267    TWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
                  +  +    I     G  ++ ++ AQ + GQ   SE S        TES+ P
Sbjct  15545  VVAKEISECSATIAQLKEGTSYLFRVIAQNKTGQTVTSEQSESIECKDTTESKKP  15599


 Score = 40.6 bits (93),  Expect = 0.043, Method: Composition-based stats.
 Identities = 20/102 (20%), Positives = 36/102 (35%), Gaps = 7/102 (7%)

Query  253    FELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
              +E+  R    + + +           I        ++ ++  + + G GEWS    E   
Sbjct  17184  YEVERRCPDQREWVSCGSTK-SLELEIKGLTPNTEYIFRVAGKNKQGLGEWS----EMTS  17238

Query  313    TPWTESRSPPAENEVSTPMQALTTNKDDD-NILFRDSANATS  353
              T  T S     +  +S P   +  N+DD+  I    S   T 
Sbjct  17239  TLKTASVGQAPQFTIS-PQSKIIANRDDEFEIAVEFSGTPTP  17279


 Score = 40.2 bits (92),  Expect = 0.051, Method: Composition-based stats.
 Identities = 45/265 (17%), Positives = 82/265 (31%), Gaps = 31/265 (12%)

Query  58     VHWVLRKPAAGSHPSRWAGMG---RRLLLRSVQLHDSGNY---SCYRAGRPAGTVHLLVD  111
              +HW   K    S   +W         L +  ++  D G Y       AG    +  L +D
Sbjct  15630  IHWFKNKKEIFSGKRQWIENIAGATSLTIGEMREDDEGEYKIVVKNTAGSVEHSCKLTMD  15689

Query  112    VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
                PE  ++  +  +                 T K  L                 +  +ES
Sbjct  15690  QLPEINRVDRYAST----------LVFDKGETVKLRLSFSGRPQPEVIWIDNNGKVIEES  15739

Query  172    QKFSCQLAVPEGDSSFYIV--------SMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
              +K   +  V     +   +        ++ + +  G         Q     +P  P    
Sbjct  15740  RKMKIEKTVLNTVLTINSIDSQDQGEFALKIKNRCGE-DKYAIGIQVTD--RPAAPGKPA  15796

Query  224    VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAW  283
              V    +N   + + W  P + +       + +    E+ KT+T   V   Q    + +  
Sbjct  15797  VE--DQNVDSVRLRWAAPTN-DGGSPVRNYTVEMCTEKGKTWTKAEVTK-QAFITLFNLV  15852

Query  284    SGLRHVVQLRAQEEFGQGEWSEWSP  308
               G  +  ++RA   FGQ E S+ S 
Sbjct  15853  PGESYRFRVRADNTFGQSEPSDESE  15877


 Score = 37.9 bits (86),  Expect = 0.26, Method: Composition-based stats.
 Identities = 18/101 (18%), Positives = 33/101 (33%), Gaps = 9/101 (9%)

Query  39    PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRW----AGMGRRLLLRSVQLHDSGNY  94
             PG + T+ C   E E   ++ W+           +      G+   L++      DSG Y
Sbjct  3118  PGSTATIACELEECELKRSIRWLRDGKDIRFEQGKTEHVQNGLKHYLVVHDATSLDSGLY  3177

Query  95    SCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWG  135
                R+        +   V      + C    P  ++  +W 
Sbjct  3178  KTERSEEQCEETIIPRGVVA---TIQCQTSEPQESI--QWS  3213


> sp|O15197|EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens 
OX=9606 GN=EPHB6 PE=1 SV=4
Length=1021

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 59/340 (17%), Positives = 97/340 (29%), Gaps = 59/340 (17%)

Query  4    VGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR  63
               A  A+L+AA G  +A           GV     G    L C G          W++ 
Sbjct  247  ASGAGGASLVAAVGTCVAHAEPE----EDGVGGQAGGSPPRLHCNGEGK-------WMVA  295

Query  64   KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVP-PEEPQLSC-  121
                   P      G     ++ Q    G Y       P          P P  P   C 
Sbjct  296  VGGCRCQPGYQPARG----DKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCL  351

Query  122  ----FRKSPLSNVVCEWGPRSTPSL-----TTKAVLLVRKFQNSPAED---FQEPCQYSQ  169
                   S      C   P +   L      +  +L  R  +         F   C+  +
Sbjct  352  EGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECE  411

Query  170  ESQK------FSCQLAVPEGDSSFYIVSMCVAS-------SVGSKFSKTQTFQGCGILQP  216
              Q+       +C     E         +  +        +      + Q   G   L P
Sbjct  412  GRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSP  471

Query  217  DPPA----NIT-----------VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER  261
            DPP     N++           V  V+R    ++V+W  P    ++   L ++LRY  + 
Sbjct  472  DPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQ--TNGNILDYQLRYYDQA  529

Query  262  SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                 ++ +    +   +     G  +  Q+RA+   G G
Sbjct  530  EDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHG  569


> sp|Q9VWE0|DOME_DROME Cytokine receptor OS=Drosophila melanogaster 
OX=7227 GN=dome PE=1 SV=1
Length=1282

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 42/295 (14%), Positives = 89/295 (30%), Gaps = 25/295 (8%)

Query  29   EVARGVLTSLPGDSVTLTC-------PGVEPEDNATVHWVLRKPAAGSHPS---RWAGMG  78
             V    +  L G    L+C        G   ED                 S   R     
Sbjct  29   WVIPSKVEQLIGGDFNLSCTLNEDYFNGKSAEDCPVEKLYFTGGGRVYRDSKHIRILNNT  88

Query  79   RRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRS  138
              L   +  +    +Y C           + V   P   +           +VC +    
Sbjct  89   TILFSDTNAVEQENDYHCMCDEYVINKSKVYVGTRPLLVRDFNCLDYDFQFMVCNFTQPP  148

Query  139  TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES-QKFSCQLAVPEGDSSFYIVSMCVASS  197
               + TK  +      +    +  +    S                  +FY   + ++++
Sbjct  149  NT-VITKYNISYNTNNDWRYSNTLDCNFDSAPVVTCNLTDDNYKRFSETFYF-RLSISNA  206

Query  198  VGSKFSKTQTFQGCGILQPDPP-ANITVTAVARNPRWLSVTWQDPHSWNSSFYR-LRFEL  255
            +G   ++  T      L P  P  N+T+  + R    + ++W+ P    S++ R L +++
Sbjct  207  LGH-ETQPITINHFERLVPARPGQNLTL--LNRTESSVCLSWEMPR--RSNYNRGLVWQV  261

Query  256  RYRAER-----SKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            R   +        ++    +      C+    ++G  + +++R +       WSE
Sbjct  262  RVTPQNFEPITRPSWRNHTLTIKDTLCLTELPFAGYNYTLRVRVRANQNNTLWSE  316


> sp|P29319|EPHA3_MOUSE Ephrin type-A receptor 3 OS=Mus musculus 
OX=10090 GN=Epha3 PE=1 SV=1
Length=983

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/219 (16%), Positives = 73/219 (33%), Gaps = 16/219 (7%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  P+         ++V+ +W               +   +        EPC  +    
Sbjct  324  PPSAPRN-VISNINETSVILDWSWPLDTGGRKDITFNIICKKCGWNVRQCEPCSPNVRFL  382

Query  173  K------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL--QPDPPANITV  224
                    +          + Y   +   + V    S  + +    I   Q  P   +T+
Sbjct  383  PRQLGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQYAAVSITTNQAAPSPVMTI  442

Query  225  TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
                 +   +S++WQ+P   + +   L +E++Y  ++ +  +  +++    +  I     
Sbjct  443  KKDRTSRNSISLSWQEPE--HPNGIILDYEVKYYQKQEQETSYTILRARGTNVTISSLKP  500

Query  285  GLRHVVQLRAQEEFGQGEWS-----EWSPEAMGTPWTES  318
               +V Q+RA+   G G  S     E SP++       S
Sbjct  501  DTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS  539


> sp|P26954|IL3B2_MOUSE Interleukin-3 receptor class 2 subunit 
beta OS=Mus musculus OX=10090 GN=Csf2rb2 PE=1 SV=1
Length=878

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 76/210 (36%), Gaps = 21/210 (10%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES-  171
               +PQ        + ++ C W   +  + +    L  R    +P E      +  Q S 
Sbjct  245  DKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPAAPEEKCSPVVKEPQASV  304

Query  172  -QKFSCQLAVPE-GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVAR  229
              ++ C L VPE    S Y VS+          S          +Q +PP    +    +
Sbjct  305  YTRYRCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYYH-------IQMEPP----ILNQTK  353

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ--HHCVIHDAWSGLR  287
            N    S+ W+        +    F+++Y+ ++S+++     ++L   +   +        
Sbjct  354  NRDSYSLHWE--TQKIPKYIDHTFQVQYK-KKSESWKDSKTENLGRVNSMDLPQLEPDTS  410

Query  288  HVVQLRAQE-EFGQGEWSEWSPE-AMGTPW  315
            +  ++R +      G WSEWS E    T W
Sbjct  411  YCARVRVKPISDYDGIWSEWSNEYTWTTDW  440


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 42/271 (15%), Positives = 77/271 (28%), Gaps = 60/271 (22%)

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVR---KFQNSPAEDFQE----PCQYSQESQKF  174
                  + ++C W             LL     K Q+   E  ++     C  S      
Sbjct  39   CYNDYTNRIICSWADTEDAQGLINMTLLYHQLDKIQSVSCELSEKLMWSECPSSHRCVPR  98

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG-CGI-----------LQPDPPANI  222
             C +                     +  +   +FQ    +           +QP PP +I
Sbjct  99   RCVIPYTRFS---------------NGDNDYYSFQPDRDLGIQLMVPLAQHVQPPPPKDI  143

Query  223  TVTAVARNPRWLSVTWQ-----DPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
             ++    +     + W         SW SS   + FE+ Y+  +  ++         +  
Sbjct  144  HISP---SGDHFLLEWSVSLGDSQVSWLSSK-DIEFEVAYKRLQ-DSWEDASSLHTSNFQ  198

Query  278  VIHDAWSGLR---HVVQLRAQEEFG---QGEWSEWSPEAMGTPWTESRSPPAENE-----  326
            V  +    L    +  ++R +   G    G  S WSPE         ++ P   +     
Sbjct  199  VNLEPKLFLPNSIYAARVRTRLSAGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDG  258

Query  327  -----VSTPMQALTTNKDDDNILFRDSANAT  352
                  S  +   TT      + +R S  A 
Sbjct  259  IQSLHCSWEVWTQTTGSVSFGLFYRPSPAAP  289


> sp|Q03145|EPHA2_MOUSE Ephrin type-A receptor 2 OS=Mus musculus 
OX=10090 GN=Epha2 PE=1 SV=3
Length=977

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 46/211 (22%), Positives = 75/211 (36%), Gaps = 28/211 (13%)

Query  114  PEEP-QLSCFRKSPLSN----------VVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
            PE+P  +SC R     N          V   W            V  V   Q  P     
Sbjct  318  PEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGEC  377

Query  163  EPCQYSQESQK-------FSCQLAVPEGDSSFYIVSMCVASSV-GSKFSKTQTFQGCGIL  214
             PC+ S    +        S  ++  E   + Y  ++   + V G   S++       I 
Sbjct  378  GPCEASVRYSEPPHALTRTSVTVSDLEPHMN-YTFAVEARNGVSGLVTSRSFRTASVSIN  436

Query  215  QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ  274
            Q +PP    V    R+   LSVTW  P   +      ++E+ YR +      ++ V+  +
Sbjct  437  QTEPPK---VRLEDRSTTSLSVTWSIP--VSQQSRVWKYEVTYRKKGDA--NSYNVRRTE  489

Query  275  H-HCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
                 + D      ++VQ++A  + GQG  S
Sbjct  490  GFSVTLDDLAPDTTYLVQVQALTQEGQGAGS  520


> sp|Q07494|EPHB1_CHICK Ephrin type-B receptor 1 (Fragment) OS=Gallus 
gallus OX=9031 GN=EPHB1 PE=2 SV=2
Length=984

 Score = 52.9 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/213 (15%), Positives = 63/213 (30%), Gaps = 57/213 (27%)

Query  133  EWGPRSTPSLTTKAVLL-------VRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
            EW P                      +   S  +D  E         +    ++      
Sbjct  322  EWNPPRETGGRDDVTYNIVCKKCRADRRACSRCDDNVEFVPRQLGLTETRVFISSLWAH-  380

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT---------------AVARN  230
            + Y   +   + V +K              P PP +++V                 V+  
Sbjct  381  TPYTFEIQAVNGVSNKS-------------PFPPQHVSVNITTNQAAPSTVPIMHQVSAT  427

Query  231  PRWLSVTWQDPHSWNSSFYRLRFELRYRAE-------------------RSKTFTTWMVK  271
             R ++++W  P     +   L +ELRY  +                       + + + +
Sbjct  428  MRSITLSWPQPEQ--PNGIILDYELRYYEKLSRICTPDVSGTVGSRPAADHNEYNSSVAR  485

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
               +   +     G+ +VVQ+RA+   G G++S
Sbjct  486  SQTNTARLEGLRPGMVYVVQVRARTVAGYGKYS  518


> sp|Q60805|MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus 
OX=10090 GN=Mertk PE=1 SV=1
Length=994

 Score = 52.9 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 92/301 (31%), Gaps = 49/301 (16%)

Query  43   VTLTCPGVEP---EDNATVHWVLRKPAA-GSHPS--------RWAGMGRRLLLRSVQLHD  90
            V   C    P   ++ A + W        G+H S            +     + SVQ  D
Sbjct  105  VKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSD  164

Query  91   SGNYSCY--RAGRPAGTVHLLVDV--PP---EEPQLSCFRKSPLSNVVCEWGPRSTPSLT  143
            +G+Y C      R   +  + V+V   P   ++P+     ++   N+ C+      P   
Sbjct  165  NGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQ---AVGPPEP  221

Query  144  TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFS  203
                 +    + +   + + P   +      +   +                +  G   S
Sbjct  222  VNIFWVQNSSRVNEKPE-RSPSVLTVPGLTETAVFSC------------EAHNDKGLTVS  268

Query  204  KTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFE-LRYRAERS  262
            K         + P PP  + +  +      + V+W         +  L+   ++ +    
Sbjct  269  K--GVHINIKVIPSPPTEVHI--LNSTAHSILVSWVP---GFDGYSPLQNCSIQVKEADR  321

Query  263  KTFTTWMVKDLQHH---CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
             +  + MV +         I    +   + + +  + E G   WS  SP  + +    + 
Sbjct  322  LSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIG---WSAVSPWILASTTEGAP  378

Query  320  S  320
            S
Sbjct  379  S  379


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 52/355 (15%), Positives = 102/355 (29%), Gaps = 54/355 (15%)

Query  44   TLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCY----RA  99
             LTC  V P +   + WV         P R        +L    L ++  +SC     + 
Sbjct  210  NLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPS-----VLTVPGLTETAVFSCEAHNDKG  264

Query  100  GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTT-KAVLLVRKFQNSPA  158
               +  VH+ + V P  P       S   +++  W P            + V++      
Sbjct  265  LTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSN  324

Query  159  EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-  217
                        S              + Y +++   + +G                P  
Sbjct  325  GSVMV----FNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSV  380

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
             P NITV  +  +   L + W  P         + + + +  E + T+     +  Q   
Sbjct  381  APLNITV-FLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQ---  436

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQA--LT  335
                                   G W++   +      T   +   +  +    +   + 
Sbjct  437  ----------------------NGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNII  474

Query  336  TNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG---GSLAFGTLLCIAIVLR  387
              +         S  A      ++ S+    F++ G   G +  G +LCI++ LR
Sbjct  475  IPEHSKVDYAPSSTPAPG----NTDSM----FIILGCFCGFILIGLILCISLALR  521


> sp|Q00941|CSF2R_MOUSE Granulocyte-macrophage colony-stimulating 
factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Csf2ra 
PE=2 SV=2
Length=388

 Score = 51.7 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 69/210 (33%), Gaps = 12/210 (6%)

Query  118  QLSCFRKSPLSNV-VCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
             L+C  +   +    C W          +  L   +  NS   D         +     C
Sbjct  132  NLTCEIR--AARFLSCAWREGPAAPADVRYSL---RVLNSTGHDVARCMADPGDDVITQC  186

Query  177  QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
                     S   + +   S  G             + +  PP ++T +    N    +V
Sbjct  187  IANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASC---NSSHCTV  243

Query  237  TWQDPHSWNS-SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            +W  P +W S +    +FE+++++    +    ++   +             H V++RA 
Sbjct  244  SWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAG  303

Query  296  EEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
            +   +  W EWSP A      ++R P A  
Sbjct  304  DTRMK-HWGEWSP-AHPLEAEDTRVPGALL  331


> sp|B8VIW9|FP_ACRMI Fibronectin type III domain-containing protein 
OS=Acropora millepora OX=45264 PE=1 SV=1
Length=1280

 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 57/304 (19%), Positives = 100/304 (33%), Gaps = 25/304 (8%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             A G A    R         +  +  G  V L C  V  + +  +H+  ++  A    +R
Sbjct  521  TAEGTATVYDRTRIVRGPSDLSVNE-GTRVDLRCEAV-ADSSLELHYTWKRDDATIEYNR  578

Query  74   ---WAGMGRRLLLRSVQLHDSGNYSC--------YRAGRPAGTVHLLVDVPPEEPQLSCF  122
               W      L +  + + D+G Y+C        Y   + +  V++    P     L   
Sbjct  579  RVQWLKDQNVLTIADLTVEDAGIYTCVAYTPQPKYSEAKASAIVNI-AGAPFPPTNLMLS  637

Query  123  RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE  182
             +    N    W    + + +    L+ RK Q   A+DF +           S  L    
Sbjct  638  SECQNRNTTLSWVTGESNNASILYFLIERKSQ--YADDFWQVIANVTNPNATSHPLVKLA  695

Query  183  GDSSFYIVSMCVASSVG-SKFSKTQTFQGCGILQPDP---PANITVTAVARNPRWLSVTW  238
            G++      +   +  G S+ S+        I +  P   P N     V      L++ W
Sbjct  696  GNADLAF-RIRAVNRFGPSRPSEPTGSFCRTI-RAVPEKWPDNFR--GVPGKAEELTIAW  751

Query  239  QDPHSWNSSFYRLRFELRYRAERS-KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEE  297
                    +   L ++L YR   S         +      V+ DA    +   Q++A  E
Sbjct  752  TAMRRVEWNGPGLYYKLWYRRVNSGDALVEVRREASSDSFVVPDAGYYRQWEFQIQAINE  811

Query  298  FGQG  301
             G+G
Sbjct  812  VGEG  815


> sp|Q07409|CNTN3_MOUSE Contactin-3 OS=Mus musculus OX=10090 GN=Cntn3 
PE=1 SV=2
Length=1028

 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 41/284 (14%), Positives = 85/284 (30%), Gaps = 22/284 (8%)

Query  38   LPGDSVTLTCPGV-EPEDNATVHWVLRKPAA-----GSHPSRWAGMGR-RLLLRSVQLHD  90
              G+SV L C    +P  +    W            GSH  +  G     L++R++QL  
Sbjct  512  AVGESVILPCQVQHDPLLDIMFAWYFNGALTDFKKDGSHFEKVGGSSSGDLMIRNIQLKH  571

Query  91   SGNYSC--YRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKA  146
            SG Y C         +    L+V   P  P+     +   +     W   +         
Sbjct  572  SGKYVCMVQTGVDSVSSAAELIVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHSPVISY  631

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKT  205
             +  R   +   +  +       + +  +  +         Y   +  ++ +G    S  
Sbjct  632  AVQARTPFSVGWQSVR-TVPEVIDGKTHTATVVELNPWVE-YEFRIVASNKIGGGEPSLP  689

Query  206  QTFQGCGILQPD--PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
                      P+  P     V+    +   L +TW        +     + + +R     
Sbjct  690  SEKVRTEEAAPEIAPSE---VSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVT  746

Query  264  TFTTWMVK---DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            T+   +V    + ++            + V++      G+G +S
Sbjct  747  TWIQTVVTSPDNPRYVFRNESIVPFSPYEVKVGVYNNKGEGPFS  790


 Score = 48.3 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/156 (20%), Positives = 53/156 (34%), Gaps = 10/156 (6%)

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQD-P  241
              S Y V + V ++ G       T       +P   P++I+  ++  +   + V+W   P
Sbjct  770  PFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSL--SSSEIEVSWNTIP  827

Query  242  HSWNSSFYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
               ++    L +E+RY       ++     V   Q   V+    S L +   +RA    G
Sbjct  828  WKLSNGHL-LGYEVRYWNNGGEEESSRKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNSAG  886

Query  300  QGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
             G +S        T      S P  N V        
Sbjct  887  AGPFSA---TVNATTKKTPPSQPPGNVVWNATDTKV  919


> sp|Q62682|CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 
GN=Cntn3 PE=1 SV=1
Length=1028

 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 44/327 (13%), Positives = 99/327 (30%), Gaps = 23/327 (7%)

Query  38   LPGDSVTLTCPGV-EPEDNATVHWVLRKPAA-----GSHPSRWAGMGR-RLLLRSVQLHD  90
              G+S+ L C    +P  +    W            GSH  +  G     L++R++QL  
Sbjct  512  AVGESIILPCQVQHDPLLDIMFAWYFNGTLTDFKKDGSHFEKVGGSSSGDLMIRNIQLKH  571

Query  91   SGNYSC--YRA-GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKA  146
            SG Y C         +    L+V   P  P+     +   +     W   +         
Sbjct  572  SGKYVCMVQTGVDSVSSAAELIVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHSPVISY  631

Query  147  VLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKT  205
             +  R   +   ++ +   +      + +  + +       Y   +  ++ +G    S  
Sbjct  632  AVQARTPFSVGWQNVRTVPEAIDGKTRTATVVELNPWVE--YEFRVVASNKIGGGEPSLP  689

Query  206  QTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
                      P+   +  V+    +   L +TW        +     + + +R     T+
Sbjct  690  SEKVRTEEAAPEVAPS-EVSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVTTW  748

Query  266  TTWMVK---DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS-P  321
               +V    + ++            + V++      G+G +S   P        E  +  
Sbjct  749  IQTVVTSPDNPRYVFRNESIVPFSPYEVKVGVYNNKGEGPFS---PVTTVFSAEEEPTVA  805

Query  322  PAENEVSTPMQALTTNKDDDNILFRDS  348
            P+     +   +      +  I ++ S
Sbjct  806  PSHISAHSLSSSEIEVSWN-TIPWKSS  831


 Score = 49.0 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 54/155 (35%), Gaps = 8/155 (5%)

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPH  242
              S Y V + V ++ G       T       +P   P++I+  ++  +   + V+W    
Sbjct  770  PFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSL--SSSEIEVSWNTIP  827

Query  243  SWNSSFYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
              +S+   L +E+RY       ++ +   V   Q   V+    S L +   +RA    G 
Sbjct  828  WKSSNGRLLGYEVRYWNNGGEEESSSKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNTAGA  887

Query  301  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
            G +S        T      S P  N V        
Sbjct  888  GPFSA---TVNATTKKTPPSQPPGNVVWNATDTKV  919


> sp|Q9UMZ3|PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ 
OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
Length=2332

 Score = 52.5 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 93/319 (29%), Gaps = 31/319 (10%)

Query  15    APGAALAPRRCPAQEVARGVLTS-LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             AP   L    C +  V      S LPG  V +    +   +  T+++             
Sbjct  1286  APPQNLTLINCTSDFVWLKWSPSPLPGGIVKVYSFKIHEHETDTIYYKNISGFKTEAKLV  1345

Query  74    WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCE  133
                      +R       GN + +       T   + DV      + C   S  S +V  
Sbjct  1346  GLEPVSTYSIRVSAFTKVGNGNQFSNVVKFTTQESVPDVVQ---NMQCMATSWQSVLVKW  1402

Query  134   WGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMC  193
               P+    + T+ ++ V            E        Q           ++S Y+  + 
Sbjct  1403  DPPKKANGIITQYMVTV------------ERNSTKVSPQDHMYTFIKLLANTS-YVFKVR  1449

Query  194   VASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRF  253
              ++S G     T          P  P NI  + V       ++TW  P +    F   + 
Sbjct  1450  ASTSAGEGDESTCHVSTLPETVPSVPTNIAFSDVQSTSA--TLTWIRPDTILGYFQNYKI  1507

Query  254   ELRYRAERSKTFTTWMVKDLQ----------HHCVIHDAWSGLRHVVQLRAQEEFGQGEW  303
               + RA++ K + +    + Q              ++       +  Q+ A    G G  
Sbjct  1508  TTQLRAQKCKEWESEECVEYQKIQYLYEAHLTEETVYGLKKFRWYRFQVAASTNAGYGNA  1567

Query  304   SEWSPEAMGTPWTESRSPP  322
             S W   +  T       PP
Sbjct  1568  SNWI--STKTLPGPPDGPP  1584


 Score = 50.2 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/191 (14%), Positives = 56/191 (29%), Gaps = 14/191 (7%)

Query  111   DVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQE  170
             DVP   P ++ F+    ++V+  W P   P+              S     Q P +    
Sbjct  1190  DVPETSPIINTFKNLSSTSVLLSWDPPVKPN----------GAIISYDLTLQGPNENYSF  1239

Query  171   SQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
                 +  +       + Y       +  G   S    F     +   PP N+T+  +   
Sbjct  1240  ITSDNYIILEELSPFTLYSFFAAARTRKGLGPSSILFFYTDESVPLAPPQNLTL--INCT  1297

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV  290
               ++ + W    S         +  +     + T     +   +    +        + +
Sbjct  1298  SDFVWLKWSP--SPLPGGIVKVYSFKIHEHETDTIYYKNISGFKTEAKLVGLEPVSTYSI  1355

Query  291   QLRAQEEFGQG  301
             ++ A  + G G
Sbjct  1356  RVSAFTKVGNG  1366


 Score = 46.3 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/192 (14%), Positives = 64/192 (33%), Gaps = 21/192 (11%)

Query  114  PEEPQLSCFRKSPLSNVVCEWGPRSTP-SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            P   ++  ++    S+++  W P   P    T   +   +   + A        +   + 
Sbjct  611  PSSIKIINYKNISSSSILLYWDPPEYPNGKITHYTIYAMELDTNRA--------FQITTI  662

Query  173  KFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP---PANITVTAVAR  229
              S  +   +   + Y + +  ++ VG      +        + +P   P ++ V  V  
Sbjct  663  DNSFLITGLKKY-TKYKMRVAASTHVGESSLSEENDIFVRTSEDEPESSPQDVEVIDVTA  721

Query  230  NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
            +   L   W  P     +   + +E+ Y+       T +M        ++ +      + 
Sbjct  722  DEIRL--KWSPPE--KPNGIIIAYEVLYKNID----TLYMKNTSTTDIILRNLRPHTLYN  773

Query  290  VQLRAQEEFGQG  301
            + +R+   FG G
Sbjct  774  ISVRSYTRFGHG  785


 Score = 41.3 bits (95),  Expect = 0.021, Method: Composition-based stats.
 Identities = 22/205 (11%), Positives = 64/205 (31%), Gaps = 31/205 (15%)

Query  110  VDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVR------KFQNSPAEDFQE  163
            V + PE+P+          +    W          +  + +         ++    ++Q 
Sbjct  4    VPIKPEQPEKLRAFNISTHSFSLHWSL--PSGHVERYQVDLVPDSGFVTIRDLGGGEYQV  61

Query  164  PCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANIT  223
                     ++   ++      +  +  +   +                + +P PP  + 
Sbjct  62   DVSNVVPGTRYDITISSISTTYTSPVTRIVTTN----------------VTKPGPPVFLA  105

Query  224  VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYR---AERSKTFTTWMVKDLQHHCVIH  280
               V  +   L ++W  P   N +   + + ++Y+         +T    K      ++ 
Sbjct  106  GERV-GSAGIL-LSWNTPP--NPNGRIISYIVKYKEVCPWMQTVYTQVRSKPDSLEVLLT  161

Query  281  DAWSGLRHVVQLRAQEEFGQGEWSE  305
            +   G  + +++ A+   G G +S+
Sbjct  162  NLNPGTTYEIKVAAENSAGIGVFSD  186


> sp|A0A140LHF2|VSXL2_MOUSE V-set and immunoglobulin domain-containing 
protein 10-like 2 OS=Mus musculus OX=10090 GN=Vsig10l2 
PE=3 SV=2
Length=776

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 50/324 (15%), Positives = 104/324 (32%), Gaps = 40/324 (12%)

Query  5    GCALLAALLAAPG---AALAPRRCPAQEVARGVLTSLPGDS-VTLTCPGVEPEDNATVHW  60
             C      LA P      L               T+  GD  + L+C     E  A + W
Sbjct  393  SCTGQHPTLAMPIFCRVTLWEPPGS----PTCWTTATVGDQYIMLSCEWPGGEPPAMLSW  448

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSG-NYSC---YRAGRPAGTVHLLVDVPP--  114
            + R+ + G       G  + + L   Q   +G  ++C   +    P     L ++VP   
Sbjct  449  LDRQQSLGD-----LGSSQAVHLLQAQSDLAGREFTCQGSHPLTAPGSHCRLRLEVPQLT  503

Query  115  -EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQK  173
              EP++S   +   + + C     + P+   + + L  + Q                  +
Sbjct  504  VAEPRVS-VLEGEEAWLGCALQRGTPPA---QLLWLGPQQQQLEGSTPGFILHPEGTHLR  559

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ--------PDPPANITVT  225
               + A P      Y       +++G   S++   +     +        P PP N+T++
Sbjct  560  LQVRDADPAHHRGTY--QCVARNALG-NSSQSVLLEVLSECKGFVCPCGYPTPP-NVTIS  615

Query  226  AV--ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTW--MVKDLQHHCVIHD  281
             +   R  R + + W      N + + ++      +  +  +      ++       +  
Sbjct  616  RLTYRRQRREVQLQWAIYGPGNLTGFLVQQRASVPSSEAGAWEVAASDIEPESRDRRLGG  675

Query  282  AWSGLRHVVQLRAQEEFGQGEWSE  305
               G+ +  ++ A      G  SE
Sbjct  676  LDPGVLYAFRILAMNHHTAGYPSE  699


 Score = 42.1 bits (97),  Expect = 0.010, Method: Composition-based stats.
 Identities = 29/175 (17%), Positives = 52/175 (30%), Gaps = 29/175 (17%)

Query  41   DSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC----  96
            + VTL+C       N   H+V  +  +  H       G   ++ S     +G Y+C    
Sbjct  262  EEVTLSC---LAASNPPSHYVWFRDDSQIH------TGPTYIIASASRTHTGLYTCLAHN  312

Query  97   -YRAGRPAGTVHLLVDVPPE-EPQLSCFRKSPLSNVVCEWGPRST-------------PS  141
             +       TV L++  PPE +P  +      +  ++C W                  PS
Sbjct  313  RHLDTHTQTTVQLIIYYPPEGQPSCAVLPTLGVVTLLCTWPGGFPNAQLHWEGPQGIGPS  372

Query  142  LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
             +                 F    Q+   +    C++ + E   S          
Sbjct  373  ASGNVTWSYTTTGLPNGSIFSCTGQHPTLAMPIFCRVTLWEPPGS-PTCWTTATV  426


 Score = 36.3 bits (82),  Expect = 0.69, Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 41/126 (33%), Gaps = 7/126 (6%)

Query  1    MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW  60
            +L  G  +  A L      L P   P   V     + + G SV  TC   E  +  T  W
Sbjct  125  LLVSGGQVHTAYLYLMLTVLVPVSKPR--VQLNDPSPVEGVSVVATCAVREGTEPLTFSW  182

Query  61   VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRP----AGTVHLLVDVPPEE  116
                P  G           RL L  V     G Y+C  +       +    L V   P++
Sbjct  183  HHHMP-QGPGEVLVGLSEPRLQLDPVNRTHLGWYTCSVSNVVNQLKSDGAFLDVIYGPDK  241

Query  117  PQLSCF  122
            P ++  
Sbjct  242  PVITVE  247


> sp|Q9HC73|CRLF2_HUMAN Cytokine receptor-like factor 2 OS=Homo 
sapiens OX=9606 GN=CRLF2 PE=1 SV=1
Length=371

 Score = 51.7 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 62/211 (29%), Gaps = 41/211 (19%)

Query  128  SNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYS--QESQKFSCQLAVPEGDS  185
              V   W         T      R       ++  + C     QE     C L   + D 
Sbjct  40   ETVQVTWNASK--YSRTNLTFHYR----FNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDD  93

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTW-QDPHSW  244
              Y         V +       +     L+P  P              +  +W QD  + 
Sbjct  94   ILYFSIRNGTHPVFTASRWMVYY-----LKPSSPK------------HVRFSWHQDAVTV  136

Query  245  ---NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ------  295
               + S+  L +E++YR+     + +   ++   +  I    +   +   +R +      
Sbjct  137  TCSDLSYGDLLYEVQYRSPFDTEWQSK--QENTCNVTIEGLDAEKCYSFWVRVKAMEDVY  194

Query  296  -EEFGQGEWSE---WSPEAMGTPWTESRSPP  322
              +    +WSE   W    +     E+ +PP
Sbjct  195  GPDTYPSDWSEVTCWQRGEIRDACAETPTPP  225


> sp|Q5XKE0|MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus 
musculus OX=10090 GN=Mybpc2 PE=1 SV=1
Length=1136

 Score = 52.5 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 71/242 (29%), Gaps = 45/242 (19%)

Query  79   RRLLLRSVQLHDSGNYSCYRAGRPAGTV------HLLVDVPPEEPQLSCFRKSPLSNVVC  132
             +L++  V+  D G+Y+    G             + V+  P++       + P  ++ C
Sbjct  488  HKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQ-------EPPKIHLDC  540

Query  133  EWGPRS----------------TPSLTTKAVLLVRK---FQNSPAEDFQEPCQYSQESQK  173
                                             +R    F  +      E          
Sbjct  541  SGKTSDNSIVVVAGNKLRLDVAITGEPPPTATWLRGDEVFTATEGRTHIEQRPD---CSS  597

Query  174  FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
            F  + A    D   Y + +   + VG       +     +  PDPP  + VT+V     W
Sbjct  598  FVIESA-ERSDEGRYTIKVT--NPVG---EDVASIFLRVVDVPDPPEAVRVTSVGE--DW  649

Query  234  LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ-HHCVIHDAWSGLRHVVQL  292
              + W+ P  ++       + +  + + S+ +     +              G+ + +++
Sbjct  650  AILVWEPP-KYDGGQPVTGYLMERKKKGSQRWMKINFEVFTDTTYESTKMIEGVLYEMRV  708

Query  293  RA  294
             A
Sbjct  709  FA  710


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 15/105 (14%), Positives = 37/105 (35%), Gaps = 8/105 (8%)

Query  188   YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
             Y +S+ + +        T T +   + +  P  N+ V  V      +   WQ P    +S
Sbjct  905   YELSVQIENMK-----DTATIRIRVVEKAGPAENVMVKEVWGTNALVE--WQPPKDDGNS  957

Query  248   FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
                  + ++   +++  +      +    C + D   G  +  ++
Sbjct  958   EIT-GYFVQKADKKTMEWFNVYEHNRHTSCTVSDLIVGNEYYFRI  1001


> sp|Q07496|EPHA4_CHICK Ephrin type-A receptor 4 OS=Gallus gallus 
OX=9031 GN=EPHA4 PE=1 SV=2
Length=986

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 64/213 (30%), Gaps = 32/213 (15%)

Query  122  FRKSPLSNVVCEWGPRSTPSL-----TTKAVLLVRKFQNSPAEDFQEP---CQYSQESQK  173
              ++  +++ C   P +  +L      T   L     QN    D       C+     + 
Sbjct  315  RAENDAASMPCTRPPSAPQNLISNVNETSVNLEWSAPQNKGGRDDISYNVVCKRCGAGEP  374

Query  174  FSCQLAVPEGDSSF--------------------YIVSMCVASSVGS-KFSKTQTFQGCG  212
              C+        S                     Y   +   + V     S+ Q      
Sbjct  375  SHCRSCGSGVHFSPQQNGLKTTKVSITDLLAHTNYTFEVWAVNGVSKHNPSQDQAVSVTV  434

Query  213  ILQPDPPANITVTAVARNPRW-LSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
                  P+ I +       R  +++ W +P     +   L +E++Y  +     +  +VK
Sbjct  435  TTNQAAPSPIALIQAKEITRHSVALAWLEPD--RPNGVILEYEVKYYEKDQNERSYRIVK  492

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
                +  I        +V  +RA+   G G++S
Sbjct  493  TASRNTDIKGLNPLTSYVFHVRARTAAGYGDFS  525


> sp|Q6DFV6|FN3C1_MOUSE Fibronectin type III domain containing 
protein 3C1 OS=Mus musculus OX=10090 GN=Fndc3c1 PE=2 SV=1
Length=1356

 Score = 52.5 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 51/347 (15%), Positives = 91/347 (26%), Gaps = 56/347 (16%)

Query  36    TSLPGDSVTLTCPGVE-----PE----DNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSV  86
              S  G  V LTC G        E    + A +     +             G  L     
Sbjct  915   PSQCGTPV-LTCKGPTCVIVSWEIPKCNGAEIIDYRLQWGQVEDSMHLIYTGPCLRYEVK  973

Query  87    QLHDSGNYSCYRAGRPAGTVHLLVD---------VPPEEPQLS-CFRKSPLS-NVVC---  132
              L  +  Y C         V +            VP   P L     K P   +  C   
Sbjct  974   GLVPATTYFCRVQAVNIVGVGMFGGTAKVTTPGTVPAMVPVLKEVESKVPAKLSSTCIAI  1033

Query  133   -EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS  191
                 P    S  T   +     +                 ++ +  +      ++ Y + 
Sbjct  1034  RWEEPDCHGSPITGYNIEYGDKKV-------------VTVKRITEYVLKDLQPNTTYRIR  1080

Query  192   MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL  251
             +   +  G               +P PP    +  V    + L + W    S  +    L
Sbjct  1081  IQAINHYGLSPFSPS---IRCKTKPLPPEPPQLNCVVYGHQSLRLKWGTVSSKKT----L  1133

Query  252   RFELRYRA--ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
                + Y    E      + + +       +        +  +++A  E G+G      PE
Sbjct  1134  ANFINYNVLMEDRSGRFSVIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEG------PE  1187

Query  310   AMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPV  356
             +    +T ++SPP    +  P      N +   I +         P+
Sbjct  1188  SDIYTFTTTKSPP--TALKAPKVHPL-NNNSCEIKWESLEPIKGDPI  1231


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 70/191 (37%), Gaps = 11/191 (6%)

Query  115  EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
            E+P +S  +          W  +S       + +      +S  ++      Y       
Sbjct  456  EKPVVSNIQTRSA---TVSWTRKSNEKYDINSSMTHELALSSNGKNGTYKNIY--TGNGV  510

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWL  234
            +  L   +    +++    + ++     S+  +F   G  +PDPP   T+ +  +N   L
Sbjct  511  TVVLHDLQPCMVYFLRVTTIRNAEHRSVSEVVSFTTPG-CEPDPPLAPTLISRTKNS--L  567

Query  235  SVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRA  294
            S+ W+   S ++      F L +   + + F +     L+    +       ++  +L A
Sbjct  568  SLQWK--ASNDNGSKISSFLLEWDEGKGEDFKSCYSGRLK-QHKLFKLNPSTKYSFRLAA  624

Query  295  QEEFGQGEWSE  305
            + +FG   +SE
Sbjct  625  KNDFGCSNFSE  635


> sp|O08644|EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus 
OX=10090 GN=Ephb6 PE=2 SV=4
Length=1014

 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 59/338 (17%), Positives = 94/338 (28%), Gaps = 57/338 (17%)

Query  4    VGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLR  63
               A  A+L+AA G  +A           GV     G    L C G          W++ 
Sbjct  242  ASGAGGASLVAAVGTCVAHAEPE----EDGVGGQAGGSPPRLHCNGEG-------RWMVA  290

Query  64   KPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVP-PEEPQLSC-  121
                   P      G +L     +    G+Y       P          P P  P   C 
Sbjct  291  VGGCRCQPGHQPARGDKLCQACPE----GSYKALAGNVPCSPCPARSHSPDPAAPVCPCL  346

Query  122  ----FRKSPLSNVVCEWGPRSTPSL-----TTKAVLLVRKFQNSPAED---FQEPCQYSQ  169
                   S      C   P +   L      +  +L  R  Q         F   C+   
Sbjct  347  QGFYRASSDPPEAPCTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECG  406

Query  170  ESQKFS----CQLAVPEGDSSFYIVSMCVAS-------SVGSKFSKTQTFQGCGILQPDP  218
               + S    C+    E         +  +        +      + Q   G   L PDP
Sbjct  407  GHGEPSSGGMCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDP  466

Query  219  PAN--ITVTAVARNPRWL-------------SVTWQDPHSWNSSFYRLRFELRYRAERSK  263
            P    I V+     P  +             +V+W  P    ++   L ++LRY  +   
Sbjct  467  PQAAAINVSTSHEVPSAVPVMHQVSRAANSITVSWPQPEQ--TNGNILDYQLRYYDQAED  524

Query  264  TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
               ++ +    +   +     G  +  Q+RA+   G G
Sbjct  525  ESHSFTMTSETNTATVTRLSPGHIYGFQVRARTAAGHG  562


> sp|Q91735|EPHB3_XENLA Ephrin type-B receptor 3 OS=Xenopus laevis 
OX=8355 GN=ephb3 PE=2 SV=1
Length=974

 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 76/249 (31%), Gaps = 17/249 (7%)

Query  86   VQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEW-GPRSTPS---  141
            +    +G Y     G  A T    V   P +           ++VV EW  P        
Sbjct  296  ICSCQNGYY--RADGESAETACTSVPSAPRQ----VISNVNETSVVLEWAEPGHLGGRDD  349

Query  142  -LTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS  200
             L         +   S  +D  +         +    ++  +  + +      V    G 
Sbjct  350  VLYNVICKKCLERLCSRCDDNVQFWPRQLGVTQRLVSVSHLQAHTKYSFEIQAVNGVSGK  409

Query  201  KFSKTQTFQGCGILQPDPPANITVTAVARN-PRWLSVTWQDPHSWNSSFYRLRFELRYRA  259
                   F          P+++ +     +    L+++W  P S   +   L +E++Y A
Sbjct  410  SPHIPNYFTVNITTNQAAPSSVPMVQSHGSLANSLTLSWAPPES--PNGIILDYEIKYYA  467

Query  260  ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
            +         V   +    +        +VVQ+RA+   G G +SE  P    T   +  
Sbjct  468  KGH-IGAGNTVTSQRTTVRMEGMTPDTVYVVQVRARTVAGYGAYSE--PREFQTIAEDGD  524

Query  320  SPPAENEVS  328
                + +V 
Sbjct  525  RSSLQEQVP  533


> sp|Q91845|EPA4A_XENLA Ephrin type-A receptor 4-A OS=Xenopus laevis 
OX=8355 GN=epha4-a PE=2 SV=1
Length=986

 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/204 (17%), Positives = 57/204 (28%), Gaps = 19/204 (9%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
            PP  PQ         ++V  EW P             +   +         PC       
Sbjct  328  PPSAPQNL-ISNVNETSVNLEWSPPQNSGGRPDVSYNLVCKRCGSDLTRCRPCGSGVHYS  386

Query  173  K------------FSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPA  220
                            Q         + I  +   +  G   + + T       Q  P  
Sbjct  387  PQQNGLKTTKVSITDLQAHTNYTFEVWSINGVSKQNP-GQDQAVSVTVTTN---QAAPST  442

Query  221  NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH  280
               +         +S+TW +P     +   L +E++Y  +     T  +VK       I 
Sbjct  443  VTQIQPKDITRHSVSLTWPEPE--RPNGVILEYEVKYYEKDQNERTYRIVKTTSRSADIK  500

Query  281  DAWSGLRHVVQLRAQEEFGQGEWS  304
                   +V  +RA+   G GE+S
Sbjct  501  GLNPLTAYVFHVRARTAAGYGEFS  524


> sp|O70394|I27RA_MOUSE Interleukin-27 receptor subunit alpha OS=Mus 
musculus OX=10090 GN=Il27ra PE=2 SV=2
Length=623

 Score = 51.7 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 70/206 (34%), Gaps = 16/206 (8%)

Query  119  LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
            L C+   PL  + C W P     L T  VL  +  +  P   ++      Q        +
Sbjct  34   LQCYSVGPLGILNCSWEP--LGDLETPPVLYHQSQKYHPNRVWEVKVPSKQS------WV  85

Query  179  AVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANI-TVTAVARNPRWLSVT  237
             +P    +     +   +  G     + +      ++PD P     V          +V 
Sbjct  86   TIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQMKPDTPQIFSQVDISEEATLEATVQ  145

Query  238  WQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV---KDLQHHCVIHDAWSGLRHVVQLRA  294
            W  P  W      L  + RY+  +++T+T        D      + +   G  + V  R 
Sbjct  146  WAPP-VWPPQK-VLICQFRYKECQAETWTRLEPQLKTDGLTPVEMQNLEPGTCYQVSGRC  203

Query  295  QEEFGQGEWSEW-SPEAMGTPWTESR  319
            Q E G   W EW SP +  TP+ +  
Sbjct  204  QVENGY-PWGEWSSPLSFQTPFLDPE  228


> sp|P16419|MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus 
gallus OX=9031 GN=MYBPC2 PE=1 SV=3
Length=1132

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 48/308 (16%), Positives = 94/308 (31%), Gaps = 54/308 (18%)

Query  19   ALAPRRCPAQEVARGV--LTSLPGDSVTLTCPGVEPEDNATVHWVLR----KPAAGSHPS  72
            A         EV + +  LT    +     C     ++  T  W       KP+   H S
Sbjct  422  AELSVEEKQLEVLQDMADLTVKASEQAVFKCEVS--DEKVTGRWFRNGVEVKPSKRIHIS  479

Query  73   RWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTV------HLLVDVPPEEPQLSCFRKSP  126
               G   +L++  V+  D G+Y+    G             + V+  P++       + P
Sbjct  480  H-NGRFHKLVIDDVRPEDEGDYTFIPDGYALSLSAKLNFLEIKVEYVPKQ-------EPP  531

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYS--------QESQKFSCQL  178
              ++ C              V++             EP              + +    +
Sbjct  532  KIHLDCSGKAAENT-----IVVVAGNKVRLDVPISGEPAPTVTWKRGDQLFTATEGRVHI  586

Query  179  AVPEGDSSFYIVS----------MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA  228
                  SSF I S          + V + VG     + T     +  PDPP ++ VT+V 
Sbjct  587  DSQADLSSFVIESAERSDEGRYCITVTNPVG---EDSATLHVRVVDVPDPPQSVRVTSVG  643

Query  229  RNPRWLSVTWQDPHSWNSSFYRLR-FELRYRAERSKTFTTWMVKD-LQHHCVIHDAWSGL  286
                W  ++W+ P         +  + +  + + S  +     +              G+
Sbjct  644  E--DWAVLSWEAPP--FDGGMPITGYLMERKKKGSMRWMKLNFEVFPDTTYESTKMIEGV  699

Query  287  RHVVQLRA  294
             + +++ A
Sbjct  700  FYEMRVFA  707


 Score = 38.6 bits (88),  Expect = 0.14, Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 37/115 (32%), Gaps = 11/115 (10%)

Query  186  SFYIVSMCVASSVGSKF--------SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVT  237
            S + +        G+              T +   + +P PP  + V  V  +   L   
Sbjct  886  SVFFIRSAARPLSGNYEMRVRIDNMEDCATLRLRVVERPGPPQAVRVMEVWGSNALL--Q  943

Query  238  WQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
            W+ P    ++     + ++    R+  + T +       C + +   G  +  ++
Sbjct  944  WEPPKDDGNAEIS-GYTVQKADTRTMEWFTVLEHSRPTRCTVSELVMGNEYRFRV  997


> sp|Q64612|PTPRV_RAT Receptor-type tyrosine-protein phosphatase 
V OS=Rattus norvegicus OX=10116 GN=Ptprv PE=1 SV=1
Length=1711

 Score = 52.1 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 65/365 (18%), Positives = 108/365 (30%), Gaps = 48/365 (13%)

Query  7    ALLAALLAAPGAALAPRRCPAQEVARGVLT-SLPGDSVTLTCPGVEP-EDNATVHWVLRK  64
             L   +LA P  A               L   +PG  + L   G+E  +       +   
Sbjct  368  TLQLKVLAGPYDAWVEGS--TWLAESAALPREVPGARLWL--DGLEASKQPGRRALLYSD  423

Query  65   PAAGSHPSRWAGMGRRLLLRSVQLHDSGN---YSCYRAGRPAGTVHLLVDVPPEEPQLSC  121
             A GS  +     G   ++    +  +      +                +PP+   L  
Sbjct  424  DAPGSLGNISVPSGATHVIFCGLVPGAHYRVDIASSTGDISQSISGYTSPLPPQ--SLEV  481

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA-V  180
              +S  S++   WGP            L         +  Q       +    +  L   
Sbjct  482  ISRSSPSDLTIAWGPAPGQ--------LEGYKVTWHQDGSQRSPGDLVDLGPDTLSLTLK  533

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
                 S Y  ++   +  G+  S +Q    C   +P PP N+++    + P  L  +W  
Sbjct  534  SLVPGSCY--TVSAWAWAGNLDSDSQKIHSCT--RPAPPTNLSLGFAHQ-PAALKASWYH  588

Query  241  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH-CVIHDAWSGLRHVVQLRAQEEFG  299
            P     +     F LR    R  T  +  V   +          +G    VQL       
Sbjct  589  PPGGRDA-----FHLRLYRLRPLTLESEKVLPREAQNFSWAQLTAGCEFQVQLST-----  638

Query  300  QGEW-SEWSPEAMGTPWTESRSP---------PAENEVSTPMQALTTNKDDDNILFRDSA  349
               W SE S  A  T WT   +P         P + +VS        ++    +    + 
Sbjct  639  --LWGSERSSSANATGWTPPSAPTLVNVTSDAPTQLQVSWAHVPGGRSRYQVTLYQESTR  696

Query  350  NATSL  354
             ATS+
Sbjct  697  TATSI  701


> sp|Q14324|MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo 
sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
Length=1141

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 77/239 (32%), Gaps = 39/239 (16%)

Query  79   RRLLLRSVQLHDSGNYSCYRAGRPAGTV------HLLVDVPPEEPQLSCFRKSPLSNVVC  132
             +L++  V+  D G+Y+    G             + V+  P++       + P  ++ C
Sbjct  493  HKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQ-------EPPKIHLDC  545

Query  133  EWGPR----------------STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSC  176
                                 S           ++  +     + +   +   +   F  
Sbjct  546  SGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVI  605

Query  177  QLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
            + A  E +  +   ++ V + VG       +     +  PDPP  + +T+V     W  +
Sbjct  606  ESAQREDEGRY---TIKVTNPVG---EDVASIFLQVVDVPDPPEAVRITSVGE--DWAIL  657

Query  237  TWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD-LQHHCVIHDAWSGLRHVVQLRA  294
             W+ P  ++       + +  + + S+ +     +   +          G+ + +++ A
Sbjct  658  VWEPP-MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA  715


 Score = 46.3 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 15/105 (14%), Positives = 40/105 (38%), Gaps = 8/105 (8%)

Query  188   YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSS  247
             Y +S+ + +        T T +   + +  PP N+ V  V      +   WQ P   + +
Sbjct  910   YELSVQIENMK-----DTATIRIRVVEKAGPPINVMVKEVWGTNALVE--WQAPKD-DGN  961

Query  248   FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
                + + ++   +++  +     ++    C + D   G  +  ++
Sbjct  962   SEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV  1006


> sp|P54761|EPHB4_MOUSE Ephrin type-B receptor 4 OS=Mus musculus 
OX=10090 GN=Ephb4 PE=1 SV=2
Length=987

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 51/118 (43%), Gaps = 7/118 (6%)

Query  188  YIVSMCVASSVGSKFSKTQTFQGCGILQPD---PPANITVTAVARNPRWLSVTWQDPHSW  244
            Y   +   + V +  +    F+    +  D   PPA   +     +P  L ++W  P + 
Sbjct  402  YTFEVAALNGVSTLATGPPPFEPVN-VTTDREVPPAVSDIRVTRSSPSSLILSWAIPRA-  459

Query  245  NSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
              S   L +E++Y  + ++  ++   +K  ++   +     G  ++VQ+RA+ E G G
Sbjct  460  -PSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYG  516


> sp|Q28106|CNTN1_BOVIN Contactin-1 OS=Bos taurus OX=9913 GN=CNTN1 
PE=2 SV=1
Length=1018

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 48/303 (16%), Positives = 96/303 (32%), Gaps = 22/303 (7%)

Query  40   GDSVTLTCPGV-EPEDNATVHWVLRK-----PAAGSHPSR--WAGMGRRLLLRSVQLHDS  91
            G++ T+ C    +P  + T  W              H  R         LL+R+ QL  +
Sbjct  519  GENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHA  578

Query  92   GNYSCYRA---GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLT-TKAV  147
            G Y+C         + +  L+V  PP  P          ++V   W   S      +K  
Sbjct  579  GRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYT  638

Query  148  LLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKF-SKTQ  206
            +  +   +   +D +      + + + +  + +       Y   +   +++G    S   
Sbjct  639  IQTKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWME--YEFRVVATNTLGIGEPSIPS  696

Query  207  TFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTF  265
                     P+  P++  V     + R L++TW         F    + + ++    + +
Sbjct  697  NKIKTDGAAPNVAPSD--VGGGGGSNRELTITWAPLSREYHYFNNFGYIVAFKPFDGEEW  754

Query  266  TTWMVK-DLQHHCVIHD--AWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                V        V  D          V+++A    G G +S  +          S +P 
Sbjct  755  KKVTVTNPDTGRYVHKDETMRPSTAFQVKVKAFNNKGDGPYSLTAV-IHSAQDAPSEAPT  813

Query  323  AEN  325
            A  
Sbjct  814  AVG  816


> sp|P02751|FINC_HUMAN Fibronectin OS=Homo sapiens OX=9606 GN=FN1 
PE=1 SV=5
Length=2477

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 42/250 (17%), Positives = 85/250 (34%), Gaps = 38/250 (15%)

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DS  185
             S+ V  W   S     T +   V    +   ++         +    +  + +P+    
Sbjct  733  ASSFVVSWVSASD----TVSGFRVEYELSEEGDE-----PQYLDLPSTATSVNIPDLLPG  783

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              YIV++   S  G +     T Q      PD P + TV  V      + V W  P +  
Sbjct  784  RKYIVNVYQISEDGEQSLILSTSQTTA---PDAPPDTTVDQVDDTS--IVVRWSRPQAPI  838

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            +      + + Y      + T   + +  +   + D   G+++ + + A EE  +     
Sbjct  839  TG-----YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVV  893

Query  306  WSPEAMGTPWTESRSPPAENE-----------VSTPMQALTTNKDDDNILFRDSANATSL  354
               E  GTP +++   P + +           + TP ++  T        +R      +L
Sbjct  894  IQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTG-------YRVDVIPVNL  946

Query  355  PVQDSSSVPL  364
            P +    +P+
Sbjct  947  PGEHGQRLPI  956


 Score = 49.0 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 67/193 (35%), Gaps = 20/193 (10%)

Query  105   TVHLLVDVPPEEPQLS--CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQ  162
             +V +   + PE PQL+   F     S++   W P         + ++  +     A +  
Sbjct  1256  SVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTP------LNSSTIIGYRITVVAAGEGI  1309

Query  163   EPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANI  222
                +   +S      +   E    + I  + + +      S   T      +   PP ++
Sbjct  1310  PIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGG---ESAPTTLTQQTAVP--PPTDL  1364

Query  223   TVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA-ERSKTFTTWMVKDLQHHCVIHD  281
               T +   P  + VTW  P S + + +     +RY   +  +      +    +  V+ +
Sbjct  1365  RFTNIG--PDTMRVTWAPPPSIDLTNFL----VRYSPVKNEEDVAELSISPSDNAVVLTN  1418

Query  282   AWSGLRHVVQLRA  294
                G  +VV + +
Sbjct  1419  LLPGTEYVVSVSS  1431


 Score = 40.6 bits (93),  Expect = 0.036, Method: Composition-based stats.
 Identities = 19/122 (16%), Positives = 41/122 (34%), Gaps = 13/122 (11%)

Query  181   PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
             P  D   Y+ ++       +  S          +  D P+N+    +A  P  L V+WQ 
Sbjct  1966  PGTDYKIYLYTLND-----NARSSPVVIDASTAI--DAPSNLR--FLATTPNSLLVSWQP  2016

Query  241   PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ  300
             P +  + +  +++E   +            +       I     G  + + + A +   +
Sbjct  2017  PRARITGYI-IKYE---KPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQK  2072

Query  301   GE  302
              E
Sbjct  2073  SE  2074


 Score = 38.6 bits (88),  Expect = 0.15, Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 5/83 (6%)

Query  219  PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS-KTFTTWMVKDLQHHC  277
            P  + +T     P    + W  P     S    ++ LR+R + S   +    +    +  
Sbjct  611  PVEVFITETPSQPNSHPIQWNAP---QPSHIS-KYILRWRPKNSVGRWKEATIPGHLNSY  666

Query  278  VIHDAWSGLRHVVQLRAQEEFGQ  300
             I     G+ +  QL + +++G 
Sbjct  667  TIKGLKPGVVYEGQLISIQQYGH  689


 Score = 36.7 bits (83),  Expect = 0.63, Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 59/197 (30%), Gaps = 21/197 (11%)

Query  99    AGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPA  158
                   T+     VPP  P    F       +   W P  +  LT     LVR       
Sbjct  1345  GESAPTTLTQQTAVPP--PTDLRFTNIGPDTMRVTWAPPPSIDLTN---FLVRYSPVKNE  1399

Query  159   EDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP  218
             ED  E    S      +  L       + Y+VS+          S      G      D 
Sbjct  1400  EDVAE---LSISPSDNAVVLT-NLLPGTEYVVSVSSVYE--QHESTPLR--GRQKTGLDS  1451

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAER-SKTFTTWMVKDLQHHC  277
             P  I  + +  N    +V W  P +  +      + +R+  E  S       V   ++  
Sbjct  1452  PTGIDFSDITANS--FTVHWIAPRATITG-----YRIRHHPEHFSGRPREDRVPHSRNSI  1504

Query  278   VIHDAWSGLRHVVQLRA  294
              + +   G  +VV + A
Sbjct  1505  TLTNLTPGTEYVVSIVA  1521


 Score = 36.3 bits (82),  Expect = 0.67, Method: Composition-based stats.
 Identities = 19/145 (13%), Positives = 40/145 (28%), Gaps = 13/145 (9%)

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK-TFTTWMVKDLQHHC  277
             P ++  T V      LS  W  P+   +      + +R   +          +       
Sbjct  1816  PTDLKFTQVTPTS--LSAQWTPPNVQLTG-----YRVRVTPKEKTGPMKEINLAPDSSSV  1868

Query  278   VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
             V+       ++ V + A ++          P        E+ SPP    V+   +   T 
Sbjct  1869  VVSGLMVATKYEVSVYALKDTLTSR-----PAQGVVTTLENVSPPRRARVTDATETTITI  1923

Query  338   KDDDNILFRDSANATSLPVQDSSSV  362
                            ++P    + +
Sbjct  1924  SWRTKTETITGFQVDAVPANGQTPI  1948


> sp|P21709|EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens 
OX=9606 GN=EPHA1 PE=1 SV=4
Length=976

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 46/285 (16%), Positives = 83/285 (29%), Gaps = 32/285 (11%)

Query  31   ARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHD  90
              G      G++    CP      +      L  P   +  S  A          +   +
Sbjct  265  EPGYEEGGSGEACVA-CPSGSYRMDMDTPHCLTCPQQSTAESEGAT---------ICTCE  314

Query  91   SGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV  150
            SG+Y     G            PP  P+   F  S    +   W P +           V
Sbjct  315  SGHYRAPGEGPQVACTG-----PPSAPRNLSFSASGTQ-LSLRWEPPADTGGRQDVRYSV  368

Query  151  RKFQNSPAEDFQEPCQYS---QESQKFSCQLAVPE----GDSSF--YIVSMCVAS--SVG  199
            R  Q         PCQ           +  L  P     G   +  Y  ++   +  S  
Sbjct  369  RCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGL  428

Query  200  SKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA  259
                   T     +   +  + +++  V + PR L +TW      +     L +EL    
Sbjct  429  GSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGAN-LTYELHVLN  487

Query  260  ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            +  + +       L+   ++ +      ++V++R     G G +S
Sbjct  488  QDEERYQMV----LEPRVLLTELQPDTTYIVRVRMLTPLGPGPFS  528


> sp|Q53EP0|FND3B_HUMAN Fibronectin type III domain-containing 
protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B PE=1 SV=2
Length=1204

 Score = 51.7 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 53/355 (15%), Positives = 103/355 (29%), Gaps = 29/355 (8%)

Query  98   RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP  157
             +G     V   +   P+ P      ++ ++ V  +W  +       + +    + Q   
Sbjct  459  TSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWS-KPEGCSPEEVITYTLEIQEDE  517

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             ++   P       +  +C +      S+ Y   +  +++ G               +P 
Sbjct  518  NDNLFHP---KYTGEDLTCTV-KNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPDRPG  573

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK--DLQH  275
            PP    V          SV W  P   N     L++ L    + +     W V       
Sbjct  574  PPTRPLVKG-PVTSHGFSVKWDPPKD-NGGSEILKYLLEI-TDGNSEANQWEVAYSGSAT  630

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALT  335
                     G  + ++       G  + SE S           +  P    +  P     
Sbjct  631  EYTFTHLKPGTLYKLRACCISTGGHSQCSE-SLPVRTLSIAPGQCRPPR-VLGRPKHKEV  688

Query  336  TNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLR  395
              + D           +   V+ +    + + +  G  L         ++      +++R
Sbjct  689  HLEWDVPA-SESGCEVSEYSVEMTEPEDVASEVYHGPELE---CTVGNLLPGTVYRFRVR  744

Query  396  ALKEGKTSMHPPYS-LGQLVPERPRPTPVLVPLIS--PPV-------SPSSLGSD  440
            AL +G      PYS + ++      P     P IS  P         SP S G+D
Sbjct  745  ALNDGGYG---PYSDVSEITTAAGPPGQCKAPCISCTPDGCVLVGWESPDSSGAD  796


 Score = 37.9 bits (86),  Expect = 0.25, Method: Composition-based stats.
 Identities = 14/95 (15%), Positives = 30/95 (32%), Gaps = 7/95 (7%)

Query  232  RWLSVTWQDPHSWNSS-----FYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGL  286
            R + ++W  P   +        +   +E+    +        +    +  C + D     
Sbjct  290  RAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPAT  349

Query  287  RHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSP  321
             + V++ A     +G  SE  P +  T       P
Sbjct  350  DYHVRVYAMYNSVKGSCSE--PVSFTTHSCAPECP  382


 Score = 37.5 bits (85),  Expect = 0.32, Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 52/155 (34%), Gaps = 10/155 (6%)

Query  168   SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAV  227
             S      +  +       + Y + +   + +G+      +       +P PP    +   
Sbjct  911   SITVGNTTMHVMKDLLPETTYRIRIQAINEIGAG---PFSQFIKAKTRPLPPLPPRLECA  967

Query  228   ARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLR  287
             A  P+ L + W D +S   +   + + L+      + F +       H   +        
Sbjct  968   AAGPQSLKLKWGDSNSKTHAAEDIVYTLQLEDRNKR-FISIYRGP-SHTYKVQRLTEFTC  1025

Query  288   HVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
             +  +++A  E G+G +SE       T  T    PP
Sbjct  1026  YSFRIQAASEAGEGPFSE-----TYTFSTTKSVPP  1055


 Score = 36.3 bits (82),  Expect = 0.78, Method: Composition-based stats.
 Identities = 46/315 (15%), Positives = 89/315 (28%), Gaps = 54/315 (17%)

Query  24   RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA-----GMG  78
             CP++ +        PG        G       +V W   K   GS   ++      G  
Sbjct  557  SCPSEVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNGGSEILKYLLEITDGNS  616

Query  79   RRLLLRSVQLHDSGNYS---------------C-YRAGRPAGTVHL---LVDVPPEE---  116
                        +  Y+               C    G    +  L    + + P +   
Sbjct  617  EANQWEVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSESLPVRTLSIAPGQCRP  676

Query  117  PQLSCFRKSPLSNVVCEWG-PRSTPSLT-TKAVLLVRKFQNSPAEDFQEPCQYSQESQKF  174
            P++    +     V  EW  P S      ++  + + + ++  +E +  P        + 
Sbjct  677  PRV--LGRPKHKEVHLEWDVPASESGCEVSEYSVEMTEPEDVASEVYHGP--------EL  726

Query  175  SCQLAVPEGDSSFYIVSMCVASSVGSK-FSKTQTFQGCGILQPDPPANITVTAVARNPRW  233
             C +       + Y   +   +  G   +S              PP       ++  P  
Sbjct  727  ECTVG-NLLPGTVYRFRVRALNDGGYGPYSDVSEITTAA----GPPGQCKAPCISCTPDG  781

Query  234  LS-VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMV--KDLQHHCVIHDAWSGLRHVV  290
               V W+ P S  +          YR E  +   +  +          I D     ++  
Sbjct  782  CVLVGWESPDSSGADIS------EYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCC  835

Query  291  QLRAQEEFGQGEWSE  305
            +L+A  + G G +SE
Sbjct  836  RLQAFNQAGAGPYSE  850


> sp|Q05546|TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr 
PE=1 SV=1
Length=1356

 Score = 51.3 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/117 (19%), Positives = 46/117 (39%), Gaps = 19/117 (16%)

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
            + YIV++      G+  S+         +  DPP NIT++ V ++   L+V+W  P +  
Sbjct  837  TEYIVNLVAVH--GTVTSEPIVGSITTGI--DPPKNITISNVTKDS--LTVSWSPPVAPF  890

Query  246  SSFYRLRFELRYRAERSKT--FTTWMVKDLQHHCVIHDAWSGLRHVV---QLRAQEE  297
              +        Y      +    + +V +      I   +   ++ +    +R +EE
Sbjct  891  DYY-------EY-PIDHPSGRLDSSVVPNTVTEFTITRLYPASQYEISLNSVRGREE  939


 Score = 46.0 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 61/192 (32%), Gaps = 28/192 (15%)

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSM  192
            EW P        K   ++ K+     E  +   +      ++S Q   P    S Y VS+
Sbjct  522  EWTPPRA-----KVDFILLKYGLVGGEGGKTTFRLQPPLSQYSVQALRP---GSRYEVSI  573

Query  193  CVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLR  252
                  G+  S   + Q    +  D P N+ V +       L + W +  +         
Sbjct  574  SAV--RGTNESDASSTQFTTEI--DAPKNLRVGSRTATS--LDLEWDNSEAEAQE-----  622

Query  253  FELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE  309
            +++ Y     + +   +V           + D   G  + V + A         S+ S  
Sbjct  623  YKVVYSTLAGEQYHEVLVPKGIGPTTKTTLTDLVPGTEYGVGISAVMN------SKQSIP  676

Query  310  AMGTPWTESRSP  321
            A     TE  SP
Sbjct  677  ATMNARTELDSP  688


> sp|P12371|FCERA_RAT High affinity immunoglobulin epsilon receptor 
subunit alpha OS=Rattus norvegicus OX=10116 GN=Fcer1a PE=1 
SV=1
Length=245

 Score = 50.2 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/96 (24%), Positives = 35/96 (36%), Gaps = 7/96 (7%)

Query  9    LAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAG  68
            LA +L + G  L   +     +    +  L GD VTL C G       +  W+     + 
Sbjct  11   LALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISN  70

Query  69   SHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG  104
               S W       ++ S  + DSG Y C + G    
Sbjct  71   VKSSHW-------VIVSATIQDSGKYICQKQGFYKS  99


> sp|Q91145|COCA1_NOTVI Collagen alpha-1(XII) chain (Fragment) 
OS=Notophthalmus viridescens OX=8316 PE=2 SV=1
Length=929

 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/186 (14%), Positives = 53/186 (28%), Gaps = 20/186 (11%)

Query  116  EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFS  175
             P+   F +   S+    W P +  ++      LV        E+F             +
Sbjct  67   PPRDLSFAEVTSSSFRVSWSPAAEDAI----AYLVNYTVALGGEEFVVSVP-----APTT  117

Query  176  CQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLS  235
              +       + Y V +      G   S     +   +     P N+ VT          
Sbjct  118  STVLTNLFPKTTYEVRVVAEYPEG--ESPPLKGEETTLEVRGAPRNLRVT--DETTDSFK  173

Query  236  VTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            V W       +    LR+ + YR           V+  +    +++ +   ++   +   
Sbjct  174  VGWTP-----APGNVLRYRIAYRPVAGGERKEVTVQGNERATTLYNLFPDTKY--HVSGV  226

Query  296  EEFGQG  301
             E+  G
Sbjct  227  PEYQSG  232


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 26/76 (34%), Gaps = 7/76 (9%)

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            +PP+N+  +     PR   VTW  P          RF++ Y            V+  Q  
Sbjct  820  NPPSNLVTS--EPTPRSFRVTWVPPSQSVE-----RFKVEYYPVAGGRPQEVYVRGTQTT  872

Query  277  CVIHDAWSGLRHVVQL  292
             V+        + V +
Sbjct  873  TVLVGLKPETEYYVNV  888


 Score = 35.6 bits (80),  Expect = 1.3, Method: Composition-based stats.
 Identities = 14/109 (13%), Positives = 28/109 (26%), Gaps = 10/109 (9%)

Query  184  DSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHS  243
              + Y +S+    + G       + +      PD      V         +  TWQ    
Sbjct  401  PETKYRLSVYANYASG--EGDPLSGEATTEASPD---GKIVKISEETETTMKATWQP---  452

Query  244  WNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQL  292
              +    L + + YR           V       V+        + + +
Sbjct  453  --APGNVLNYRVVYRPRAGGRQIVAKVPPAVTSTVLRRLTPLTTYDISV  499


> sp|P0C0K6|EPHB6_PANTR Ephrin type-B receptor 6 OS=Pan troglodytes 
OX=9598 GN=EPHB6 PE=3 SV=4
Length=1020

 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 51/159 (32%), Gaps = 31/159 (19%)

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
              D        +   +    +         YI+ +   +  G              L PD
Sbjct  426  CRDEVHFDPRQRGLTESRVLVGGLRAH-VPYILEVQAVN--GVSE-----------LSPD  471

Query  218  PPA----NIT-----------VTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERS  262
            PP     N++           V  V+R    ++V+W  P    ++   L ++LRY  +  
Sbjct  472  PPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQ--TNGNILDYQLRYYDQVE  529

Query  263  KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                ++ +    +   +     G  +  Q+RA+   G G
Sbjct  530  DESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHG  568


> sp|Q13332|PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase 
S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
Length=1948

 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 48/278 (17%), Positives = 84/278 (30%), Gaps = 34/278 (12%)

Query  80   RLLLRSVQLHDSGNYSCYRAGRPAG---TVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGP  136
               +R +     G         P      V     VP +   L    +S  S +   W P
Sbjct  496  TYTVRVLAFTSVG-------DGPLSDPIQVKTQQGVPGQPMNLRAEARSETS-ITLSWSP  547

Query  137  RSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVAS  196
                S+  K  LL R+             +  +     +  +      ++ Y   +   S
Sbjct  548  PRQESI-IKYELLFREGD--------HGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARS  598

Query  197  SVGSKFSKTQTFQGCGILQPD-PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFEL  255
              G         Q     +P  PP +  V  V+     + V+W+ P     +   + + +
Sbjct  599  PQGLGAFTPVVRQRTLQSKPSAPPQD--VKCVSVRSTAILVSWRPPPPETHNGALVGYSV  656

Query  256  RYRA---ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG  312
            RYR    E  +      +       ++       ++ +   A  E G G  S  SP  + 
Sbjct  657  RYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPES--SPVVVR  714

Query  313  TPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN  350
            T      +PP + E      A   N     +L+R  A 
Sbjct  715  TDEDVPSAPPRKVE------AEALNATAIRVLWRSPAP  746


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 67/231 (29%), Gaps = 27/231 (12%)

Query  111  DVPPEEPQLSCFRKSPLSNVVCEWG---PRSTPSLTTKAVLLVRKFQNSPAE--------  159
            DVP   P+         + +   W    P           +   + + + A         
Sbjct  718  DVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDV  777

Query  160  ---DFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS-KFSKTQTFQGCGILQ  215
               D Q     + E +     +       + Y +++   +  G    SK +     G + 
Sbjct  778  MLADAQWETDDTAEYE----MVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVL  833

Query  216  PDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
              P  ++  T        L   W+ P    +    L + L++  E S    T      + 
Sbjct  834  GRPTLSVQQTPEGS----LLARWEPPA-GTAEDQVLGYRLQFGREDSTPLATLEFPPSED  888

Query  276  HCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENE  326
                     G  +V +L A+   G G   E + E +  P    R  P   E
Sbjct  889  RYTASGVHKGATYVFRLAARSRGGLG---EEAAEVLSIPEDTPRGHPQILE  936


> sp|Q07497|EPHB5_CHICK Ephrin type-B receptor 5 OS=Gallus gallus 
OX=9031 GN=EPHB5 PE=2 SV=1
Length=1002

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 69/213 (32%), Gaps = 32/213 (15%)

Query  122  FRKSPLSNVVCEWGPRSTPSLT-----TKAVLLVRKFQNSPAED---FQEPCQYSQESQK  173
               S  S+  C   P +   L+     +  +L  R  ++        F   C+       
Sbjct  328  RSASDNSDAPCTGIPSAPRDLSYEIVGSNVLLTWRLPKDLGGRKDVFFNVICKECPTRSA  387

Query  174  FSCQLAVPEGDSSFYIVSMC-----VASSVGS--KFSKTQTFQGCGILQPDPPA----NI  222
             +C             V +      V++ +       + Q       L  + P     N+
Sbjct  388  GTCVRCGDNVQFEPRQVGLTESRVQVSNLLARVQYTFEIQAVNLVTELSSEAPQYATINV  447

Query  223  TVTA-----------VARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVK  271
            + +            V+R    ++++W  P     +   L ++LRY  +      ++ + 
Sbjct  448  STSQSVPSAIPMMHQVSRATSSITLSWPQPDQ--PNGVILDYQLRYFDKAEDEDNSFTLT  505

Query  272  DLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
               +   I +   G  +V Q+RA+   G G +S
Sbjct  506  SETNMATILNLSPGKIYVFQVRARTAVGYGPYS  538


> sp|Q5JZY3|EPHAA_HUMAN Ephrin type-A receptor 10 OS=Homo sapiens 
OX=9606 GN=EPHA10 PE=1 SV=2
Length=1008

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/199 (17%), Positives = 59/199 (30%), Gaps = 21/199 (11%)

Query  113  PPEEPQ-LSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQES  171
            PP  P+ L          +   W P +     +     +        E     C+     
Sbjct  337  PPSAPRDLQYSLSRSPLVLRLRWLPPADSGGRSDVTYSLL-CLRCGREGPAGACE---PC  392

Query  172  QKFSCQLAVPEG------------DSSFYIVSMCVAS--SVGSKFSKTQTFQGCGILQPD  217
                  L    G              + Y V +   +  S  +  + T   Q      P 
Sbjct  393  GPRVAFLPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGTTYAQVTVSTGPG  452

Query  218  PPANI-TVTAVARNPRWLSVTWQDP-HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQH  275
             P     +      P+ +S++W++P  +         +E+RY  +     T  MVK    
Sbjct  453  APWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAP  512

Query  276  HCVIHDAWSGLRHVVQLRA  294
               + +     R+V Q+RA
Sbjct  513  TVTVTNLKPATRYVFQIRA  531


> sp|Q60847|COCA1_MOUSE Collagen alpha-1(XII) chain OS=Mus musculus 
OX=10090 GN=Col12a1 PE=2 SV=3
Length=3120

 Score = 51.3 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/210 (16%), Positives = 62/210 (30%), Gaps = 21/210 (10%)

Query  93   NYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRK  152
               C R  +    +     VPP++ + +    +   +   EW P      +    +  + 
Sbjct  614  QSICLRIEQELAAIKKKAYVPPKDLRFTQVTAN---SFKAEWSPPGDNVFS--YHVTYKD  668

Query  153  FQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCG  212
                      EP      +   S  L       + Y+V++      G  FS   T +   
Sbjct  669  ANGDDEVTVVEP------ASSTSVVLN-NLRPETLYLVNVTAEYEDG--FSVPITGEETT  719

Query  213  ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD  272
                  P N+ VT          +TW       +    LR+ +RYR              
Sbjct  720  AEVKGVPRNLKVT--DETTDSFKLTWS-----QAPGRVLRYRIRYRPVSGGESKEVSTPA  772

Query  273  LQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
             Q    + +     ++ + + A+   G G 
Sbjct  773  NQRRKTLENLTPDTKYEISVIAEYSSGPGS  802


 Score = 49.8 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/239 (14%), Positives = 72/239 (30%), Gaps = 26/239 (11%)

Query  126   PLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS  185
               + +  +W P       T   +  +  ++       +P +          QL      +
Sbjct  1486  GPTTMHVQWQP---VGGATGYTVSYQPTRSPEG---TKPKEMRVGPTVNDVQLTG-LLPN  1538

Query  186   SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDP-PANITVTAVARNPRWLSVTWQDPHSW  244
             + Y V++     +    S+        +  P P P ++ +  V      ++V W+     
Sbjct  1539  TEYEVTVQAV--LYDLTSEPAK--AREVTLPLPRPQDVKLRDV--THSTMNVVWEPVLGK  1592

Query  245   NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
                    ++ +RY+    + F    V   +   ++ D  S  ++ V + A   + +G   
Sbjct  1593  VR-----KYIVRYKTPD-EEFKEVEVDRSRASTILKDLSSQTQYTVSVSAV--YDEGT--  1642

Query  305   EWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVP  363
               SP A     T     P   + +           D           T  PV +   + 
Sbjct  1643  --SPPATAYDTTRRVPAPTNLQFTEVTPESFRGTWDHGASDVSLYRITWAPVGNPDKME  1699


 Score = 41.7 bits (96),  Expect = 0.017, Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 26/74 (35%), Gaps = 7/74 (9%)

Query  219   PANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCV  278
             P N+ ++   R  R   V+W  P          R+++ Y          + V  L    V
Sbjct  1388  PTNLVIS--ERTHRSFRVSWTPPSDSVD-----RYKVEYYPVSGGKRQEFYVSRLDTSTV  1440

Query  279   IHDAWSGLRHVVQL  292
             + D      +VV +
Sbjct  1441  LKDLKPETDYVVNV  1454


 Score = 36.7 bits (83),  Expect = 0.60, Method: Composition-based stats.
 Identities = 17/114 (15%), Positives = 38/114 (33%), Gaps = 15/114 (13%)

Query  217  DPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHH  276
            DPP+++    +  N   + ++W+ P           + +            + +      
Sbjct  26   DPPSDLNFKIIDENT--VHMSWERPVDPIVG-----YRITVDPTTDGPTKEFTLAASTTE  78

Query  277  CVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMG--TPWTESRSPPAENEVS  328
             ++ D     ++VV + +  E       E S   +G  T  T   + P E +  
Sbjct  79   TLLSDLIPETQYVVTITSYNEV------EESVPVIGQLTIQTGGPTKPGEKKPG  126


> sp|O73875|EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio 
OX=7955 GN=ephb4a PE=2 SV=3
Length=987

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 61/184 (33%), Gaps = 12/184 (7%)

Query  129  NVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS---  185
            ++  EW         +     V     S        C      +     +          
Sbjct  343  SLTLEWSEPLDSGGRSDLSYSVECRMCSTPGSPCTLCSDGVNYRPSQTGIQGRRVSIWGL  402

Query  186  ---SFYIVSMCVASSVGSKFSKTQTFQGCGILQ-PDPPANIT-VTAVARNPRWLSVTWQD  240
               + Y  ++   + V ++  +    +   I   P+ P  ++ +         L++ W  
Sbjct  403  RPHTTYSFTVMALNGVSAQSQQGPAGETINITTSPNVPVLVSGLRKSTATESSLTLYWNT  462

Query  241  PHSWNSSFYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEF  298
            P    S +  L++++RY  +   S+  +   ++   +  V+ D     ++ VQ+RA+   
Sbjct  463  PTQ--SHYRILQYQIRYCEKERGSEENSCHYMESNNNEVVLSDLRRATQYEVQVRARTFA  520

Query  299  GQGE  302
            G G 
Sbjct  521  GYGS  524


> sp|Q91740|FINC_XENLA Fibronectin OS=Xenopus laevis OX=8355 GN=fn1 
PE=2 SV=1
Length=2481

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/156 (18%), Positives = 52/156 (33%), Gaps = 25/156 (16%)

Query  218   PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT-WMVKDLQHH  276
             PP N+  T +   P  + VTW  P S   S     + +RY   +     T   +    + 
Sbjct  1360  PPTNLRFTNIG--PDNIRVTWSPPTSIELSS----YLVRYSPVKKPDDVTELSLSPSTNM  1413

Query  277   CVIHDAWSGLRHVVQLR--------------AQEEFGQGE---WSEWSPEAMGTPWTESR  319
              V+ +      ++V +               A+          +SE +P +    W   R
Sbjct  1414  VVLSNLLPFTEYLVSVHSVYEERESSSLNGVAKTHLDSPTGIAFSEITPNSFTVHWIAPR  1473

Query  320   SPPAENEVSTPMQA-LTTNKDDDNILFRDSANATSL  354
              P     +   +++     K++     R+S   T L
Sbjct  1474  GPITGYRIRYQLESGAGRPKEERVPPSRNSITLTHL  1509


 Score = 49.0 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 37/256 (14%), Positives = 80/256 (31%), Gaps = 38/256 (15%)

Query  113   PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQ  172
             PP  P++   +    + V   W         TK   +     ++   D Q P + + ++ 
Sbjct  1907  PPRRPRI---QDVTETTVTLSWR--------TKTETITGFQIDAIPADGQNPIRRTVDAD  1955

Query  173   KFSCQLAV--PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN  230
               +  +    P  D   Y+ ++       +  S   T      +  D P+N+    +   
Sbjct  1956  LRTFTITGLQPGTDYKIYLYTLND-----NARSSPVTVDVTTAV--DSPSNLR--FLTTT  2006

Query  231   PRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM-VKDLQHHCVIHDAWSGLRHV  289
                L  TWQ P +  + +      +RY             +        + +   G  ++
Sbjct  2007  SNSLLFTWQPPRARITGYI-----IRYEKAGGLIKEHLPRLPAGTTESTLTNLEPGTEYI  2061

Query  290   VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSA  349
             + + A     +      S   +G   T+    P    +  P Q       D      ++ 
Sbjct  2062  IYIIAVRNNMK------SEPLVGRKRTD--ELPRLVTLPHPGQGP--EILDVPTDEENTP  2111

Query  350   NATSLPVQDSSSVPLP  365
             + T   + + + + LP
Sbjct  2112  HITQTKLDNGNGIQLP  2127


 Score = 37.1 bits (84),  Expect = 0.39, Method: Composition-based stats.
 Identities = 34/233 (15%), Positives = 70/233 (30%), Gaps = 49/233 (21%)

Query  127  LSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEG-DS  185
             S+ +  W   S     T +   V    +   ++     +   E    +  + +P+    
Sbjct  733  ASSFLVSWVSASD----TVSGFRVEYELSEDGDE-----KRYLELPNTATSVNIPDLLPG  783

Query  186  SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
              Y V++   +  G K     T Q      PD P    V  V      + + W  P +  
Sbjct  784  RRYNVNVYQITEEGEKSLILSTTQTTA---PDAPPEHNVENVDDTS--IMIKWNKPQAPI  838

Query  246  SSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE  305
            +      + + Y      + T   +    +   + +   G+ + + + A E+        
Sbjct  839  TG-----YRVVYSPSVEGSSTELNLPSTANSVTLTELLPGIEYNITIYAVED--------  885

Query  306  WSPEA---------MGTPWTESRSPPAENEV-----------STPMQALTTNK  338
             S E+          GTP T     P + ++            T  Q+  +  
Sbjct  886  -SLESVPVFIQQGTTGTPQTVIVPSPTDLQLVEVTDVKIIIMWTSPQSEVSGY  937


> sp|Q78DX7|ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS 
OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
Length=2340

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 61/198 (31%), Gaps = 20/198 (10%)

Query  123  RKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPE  182
                   V   W P +   +  K ++  +  Q   +  F E    +     ++ +   P 
Sbjct  118  SSIGSHGVTLRWNPANISGV--KYIIQWKYAQLPGSWTFTE----TVSKLSYTVEPLHPF  171

Query  183  GDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPH  242
             +  F +V +  A                  +    P  + +   + +P  + V+W  PH
Sbjct  172  TEYIFRVVWIFTAQLHLYSPPSPSYRTHPYGVPETAP--LILNMESWSPDTVEVSWAPPH  229

Query  243  SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
                    L + LR  ++  K  +       +     +       +   + A  E G+G 
Sbjct  230  --FPGGPILGYNLRLISKNQKLDS----GTQRTSFQFYSTLPNTTYRFSIAAVNEVGEG-  282

Query  303  WSEWSPEAMGTPWTESRS  320
                 PEA  T  T S S
Sbjct  283  -----PEAESTVTTPSPS  295


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 37/111 (33%), Gaps = 13/111 (12%)

Query  222  ITVTAVARNPRWLSV---------TWQDPHSW----NSSFYRLRFELRYRAERSKTFTTW  268
            +    +  +P+ +SV          W  P        S++    +E++  ++     T  
Sbjct  562  VQSYPLPGHPQEVSVLFGSREALIQWTPPALAIGASPSAWQNWTYEVKVYSQDILEITQV  621

Query  269  MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR  319
                      + +  S  ++ V +RA    G G WS  S      P TE  
Sbjct  622  FSNISGTMLNVPELQSSTKYTVSVRASSPKGPGPWSAPSVGTTLVPATEPP  672


> sp|Q8R4S8|CRLF2_RAT Cytokine receptor-like factor 2 OS=Rattus 
norvegicus OX=10116 GN=Crlf2 PE=1 SV=1
Length=360

 Score = 50.2 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/194 (19%), Positives = 63/194 (32%), Gaps = 27/194 (14%)

Query  126  PLSNVVCEWGPRS-TPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGD  184
             L +V   WGP S    L+    L  R           +PC +            +P G 
Sbjct  42   DLESVEVTWGPGSAHHGLSANLSLEFRY-----GNQVPQPCPHYFLLDSVRAGCVLPMGK  96

Query  185  SSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSW  244
                +V      +      K  +      L+P PP N+T++ V         +   P   
Sbjct  97   GLLEVVLREGGGAKLFSRKKKAS----AWLRPRPPWNVTLSWVGDTVAVSCPSHSYPG--  150

Query  245  NSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQE-EFGQGEW  303
                  L +E+++R +    + +        +  +     G  +  ++RA   +F  G  
Sbjct  151  ------LEYEVQHRDDFDPEWQSTSAPF--CNLTVGGLDPGRCYDFRVRATPQDFYYG--  200

Query  304  SEWSPEAMGTPWTE  317
                PEA  + WT 
Sbjct  201  ----PEARPSKWTG  210


> sp|A8DYP0|OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 
GN=Unc-89 PE=1 SV=1
Length=4218

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/233 (16%), Positives = 74/233 (32%), Gaps = 26/233 (11%)

Query  111   DVPP---EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQY  167
               PP   E+PQ     ++  S++ C     +                 + +    +  + 
Sbjct  3651  GYPPFFREKPQTIAITENQPSHIHCF----AVGDPKPCVQWFKNDMVLTES----KRIKI  3702

Query  168   SQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQ---PDPPANITV  224
             S +    S     P       +  +   + VG      QT   C I+    PD P +  +
Sbjct  3703  SVDEDGRSILRFEPALHFDVGVYKVVARNKVG------QTVARCRIVVATLPDAPDSPEI  3756

Query  225   TAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWS  284
             +A +     + + W+ P   +     L + L+Y+      +TT          ++HD   
Sbjct  3757  SANSGTE--ILLRWKQPRD-DGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQP  3813

Query  285   GLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
                +  +L ++   G   WSE       +            +    +Q LT N
Sbjct  3814  NTNYQFRLASKNRIG---WSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTEN  3863


 Score = 46.3 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 49/340 (14%), Positives = 102/340 (30%), Gaps = 42/340 (12%)

Query  58    VHWVLRK---PAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA---------GRPAGT  105
             + W  +    P +  +  +  G    L++ + +  D G Y C  +         GR    
Sbjct  2646  LEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIV  2705

Query  106   VHLLVDVPPEEPQ-LSCFRKSP-----LSNVV-C---------EWGPRSTPSLTTKAVLL  149
               +      E P  L            ++    C         EW         +   L+
Sbjct  2706  NEIKKHSRSEPPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLI  2765

Query  150   VRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQ  209
               +         +   +Y     ++SC++  P GD   +      +     K  + Q   
Sbjct  2766  DIEPNGLLRLTIKNVTEYDV--GRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQYTD  2823

Query  210   GCGILQPDPPANITVTAVAR--NPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTT  267
                  +   P  ++   +      R L ++W +P    +  Y + +++         + T
Sbjct  2824  FKKYKKSGAPPPLSEGPIISRMTDRGLLLSW-NPSVPLTPRYPITYQIEMMDLPEGDWRT  2882

Query  268   WMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE-----AMGTPWTESRSPP  322
                      C I +      +  ++R + +FG  + S ++           P T +  PP
Sbjct  2883  LRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPP  2942

Query  323   AENEVSTPMQALTTNKD-DDNILFRDS-ANATSLPVQDSS  360
               +    P  +    KD D      D  A A    +++  
Sbjct  2943  GTD--FRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQD  2980


> sp|O75015|FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region 
receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
Length=233

 Score = 49.4 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 60/204 (29%), Gaps = 20/204 (10%)

Query  14   AAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSR  73
             + G            +     + L  DSVTL C G    ++ +  W   +    S  S 
Sbjct  14   VSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQAS-  72

Query  74   WAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG---TVHLLVDVPPEEPQLSCFRKSPLSNV  130
                     + +  ++DSG Y C            + + +     +     F++    ++
Sbjct  73   ------SYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHL  126

Query  131  VC-EWGPRSTPSLTTKAVLLVRKFQNSP---AEDFQEPCQYSQESQKFSCQLAVPEGDSS  186
             C  W   +      K   L             DF  P    ++S  + C      G  +
Sbjct  127  RCHSWKNTALH----KVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFC--RGLVGSKN  180

Query  187  FYIVSMCVASSVGSKFSKTQTFQG  210
                ++ +  + G   S   +F  
Sbjct  181  VSSETVNITITQGLAVSTISSFSP  204


> sp|Q91289|FINC_PLEWA Fibronectin (Fragment) OS=Pleurodeles waltl 
OX=8319 PE=2 SV=1
Length=1328

 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/242 (17%), Positives = 74/242 (31%), Gaps = 28/242 (12%)

Query  122  FRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVP  181
            F  +  S+    W         T   +          +      +      + S  L   
Sbjct  302  FSDTTSSSFTVYWMAPRAT--VTGYKIQYHPETGGAGQKE----ERCVPPSRNSLTLT-N  354

Query  182  EGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDP  241
                + Y+VS+   +  G + S     Q   +   D P N+ VT+       +S++W  P
Sbjct  355  LTPGTEYVVSIFAVN--GRQESVPLVGQQATV--SDTPTNLEVTSSTPTS--MSISWDAP  408

Query  242  HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG  301
                  +YR+ +              + V   +    I     G  +++ + A    G  
Sbjct  409  PVGVR-YYRITY---TETGGETPVQEFTVPGDRSDAPIRGLKPGAEYIITVYAVTGRGDS  464

Query  302  EWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSS  361
                    A   P T +        V  P Q   T+  D +I  R   ++T +     +S
Sbjct  465  -------PASSKPVTVTHKT----VVDKPTQLQVTDVQDHSIQVRWMPSSTPVTGYRVTS  513

Query  362  VP  363
            VP
Sbjct  514  VP  515


 Score = 42.9 bits (99),  Expect = 0.007, Method: Composition-based stats.
 Identities = 30/208 (14%), Positives = 59/208 (28%), Gaps = 29/208 (14%)

Query  144  TKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFS  203
            T   +     ++   E    P      +Q        P  +   Y VS+           
Sbjct  597  TTYKVTYSNPEDGIHELVPAPNGDEDTAQLHGL---RPGAE---YTVSVVALHDDMESQP  650

Query  204  KTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSK  263
               T Q   I  P PP N+  + +      ++V+W+ P+   +      + +R   +   
Sbjct  651  LIGT-QVTAI--P-PPTNLLFSQITPTS--VTVSWRPPNVQLTG-----YRVRVHPKEKA  699

Query  264  -TFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPP  322
                   +       V+       ++ V + A ++      S  S  A G   T+    P
Sbjct  700  GPMKEINLSPDSTSAVVTGLMVATKYEVSVYALKD------SLTSRPAQGIVTTQENVSP  753

Query  323  AENEVSTPMQALTTNKDDDNILFRDSAN  350
                     +     +    I +R    
Sbjct  754  -----PRRRRITDVTETTVTITWRTKTE  776


 Score = 36.3 bits (82),  Expect = 0.70, Method: Composition-based stats.
 Identities = 35/199 (18%), Positives = 60/199 (30%), Gaps = 21/199 (11%)

Query  98   RAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSP  157
              G  A T     D  P    L  F      +++  W    +  L+     LVR   +  
Sbjct  188  TDGESAPTTLTTADCCPTATDLR-FTNVGPDSMLVTWSAPPSMVLS---SFLVRYVPSKN  243

Query  158  AEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPD  217
             ED  E    +         L       + YIVS+        + S   T      L  D
Sbjct  244  EEDAAE---LTISPSDNMVVLT-NLLPGTEYIVSVFAVYE--ERESTPLTGVQRTGL--D  295

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAE--RSKTFTTWMVKDLQH  275
             P  +            +V W  P +  +      ++++Y  E   +       V   ++
Sbjct  296  SPTGL--DFSDTTSSSFTVYWMAPRATVTG-----YKIQYHPETGGAGQKEERCVPPSRN  348

Query  276  HCVIHDAWSGLRHVVQLRA  294
               + +   G  +VV + A
Sbjct  349  SLTLTNLTPGTEYVVSIFA  367


 Score = 35.9 bits (81),  Expect = 0.92, Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 37/122 (30%), Gaps = 14/122 (11%)

Query  181  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD  240
            P  D   +I ++       +  S   T      +  D P+N+    +      L  +WQ 
Sbjct  812  PGTDYKIHIYTLND-----NARSSPVTIDATTAV--DSPSNLR--FLTTTSNSLLFSWQP  862

Query  241  PHSWNSSFYRLRFELRYRAERS-KTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFG  299
            P S  + +  +++E   +     +                 +   G  + + + A     
Sbjct  863  PRSKLTGYI-IKYE---KPGGPVREVVPRPHPGATESQQSQNLEPGTEYTIYIIAVRSNY  918

Query  300  QG  301
            + 
Sbjct  919  KS  920


 Score = 35.2 bits (79),  Expect = 1.5, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 40/111 (36%), Gaps = 12/111 (11%)

Query  188  YIVSMCVASSVGSK--FSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWN  245
            YI+++   +  G     SK  T     ++  D P  + VT V  +   + V W    +  
Sbjct  451  YIITVYAVTGRGDSPASSKPVTVTHKTVV--DKPTQLQVTDVQDHS--IQVRWMPSSTPV  506

Query  246  SSFYRLRFELRYRAERSKTFT-TWMVKDLQHHCVIHDAWSGLRHVVQLRAQ  295
            +      + +    +     T + +V   Q    I      + +VV + AQ
Sbjct  507  TG-----YRVTSVPKSGVGPTVSHVVPPDQTEMTIEGLEPTVEYVVSVYAQ  552


 Score = 35.2 bits (79),  Expect = 1.5, Method: Composition-based stats.
 Identities = 19/106 (18%), Positives = 35/106 (33%), Gaps = 13/106 (12%)

Query  221  NITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA-ERSKTFTTWMVKDLQHHCVI  279
            ++  T V  +     VTW  P S   S +     +RY   +  +      +    +  V+
Sbjct  208  DLRFTNVGPDSML--VTWSAPPSMVLSSFL----VRYVPSKNEEDAAELTISPSDNMVVL  261

Query  280  HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAEN  325
             +   G  ++V + A  E  +           G   T   SP   +
Sbjct  262  TNLLPGTEYIVSVFAVYEEREST------PLTGVQRTGLDSPTGLD  301


> sp|Q92729|PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase 
U OS=Homo sapiens OX=9606 GN=PTPRU PE=1 SV=2
Length=1446

 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 86/273 (32%), Gaps = 44/273 (16%)

Query  113  PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTK---AVLLVRKFQNSPAEDFQEPCQYSQ  169
            P   P+   F +     +  +W P       T+     + +       +   Q   +  +
Sbjct  383  PMRAPKGLAFAEIQARQLTLQWEP--LGYNVTRCHTYTVSLCYHYTLGSSHNQTIRECVK  440

Query  170  ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVA-  228
              Q  S              V + + +  G K  K  TFQ       D P+ I   ++  
Sbjct  441  TEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDE----DVPSGIAAESLTF  496

Query  229  -RNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKD--------LQHHCVI  279
                  + + W++P     +    ++E+ Y++  S      +            + + V 
Sbjct  497  TPLEDMIFLKWEEPQ--EPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVF  554

Query  280  HDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD  339
             +   G  ++  +RA+   G+G                     A  E++T + A + +  
Sbjct  555  SNLHPGTTYLFSVRAR--TGKGF-----------------GQAALTEITTNISAPSFDYA  595

Query  340  DDNILFRDSANATS---LPVQDSSSVPLPTFLV  369
            D      +S N  +    P Q   + P+  + V
Sbjct  596  DMPSPLGESENTITVLLRPAQGRGA-PISVYQV  627


> sp|P28685|CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 
PE=1 SV=1
Length=1036

 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 69/251 (27%), Gaps = 24/251 (10%)

Query  134  WGPR---STPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIV  190
            W P             +L  RK         + P                  G  + + V
Sbjct  726  WTPTLRDYQNGDGFGYILSFRKKGTQGWLTARVP----HAESLHYVYRNESIGPYTPFEV  781

Query  191  SMCVASSVGSK-FSKTQTFQGCG---ILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS  246
             +   +  G    S T           + P       VTA A     + V+W+     + 
Sbjct  782  KIKAYNRKGEGPESLTAIVYSAEEEPKVAP-----FRVTAKAVLSSEMDVSWEPVEQGDM  836

Query  247  SFYRLRFELRY--RAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS  304
            +   L +E+RY    ++ +         L     +       ++ V +RA    G G  S
Sbjct  837  TGVLLGYEIRYWKDGDKEEAADRVRTAGLVTSAHVTGLNPNTKYHVSVRAYNRAGAGPPS  896

Query  305  EWSPEAMGTPWTESRSPPAENEV-STPMQALTTNK-DDDNILFRDSANATSLPVQDSSSV  362
                 +     T+         +  T   +  T K D       +SA      +    S 
Sbjct  897  ----PSTNITTTKPPPRRPPGNISWTLTGSTVTIKWDPVVAQADESAVTGYKMLYRQDSH  952

Query  363  PLPTFLVAGGS  373
              PT  +A  S
Sbjct  953  SAPTLYLASKS  963


 Score = 40.9 bits (94),  Expect = 0.029, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 31/83 (37%), Gaps = 7/83 (8%)

Query  36   TSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
             +L G  VTL C          V  +  +   GS  S+W      L +++V   D G Y 
Sbjct  245  YALTGQMVTLEC----FAFGNPVPQIKWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYE  300

Query  96   CYRA---GRPAGTVHLLVDVPPE  115
            C      GR      +++   P+
Sbjct  301  CEAENIKGRDTYQGRIIIHAQPD  323


 Score = 32.9 bits (73),  Expect = 7.6, Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (34%), Gaps = 1/62 (2%)

Query  36   TSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYS  95
             +     V + C        ATV W        +           L+L+++   D G Y+
Sbjct  424  PAARSGKVIIPCQ-PRAAPKATVLWTKGTELLTNSSRVTITADGTLILQNISKSDEGKYT  482

Query  96   CY  97
            C+
Sbjct  483  CF  484


> sp|O55005|ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus 
OX=10116 GN=Robo1 PE=1 SV=1
Length=1651

 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 49/354 (14%), Positives = 97/354 (27%), Gaps = 63/354 (18%)

Query  24   RCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPA------AGSHPSRWAGM  77
              P   V         G +VT  C          + W                 S    +
Sbjct  349  EPPHFVVKPRDQVVALGRTVTFQCE-ATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSV  407

Query  78   GRR--LLLRSVQLHDSGNYSCYRAGRPAGTVH--------LLVDVPP----EEPQLSCFR  123
             +   L + +VQ  D G Y C         +         ++ D PP    + P      
Sbjct  408  SQTGDLTVTNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVA  467

Query  124  KSPLSNVVCEWGPRSTPSLTTK-----AVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQL  178
                  + C       P++  +           + +   +   Q       ++ +++C  
Sbjct  468  VDGTLTLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLESGVLQIRYAKLGDTGRYTCTA  527

Query  179  AVPEGDSSF--YIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSV  236
            + P G++++  YI         G      +      I  P  P+   VT V++N   +++
Sbjct  528  STPSGEATWSAYIEVQE----FGVPVQPPRPTDPNLI--PSAPSKPEVTDVSKNT--VTL  579

Query  237  TWQD-------PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHV  289
             WQ        P S+    +              ++ T           I        ++
Sbjct  580  LWQPNLNSGATPTSYIIEAFS--------HASGSSWQTVAENVKTETFAIKGLKPNAIYL  631

Query  290  VQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNI  343
              +RA   +G  + S+ S             P    +V    Q +   +    +
Sbjct  632  FLVRAANAYGISDPSQIS------------DPVKTQDVPPTTQGVDHKQVQREL  673


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 69/239 (29%), Gaps = 46/239 (19%)

Query  218  PPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC  277
            PP ++TV+    N   + VTWQ P     +     +++      ++      V       
Sbjct  778  PPRSVTVSKNDGNGTAILVTWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSV  837

Query  278  VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTN  337
            VI     G+R+ V++ A    G G  SE                   +    P+      
Sbjct  838  VIPFLVPGIRYSVEVAASTGAGPGVKSE-------------PQFIQLDSHGNPVSPEDQ-  883

Query  338  KDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRAL  397
                           SL  Q S  V  P F+   G+          I+L     W  R  
Sbjct  884  --------------VSLAQQISDVVKQPAFIAGIGA-------ACWIILMVFSIWLYRHR  922

Query  398  KEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSP  456
            K+                 R  P+    P ++        G +  SS  RP   +   P
Sbjct  923  KK------RNGLSSTYAGIRKVPSFTFTPTVT-----YQRGGEAVSSGGRPGLLNISEP  970


 Score = 44.0 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 50/297 (17%), Positives = 86/297 (29%), Gaps = 36/297 (12%)

Query  79   RRLLLRSVQLHDSGNYSCYRA---GRPAGTVHLLVDVPPE---EPQLSCFRKSPLSNVVC  132
              L +R V   D G+Y+C      G+   +  L V  PP    +P+             C
Sbjct  313  HTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQVVALGRTVTFQC  372

Query  133  EWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS-  191
            E      P++                E  Q      Q  Q  S       GD +   V  
Sbjct  373  EATGNPQPAIF------------WRREGSQNLLFSYQPPQSSSRFSVSQTGDLTVTNVQR  420

Query  192  ------MCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARN---PRWLSVTWQDPH  242
                  +C   +V          +   ++   PP  I    V +       L+++     
Sbjct  421  SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLTLSCVATG  480

Query  243  SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGE  302
            S   +    +  +    + S+               I  A  G        A    G+  
Sbjct  481  SPVPTILWRKDGVLVSTQDSRIKQL-----ESGVLQIRYAKLGDTGRYTCTASTPSGEAT  535

Query  303  WSEW-SPEAMGTPWTESRSPPAENEVSTPMQALTTN--KDDDNILFRDSANATSLPV  356
            WS +   +  G P    R        S P +   T+  K+   +L++ + N+ + P 
Sbjct  536  WSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSKNTVTLLWQPNLNSGATPT  592


 Score = 36.7 bits (83),  Expect = 0.57, Method: Composition-based stats.
 Identities = 11/59 (19%), Positives = 19/59 (32%), Gaps = 0/59 (0%)

Query  38   LPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC  96
              G+   + C         T+ W            R    G +L++   +  D+G Y C
Sbjct  182  AVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC  240


> sp|P35918|VGFR2_MOUSE Vascular endothelial growth factor receptor 
2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=1
Length=1367

 Score = 50.6 bits (119),  Expect = 3e-0