PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           562,253 sequences; 202,348,262 total letters

Results from round 1


Query= sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1

Length=4405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute re...  9175    0.0  
  sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ...  9137    0.0  
  sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coro...  7509    0.0  
  sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus...  7477    0.0  
  sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus...  7475    0.0  
  sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co...  7475    0.0  
  sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus...  7462    0.0  
  sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir...  7448    0.0  
  sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir...  7448    0.0  
  sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir...  7444    0.0  
  sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus...  2320    0.0  
  sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir...  2318    0.0  
  sp|K9N638|R1A_CVEMC Replicase polyprotein 1a OS=Middle East res...  2196    0.0  
  sp|K9N7C7|R1AB_CVEMC Replicase polyprotein 1ab OS=Middle East r...  2190    0.0  
  sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus...  2179    0.0  
  sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir...  2174    0.0  
  sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavi...  1883    0.0  
  sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavi...  1882    0.0  
  sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavir...  1872    0.0  
  sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona...  1871    0.0  
  sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona...  1871    0.0  
  sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavir...  1868    0.0  
  sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavir...  1868    0.0  
  sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav...  1861    0.0  
  sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav...  1861    0.0  
  sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav...  1860    0.0  
  sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavir...  1845    0.0  
  sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavi...  1839    0.0  
  sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavi...  1838    0.0  
  sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus...  1837    0.0  
  sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav...  1837    0.0  
  sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona...  1835    0.0  
  sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir...  1833    0.0  
  sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus...  1833    0.0  
  sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavir...  1832    0.0  
  sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir...  1831    0.0  
  sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona...  1831    0.0  
  sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavir...  1830    0.0  
  sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavir...  1826    0.0  
  sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav...  1825    0.0  
  sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav...  1823    0.0  
  sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav...  1818    0.0  
  sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus...  1228    0.0  
  sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir...  1226    0.0  
  sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavir...  1192    0.0  
  sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav...  1192    0.0  
  sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemi...  1189    0.0  
  sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide...  1187    0.0  
  sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav...  1182    0.0  
  sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavir...  1182    0.0  
  sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmi...  1123    0.0  
  sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans...  1122    0.0  
  sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav...  1122    0.0  
  sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectiou...  1118    0.0  
  sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious...  1118    0.0  
  sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious...  1115    0.0  
  sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti...  1114    0.0  
  sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio...  1114    0.0  
  sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio...  1110    0.0  
  sp|Q4J9D2|Y1252_SULAC Uncharacterized protein Saci_1252 OS=Sulf...  73.2    3e-12
  sp|Q8ZXT3|Y1111_PYRAE Uncharacterized protein PAE1111 OS=Pyroba...  72.8    4e-12
  sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermot...  76.3    5e-12
  sp|Q97UU4|Y2899_SACS2 Uncharacterized protein SSO2899 OS=Saccha...  72.4    5e-12
  sp|Q96XY5|Y2383_SULTO Uncharacterized protein STK_23830 OS=Sulf...  67.0    3e-10
  sp|P0C6F3|R1A_BEV Replicase polyprotein 1a OS=Berne virus OX=11...  65.5    1e-08
  sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=...  65.1    2e-08
  sp|P36327|POLN_EEVV3 Polyprotein P1234 OS=Venezuelan equine enc...  63.2    7e-08
  sp|Q8CAS9|PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9...  62.4    9e-08
  sp|P27282|POLN_EEVVT Polyprotein P1234 OS=Venezuelan equine enc...  62.8    1e-07
  sp|P36328|POLN_EEVVP Polyprotein P1234 OS=Venezuelan equine enc...  62.8    1e-07
  sp|A7MG20|YMDB_CROS8 O-acetyl-ADP-ribose deacetylase OS=Cronoba...  58.2    2e-07
  sp|E1SDF1|YMDB1_PANVC O-acetyl-ADP-ribose deacetylase 1 OS=Pant...  56.6    6e-07
  sp|A8AI35|YMDB_CITK8 O-acetyl-ADP-ribose deacetylase OS=Citroba...  56.6    7e-07
  sp|C9Y0V8|YMDB_CROTZ O-acetyl-ADP-ribose deacetylase OS=Cronoba...  56.2    9e-07
  sp|Q8V294|POLN_EEVVC Polyprotein P1234 OS=Venezuelan equine enc...  59.3    1e-06
  sp|P0A8D6|YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escheri...  55.8    1e-06
  sp|P0A8D7|YMDB_ECOL6 O-acetyl-ADP-ribose deacetylase OS=Escheri...  55.8    1e-06
  sp|P0A8D8|YMDB_ECO57 O-acetyl-ADP-ribose deacetylase OS=Escheri...  55.8    1e-06
  sp|B5F961|YMDB_SALA4 O-acetyl-ADP-ribose deacetylase OS=Salmone...  54.3    4e-06
  sp|A4W960|YMDB_ENT38 O-acetyl-ADP-ribose deacetylase OS=Enterob...  53.9    5e-06
  sp|P67341|YMDB_SALTY O-acetyl-ADP-ribose deacetylase OS=Salmone...  53.5    5e-06
  sp|P67342|YMDB_SALTI O-acetyl-ADP-ribose deacetylase OS=Salmone...  53.5    5e-06
  sp|D3RKJ0|YMDB_KLEVT O-acetyl-ADP-ribose deacetylase OS=Klebsie...  53.1    7e-06
  sp|B5XXK9|YMDB_KLEP3 O-acetyl-ADP-ribose deacetylase OS=Klebsie...  53.1    7e-06
  sp|Q9WJC7|POLN_EEVVM Polyprotein P1234 OS=Venezuelan equine enc...  56.6    7e-06
  sp|B4T2X8|YMDB_SALNS O-acetyl-ADP-ribose deacetylase OS=Salmone...  53.1    8e-06
  sp|Q460N5|PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP1...  56.2    8e-06
  sp|D5CE05|YMDB_ENTCC O-acetyl-ADP-ribose deacetylase OS=Enterob...  52.0    2e-05
  sp|Q8EYT0|Y4133_LEPIN Macro domain-containing protein LA_4133 O...  52.0    2e-05
  sp|Q72M93|Y3295_LEPIC Macro domain-containing protein LIC_13295...  51.6    2e-05
  sp|B5RBF3|YMDB_SALG2 O-acetyl-ADP-ribose deacetylase OS=Salmone...  51.6    3e-05
  sp|B7LT90|YMDB_ESCF3 O-acetyl-ADP-ribose deacetylase OS=Escheri...  51.2    3e-05
  sp|Q0T5Z6|YMDB_SHIF8 O-acetyl-ADP-ribose deacetylase OS=Shigell...  50.8    4e-05
  sp|P0C6F4|R1A_BRV1 Replicase polyprotein 1a OS=Breda virus 1 OX...  53.5    7e-05
  sp|D2TT52|YMDB_CITRI O-acetyl-ADP-ribose deacetylase OS=Citroba...  50.1    8e-05
  sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 ...  53.1    8e-05
  sp|Q32E73|YMDB_SHIDS O-acetyl-ADP-ribose deacetylase OS=Shigell...  50.1    8e-05
  sp|Q8RHQ2|Y1951_FUSNN Uncharacterized protein FN1951 OS=Fusobac...  48.9    2e-04
  sp|Q2EMV9|PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP1...  51.6    2e-04
  sp|Q8Q0F9|Y177_METMA Macro domain-containing protein MM_0177 OS...  48.9    2e-04
  sp|Q87JZ5|Y4103_VIBPA Macro domain-containing protein VPA0103 O...  47.8    4e-04
  sp|Q8RB30|Y995_CALS4 Macro domain-containing protein TTE0995 OS...  47.4    5e-04
  sp|Q8TQD0|Y1614_METAC Macro domain-containing protein MA_1614 O...  47.8    5e-04
  sp|Q8IXQ6|PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9...  50.1    6e-04
  sp|E1PL40|YMDB2_PANVC O-acetyl-ADP-ribose deacetylase 2 OS=Pant...  47.0    7e-04
  sp|Q8BCR0|POLN_RUBVN Non-structural polyprotein p200 OS=Rubella...  49.3    0.001
  sp|Q8Y2K1|Y334_RALSO Macro domain-containing protein RSc0334 OS...  46.2    0.001
  sp|P13889|POLN_RUBVT Non-structural polyprotein p200 OS=Rubella...  48.1    0.002
  sp|Q9EYI6|Y189_STRNO Macro domain-containing protein in sno 5'r...  45.4    0.003
  sp|O40955|POLN_RUBVR Non-structural polyprotein p200 OS=Rubella...  47.8    0.003
  sp|Q97AU0|Y719_THEVO Uncharacterized protein TV0719 OS=Thermopl...  45.1    0.004
  sp|Q8KAE4|Y2219_CHLTE Macro domain-containing protein CT2219 OS...  44.7    0.004
  sp|Q985D2|Y7730_RHILO Macro domain-containing protein mll7730 O...  44.7    0.004
  sp|Q93SX7|Y189_ACISE Macro domain-containing protein OS=Acineto...  44.3    0.006
  sp|Q88SK6|Y3408_LACPL Macro domain-containing protein lp_3408 O...  43.9    0.009
  sp|O59182|Y1513_PYRHO Uncharacterized protein PH1513 OS=Pyrococ...  43.5    0.013
  sp|Q9V0Y3|Y656_PYRAB Uncharacterized protein PYRAB06560 OS=Pyro...  43.1    0.016
  sp|P27283|POLN_SINDO Polyprotein P1234 OS=Sindbis virus subtype...  45.4    0.018
  sp|Q8P5Z8|Y3184_XANCP Macro domain-containing protein XCC3184 O...  42.7    0.020
  sp|Q8PHB6|Y3343_XANAC Macro domain-containing protein XAC3343 O...  42.7    0.021
  sp|Q99IE7|POLN_RUBVO Non-structural polyprotein p200 OS=Rubella...  44.7    0.027
  sp|Q99IE5|POLN_RUBVV Non-structural polyprotein p200 OS=Rubella...  44.7    0.027
  sp|Q9HJ67|Y1105_THEAC Uncharacterized protein Ta1105 OS=Thermop...  42.7    0.027
  sp|Q6X2U2|POLN_RUBVC Non-structural polyprotein p200 OS=Rubella...  44.3    0.034
  sp|Q6X2U4|POLN_RUBVB Non-structural polyprotein p200 OS=Rubella...  44.3    0.038
  sp|Q86924|POLN_AURAV Polyprotein P1234 OS=Aura virus OX=44158 P...  43.9    0.046
  sp|Q6PAV8|MACD2_XENLA ADP-ribose glycohydrolase MACROD2 OS=Xeno...  43.1    0.054
  sp|Q9BQ69|MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo...  42.7    0.057
  sp|Q9ZBG3|Y6450_STRCO Macro domain-containing protein SCO6450 O...  41.2    0.071
  sp|Q86500|POLN_RUBVM Non-structural polyprotein p200 OS=Rubella...  42.7    0.11 
  sp|Q9J6K9|POLN_RUBVD Non-structural polyprotein p200 OS=Rubella...  42.7    0.11 
  sp|Q8K4G6|MACD1_RAT ADP-ribose glycohydrolase MACROD1 (Fragment...  41.6    0.11 
  sp|P03317|POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=1103...  42.4    0.14 
  sp|Q306W6|POLN_EEEV1 Polyprotein P1234 OS=Eastern equine enceph...  42.4    0.14 
  sp|O28751|Y1521_ARCFU ADP-ribose glycohydrolase AF_1521 OS=Arch...  40.4    0.15 
  sp|Q44020|YGB2_CUPNE Macro domain-containing protein in gbd 3'r...  40.0    0.17 
  sp|Q2KHU5|MACD1_BOVIN ADP-ribose glycohydrolase MACROD1 OS=Bos ...  40.8    0.21 
  sp|Q9YBE9|Y1648_AERPE Uncharacterized protein APE_1648.1 OS=Aer...  40.0    0.21 
  sp|P13896|POLN_WEEV Polyprotein P1234 OS=Western equine encepha...  41.2    0.33 
  sp|Q9VHM2|VP35L_DROME VPS35 endosomal protein sorting factor-li...  40.8    0.34 
  sp|Q306W8|POLN_EEEV8 Polyprotein P1234 OS=Eastern equine enceph...  40.4    0.62 
  sp|Q922B1|MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus ...  39.3    0.81 
  sp|Q9HXU7|Y3693_PSEAE Macro domain-containing protein PA3693 OS...  38.1    0.86 
  sp|Q9RUV0|PPDE_DEIRA Phosphatase/phosphodiesterase DR_1281 OS=D...  37.7    1.9  
  sp|Q4QXJ8|POLN_EEEVF Polyprotein P1234 OS=Eastern equine enceph...  38.5    2.1  
  sp|P26627|R1AB_CVMJD Replicase polyprotein 1ab (Fragment) OS=Mu...  38.1    2.3  
  sp|Q9KHE2|Y189_STRGR Macro domain-containing protein in non 5'r...  36.6    2.4  
  sp|Q7TZB9|Y1934_MYCBO Uncharacterized protein Mb1934c OS=Mycoba...  37.7    2.4  
  sp|P9WK29|Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycoba...  37.7    2.4  
  sp|P9WK28|Y1899_MYCTO Uncharacterized protein MT1950 OS=Mycobac...  37.7    2.5  
  sp|Q8Y3S3|Y2759_LISMO Macro domain-containing protein lmo2759 O...  36.2    3.2  
  sp|Q926Y8|Y2902_LISIN Macro domain-containing protein lin2902 O...  36.2    3.3  
  sp|Q3UYG8|MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus ...  37.4    3.5  
  sp|B4S3G9|PDXJ_PROA2 Pyridoxine 5'-phosphate synthase OS=Prosth...  36.6    3.7  
  sp|A1Z1Q3|MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo...  37.0    4.1  
  sp|Q71W03|Y2748_LISMF Macro domain-containing protein LMOf2365_...  35.8    4.5  
  sp|P43349|TCTP_SOLTU Translationally-controlled tumor protein h...  35.0    7.5  


> sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1
Length=4405

 Score = 9175 bits (23807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 4405/4405 (100%), Positives = 4405/4405 (100%), Gaps = 0/4405 (0%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
Sbjct  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
Sbjct  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
Sbjct  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
Sbjct  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
Sbjct  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
Sbjct  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
Sbjct  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
Sbjct  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
Sbjct  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
Sbjct  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
             GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
Sbjct  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
Sbjct  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840
             TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
Sbjct  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840

Query  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900
             ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
Sbjct  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900

Query  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960
             SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
Sbjct  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960

Query  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020
             EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
Sbjct  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020

Query  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080
             QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
Sbjct  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080

Query  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140
             NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
Sbjct  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140

Query  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200
             HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
Sbjct  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200

Query  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260
             QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
Sbjct  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260

Query  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320
             GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
Sbjct  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320

Query  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380
             PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
Sbjct  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380

Query  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440
             HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
Sbjct  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440

Query  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500
             LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
Sbjct  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500

Query  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560
             FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
Sbjct  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560

Query  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
Sbjct  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620

Query  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
             LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
Sbjct  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680

Query  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740
             LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
Sbjct  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740

Query  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800
             LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
Sbjct  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800

Query  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860
             ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
Sbjct  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860

Query  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920
             GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
Sbjct  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920

Query  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980
             PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
Sbjct  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980

Query  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040
             KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
Sbjct  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040

Query  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
             CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
Sbjct  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100

Query  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160
             DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
Sbjct  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160

Query  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220
             LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
Sbjct  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220

Query  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280
             PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
Sbjct  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280

Query  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340
             YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
Sbjct  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340

Query  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
             LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
Sbjct  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
             VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
Sbjct  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
Sbjct  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520

Query  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580
             FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
Sbjct  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580

Query  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640
             GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
Sbjct  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640

Query  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700
             FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
Sbjct  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700

Query  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760
             AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
Sbjct  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760

Query  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820
             KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
Sbjct  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820

Query  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880
             ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
Sbjct  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880

Query  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940
             FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
Sbjct  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940

Query  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000
             GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
Sbjct  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000

Query  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060
             SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
Sbjct  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060

Query  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120
             AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
Sbjct  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120

Query  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180
             SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
Sbjct  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180

Query  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240
             CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
Sbjct  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240

Query  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300
             FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
Sbjct  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300

Query  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360
             CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
Sbjct  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360

Query  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420
             TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
Sbjct  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420

Query  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480
             SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
Sbjct  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480

Query  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540
             WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
Sbjct  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540

Query  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600
             GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
Sbjct  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600

Query  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660
             SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
Sbjct  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660

Query  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720
             MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
Sbjct  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720

Query  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780
             VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
Sbjct  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780

Query  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840
             LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
Sbjct  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840

Query  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900
             NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
Sbjct  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900

Query  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960
             AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
Sbjct  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960

Query  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020
             QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
Sbjct  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020

Query  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080
             KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
Sbjct  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080

Query  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140
             KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Sbjct  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140

Query  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200
             NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
Sbjct  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200

Query  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260
             GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
Sbjct  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260

Query  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320
             PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
Sbjct  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320

Query  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380
             FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
Sbjct  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380

Query  4381  CSCDQLREPMLQSADAQSFLNGFAV  4405
             CSCDQLREPMLQSADAQSFLNGFAV
Sbjct  4381  CSCDQLREPMLQSADAQSFLNGFAV  4405


> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score = 9137 bits (23709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 4401/4401 (100%), Positives = 4401/4401 (100%), Gaps = 0/4401 (0%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
Sbjct  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
Sbjct  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
Sbjct  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
Sbjct  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
Sbjct  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
Sbjct  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
Sbjct  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
Sbjct  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
Sbjct  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
Sbjct  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
             GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
Sbjct  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
Sbjct  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840
             TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
Sbjct  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840

Query  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900
             ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
Sbjct  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900

Query  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960
             SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
Sbjct  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960

Query  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020
             EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
Sbjct  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020

Query  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080
             QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
Sbjct  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080

Query  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140
             NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
Sbjct  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140

Query  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200
             HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
Sbjct  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200

Query  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260
             QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
Sbjct  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260

Query  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320
             GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
Sbjct  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320

Query  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380
             PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
Sbjct  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380

Query  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440
             HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
Sbjct  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440

Query  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500
             LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
Sbjct  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500

Query  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560
             FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
Sbjct  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560

Query  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
Sbjct  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620

Query  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
             LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
Sbjct  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680

Query  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740
             LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
Sbjct  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740

Query  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800
             LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
Sbjct  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800

Query  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860
             ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
Sbjct  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860

Query  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920
             GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
Sbjct  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920

Query  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980
             PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
Sbjct  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980

Query  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040
             KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
Sbjct  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040

Query  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
             CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
Sbjct  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100

Query  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160
             DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
Sbjct  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160

Query  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220
             LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
Sbjct  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220

Query  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280
             PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
Sbjct  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280

Query  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340
             YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
Sbjct  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340

Query  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
             LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
Sbjct  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
             VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
Sbjct  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
Sbjct  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520

Query  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580
             FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
Sbjct  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580

Query  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640
             GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
Sbjct  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640

Query  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700
             FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
Sbjct  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700

Query  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760
             AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
Sbjct  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760

Query  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820
             KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
Sbjct  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820

Query  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880
             ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
Sbjct  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880

Query  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940
             FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
Sbjct  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940

Query  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000
             GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
Sbjct  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000

Query  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060
             SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
Sbjct  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060

Query  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120
             AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
Sbjct  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120

Query  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180
             SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
Sbjct  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180

Query  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240
             CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
Sbjct  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240

Query  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300
             FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
Sbjct  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300

Query  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360
             CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
Sbjct  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360

Query  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420
             TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
Sbjct  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420

Query  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480
             SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
Sbjct  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480

Query  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540
             WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
Sbjct  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540

Query  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600
             GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
Sbjct  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600

Query  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660
             SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
Sbjct  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660

Query  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720
             MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
Sbjct  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720

Query  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780
             VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
Sbjct  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780

Query  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840
             LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
Sbjct  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840

Query  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900
             NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
Sbjct  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900

Query  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960
             AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
Sbjct  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960

Query  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020
             QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
Sbjct  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020

Query  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080
             KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
Sbjct  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080

Query  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140
             KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Sbjct  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140

Query  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200
             NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
Sbjct  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200

Query  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260
             GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
Sbjct  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260

Query  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320
             PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
Sbjct  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320

Query  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380
             FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
Sbjct  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380

Query  4381  CSCDQLREPMLQSADAQSFLN  4401
             CSCDQLREPMLQSADAQSFLN
Sbjct  4381  CSCDQLREPMLQSADAQSFLN  4401


> sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coronavirus 
OX=694009 GN=1a PE=1 SV=1
Length=4382

 Score = 7509 bits (19483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3544/4412 (80%), Positives = 3942/4412 (89%), Gaps = 37/4412 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA +  HGH +VELVAE++GIQYGRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYG DLKS+DLGDELGTDP ED+++NWNTKH SG  REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A TRYVDNNFCGPDGYPL+CIKD LARAGK+ CTLSEQLD+I++KRGVYCCR+HEHEIAW
Sbjct  181   AVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERS+KSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASP ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + E+GPEHS+A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASA+IG  HTG+ G+  E LN++LLEIL +E+VNINIVGDF LNEE+AIILASF
Sbjct  421   AYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAF++T+K LDYK+FK IVESCGN+KVTKGK  KGAWNIG+Q+S+L+PL  F S+A
Sbjct  481   SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIF+RTL+ A +S+  LQ+AA+TILDGIS+ SLRL+DAM++TSDL TN++++MAY
Sbjct  541   AGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ TSQWL+N+ GT  EKL+P+ +W+E K   GVEFL+D WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  IK+ V+ F  +VNK L +C D + I GAKL++LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG++  T + +EEVVLK G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVC+NGLMLLEIKD E+YCAL+P ++ TNN F LKGGAP K VTFG+DTV EVQGYK+V
Sbjct  781   TPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   RITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQ-YEYGTEDDYQGK  958
             WS+AT+YLFD++GE   +S MYCSFYPPDE+EE+    EEE    T  +EYGTEDDYQG 
Sbjct  901   WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGL  960

Query  959   PLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTP  1018
             PLEFGA++  ++ EEE+EEDWLDD ++Q+                   E+          
Sbjct  961   PLEFGASAETVRVEEEEEEDWLDDTTEQS-------------------EI-----EPEPE  996

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
                   VN F+GYLKLTDNV IK  DIV+EA+   P V+VNAAN++LKHGGGVAGALNKA
Sbjct  997   PTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKA  1056

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENF  1138
             TN AMQ ESDDYI  NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENF
Sbjct  1057  TNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENF  1116

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQ  1198
             N  ++LLAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V  +L+    + 
Sbjct  1117  NSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPR-  1175

Query  1199  VEQKIAEIPKEEVKPFITESK---PSVEQRKQDDK-KIKACVEEVTTTLEETKFLTENLL  1254
                   E PK+E  P   +SK    SV Q+  D K KIKAC++EVTTTLEETKFLT  LL
Sbjct  1176  -----VEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLL  1230

Query  1255  LYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLA  1314
             L+ DING L+ DS  ++   D++FL+KDAPY+VGDV+  G +T VVIP+KKAGGTTEML+
Sbjct  1231  LFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLS  1290

Query  1315  KALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWN  1374
             +AL+KVP D YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   N K+EILGTVSWN
Sbjct  1291  RALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWN  1350

Query  1375  LREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASL  1434
             LREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIKIQEG+VDYG RF+FYTSK  VAS+
Sbjct  1351  LREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASI  1410

Query  1435  INTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS  1494
             I  LN LNE LVTMP+GYVTHG NLEEAAR MRSLK PA VSVSSPDAVT YNGYLTSSS
Sbjct  1411  ITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSS  1470

Query  1495  KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGEVITF  1553
             KT EEHF+ET+SLAGSY+DWSYSGQ T+LG+EFLKRGDK VY+T  +P  FHLDGEV++ 
Sbjct  1471  KTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSL  1530

Query  1554  DNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSH  1613
             D LK+LLSLREV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +H
Sbjct  1531  DKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNH  1590

Query  1614  EGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN  1673
             EGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN
Sbjct  1591  EGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNN  1650

Query  1674  CYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMS  1733
             CYL++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM+
Sbjct  1651  CYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMT  1710

Query  1734  YLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQA  1793
             +L QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+  K GV IPC CG+ A
Sbjct  1711  HLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDA  1770

Query  1794  TKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALL  1853
             T+YLVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA L
Sbjct  1771  TQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHL  1830

Query  1854  TKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPID  1913
             TK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV  TEI+PKLD YYKKDN+Y+TEQPID
Sbjct  1831  TKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPID  1890

Query  1914  LVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYK  1973
             LVP QP PNASFDNFK  C N KFADDLNQ+TG+ KPASREL VTFFPDLNGDVVAIDY+
Sbjct  1891  LVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYR  1950

Query  1974  HYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDA  2033
             HY+ SFKKGAKLLHKPIVWH+N AT K T+KPNTWC+RCLWSTKPV+TSNSF+VL  ED 
Sbjct  1951  HYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDT  2010

Query  2034  QGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHT  2093
             QGMDNLACE  +P SEEVVENPTIQK+V+EC+VKTTEVVG++ILKP++  +K+T+E+GH 
Sbjct  2011  QGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHE  2070

Query  2094  DLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTT  2153
             DLMAAYV+N+S+TIKKPNELS  LGLKT+ATHG+AA+NSVPW  I  Y KPFL +   TT
Sbjct  2071  DLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITT  2130

Query  2154  TNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEA  2213
             +N   R   RV  NYMPY FTLL QLCTFT+STNSRI+AS+PTTIAKN+VKSV K CL+A
Sbjct  2131  SNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDA  2190

Query  2214  SFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNS  2273
               NY+KSP FSKL  I +W LLLS+CLGSLI  TAA GVL+SN G PSYC G RE YLNS
Sbjct  2191  GINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNS  2250

Query  2274  TNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYIL  2333
             +NVT   +C GS PCS+CLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEW LAY+L
Sbjct  2251  SNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYML  2310

Query  2334  FTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYV  2393
             FT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYY+
Sbjct  2311  FTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYI  2370

Query  2394  WKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCV  2453
             WKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HNWNC+
Sbjct  2371  WKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCL  2430

Query  2454  NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTY  2513
             NCDTFC GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSV VKNG++HLYFDKAGQKTY
Sbjct  2431  NCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTY  2490

Query  2514  ERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLD  2573
             ERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES++KSASVYYSQLMCQPILLLD
Sbjct  2491  ERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLD  2550

Query  2574  QALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTF  2633
             QALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLSTF
Sbjct  2551  QALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTF  2610

Query  2634  ISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACID  2693
             +SAARQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLGACID
Sbjct  2611  VSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACID  2670

Query  2694  CSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNV  2753
             C+ARHINAQVAKSHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVNV
Sbjct  2671  CNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNV  2730

Query  2754  VTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAID  2813
             +TTKI+LKGGKIV+   K ++K TL+ +  A + Y++ PVH +S H  +++EIIGYKAI 
Sbjct  2731  ITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQ  2790

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTI  2873
              GVTRDI STD CFANKHA FD WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGLPGT+
Sbjct  2791  DGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTV  2850

Query  2874  LRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYC  2933
             LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKPVPYC
Sbjct  2851  LRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYC  2910

Query  2934  YDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSE  2993
             YDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTCERSE
Sbjct  2911  YDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSE  2970

Query  2994  AGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIV  3053
              G+C+STSGRWVLNN++YR+L GVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI+
Sbjct  2971  VGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGII  3030

Query  3054  AIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLT  3113
             AI+VTC AYYFM+FRR FGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYSV YLYLT
Sbjct  3031  AILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLT  3090

Query  3114  FYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFS  3173
             FY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KH +WFF+NYL++RV+FNGV+FS
Sbjct  3091  FYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFS  3150

Query  3174  TFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCH  3233
             TFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACCH
Sbjct  3151  TFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCH  3210

Query  3234  LAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3293
             LAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL
Sbjct  3211  LAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3270

Query  3294  WLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLK  3353
             WLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+LK
Sbjct  3271  WLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLK  3330

Query  3354  VDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGF  3413
             VDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVGF
Sbjct  3331  VDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGF  3390

Query  3414  NIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYA  3473
             NIDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLYA
Sbjct  3391  NIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA  3450

Query  3474  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKE  3533
             AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LKE
Sbjct  3451  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKE  3510

Query  3534  LLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLV  3593
             LLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LTSLL+
Sbjct  3511  LLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLI  3570

Query  3594  LVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMV  3653
             LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNMV
Sbjct  3571  LVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMV  3630

Query  3654  YMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMN  3713
             YMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLLILMTARTVYDD ARRVWTLMN
Sbjct  3631  YMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMN  3690

Query  3714  VLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITG  3773
             V+TLVYKVYYGNALDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FITG
Sbjct  3691  VITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITG  3750

Query  3774  NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKN  3833
             NTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK+
Sbjct  3751  NTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKS  3810

Query  3834  SIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ  3893
             SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ
Sbjct  3811  SIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ  3870

Query  3894  LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPS  3953
             LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDIN+LCEEMLDNRATLQAIASEFSSLPS
Sbjct  3871  LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPS  3930

Query  3954  YAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY  4013
             YAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY
Sbjct  3931  YAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY  3990

Query  4014  KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV  4073
             KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV
Sbjct  3991  KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV  4050

Query  4074  IPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA  4133
             +PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRA
Sbjct  4051  VPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRA  4110

Query  4134  NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKW  4193
             NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD QDLKW
Sbjct  4111  NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKW  4170

Query  4194  ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ  4253
             ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Sbjct  4171  ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ  4230

Query  4254  AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
             AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE
Sbjct  4231  AGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4290

Query  4314  ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVC  4373
             ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVC
Sbjct  4291  ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVC  4350

Query  4374  GMWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
             GMWKGYGCSCDQLREP++QSADA +FLNGFAV
Sbjct  4351  GMWKGYGCSCDQLREPLMQSADASTFLNGFAV  4382


> sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=1a PE=3 SV=1
Length=4380

 Score = 7477 bits (19401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3523/4413 (80%), Positives = 3936/4413 (89%), Gaps = 41/4413 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK GTCG+VE+EKGV
Sbjct  1     MESLVLGINEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKSGTCGIVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQ EQPYVFIKRSDA+   HGH + ELVAEL+G+QYGRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQPEQPYVFIKRSDAQGTDHGHRVRELVAELDGVQYGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHS+G DLKS+DLGDELGTDP ED+++NWNTKH SGV REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGVLRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A TRYVDNNFCGPDGYPLECIKDLLARAGK+ CTLSEQLD+I++KRGVYCCR+H HEIAW
Sbjct  181   ALTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCRDHGHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERS+KSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG  TCGYL
Sbjct  301   RSVYPVATPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVSEGPNTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + E+GPEHS A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEIGPEHSAADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASA+IG  HTG+ G+  E LN++LLEIL +E+VNINIVGDF+LNEE+AIILASF
Sbjct  421   AYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFQLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAF++T+K LDYK+FK IVESCGN+KVTKGK  KGAWNIG+ +S+L+PL  F S+A
Sbjct  481   SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPIKGAWNIGQHRSVLTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIFSRTL+ A +S+  LQ+AA+TILD IS+ SLRL+DAM++TS+L TN++++MAY
Sbjct  541   AGVIRSIFSRTLDAANHSIPDLQRAAVTILDSISEQSLRLVDAMVYTSNLLTNSVIIMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ TSQWL+N+  T  EKL+P+  W+E K   GVEFL+D WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQTSQWLSNLLDTTVEKLRPIFAWIEAKLSAGVEFLKDAWEILKFLITGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  IK+ V+ F  +VNK L +C D + I GAKL++LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNIKDCVKCFVDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG++  T + +EEVVLK G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAVVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVCINGLMLLEIK  E+YCAL+P ++ TNN F LKGGAPTK VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCINGLMLLEIKANEQYCALSPGLLATNNVFRLKGGAPTKGVTFGEDTVVEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   RITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEP--STQYEYGTEDDYQG  957
             WS+AT+YLFD+SGE KL+S MYCSFYPPDE+E+  + EEEE     + ++EYGTE+DY+G
Sbjct  901   WSVATFYLFDDSGEEKLSSRMYCSFYPPDEEEDCEEYEEEEEVSERTCEHEYGTEEDYKG  960

Query  958   KPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELT  1017
              PLEFGA++  +Q EE++EEDWLDD  +     +                          
Sbjct  961   LPLEFGASTDIIQVEEQEEEDWLDDAVEAEPEPE--------------------------  994

Query  1018  PVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNK  1077
               +    VN  +GYLKLTDNV IK  DIVEEA+   P V+VNAAN++LKHGGGVAGALNK
Sbjct  995   -PLHEEPVNQLTGYLKLTDNVAIKCVDIVEEAQNANPMVIVNAANIHLKHGGGVAGALNK  1053

Query  1078  ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYEN  1137
             ATN AMQ ESD YI  NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYEN
Sbjct  1054  ATNGAMQKESDHYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYEN  1113

Query  1138  FNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEK  1197
             FN  ++LLAPLLSAGIFGA P+ SL++CV TVRT VY+ V DK LY+++V  +L+    K
Sbjct  1114  FNSQDILLAPLLSAGIFGAKPLQSLQMCVQTVRTQVYIVVNDKVLYEQVVMDYLDSLKPK  1173

Query  1198  QVEQKIAEIPKEEVKP---FITESKPSVEQRKQDDK-KIKACVEEVTTTLEETKFLTENL  1253
                    E PK+EV P   +    + SV Q+  D K KIKAC++EVTTTLEETKFLT  L
Sbjct  1174  ------VEAPKQEVLPKAEYPKVDEKSVVQKTIDVKPKIKACIDEVTTTLEETKFLTNKL  1227

Query  1254  LLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEML  1313
             LL+ DING L+ DS  ++   D++FL+KDAPY+VGDV+  G +T VVIP+KKAGGTTEML
Sbjct  1228  LLFTDINGKLYQDSKNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEML  1287

Query  1314  AKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSW  1373
             ++AL+KVP + YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   N K+EILGTVSW
Sbjct  1288  SRALKKVPINEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSETPNAKEEILGTVSW  1347

Query  1374  NLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVAS  1433
             NLREMLAHAEETRKLMPVC++ +AI++TIQRKYKGIKIQEG+VDYG RF+FYTSK  VAS
Sbjct  1348  NLREMLAHAEETRKLMPVCMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVAS  1407

Query  1434  LINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSS  1493
             +I  LN LNE LVTMP+GYVTHG NLEEAAR MRSLK PA VSVSSPDAVT YNGYLTSS
Sbjct  1408  IITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAIVSVSSPDAVTTYNGYLTSS  1467

Query  1494  SKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGEVIT  1552
             SKT E+HF+ET+SLAGSY+DWSYSGQ T+LG+EFLKRG+K VY+T  +P  FHLDGEV+ 
Sbjct  1468  SKTSEDHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGEKIVYHTLESPVKFHLDGEVLP  1527

Query  1553  FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNS  1612
              D LK+LLSLREV+TIKVFTTVDN NLHTQ+VDMSMTYGQQ GPTYL+GADVTKIKPH +
Sbjct  1528  LDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQLGPTYLEGADVTKIKPHVN  1587

Query  1613  HEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADN  1672
             HEGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADN
Sbjct  1588  HEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADN  1647

Query  1673  NCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETM  1732
             NCYL++ LL LQQIE+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM
Sbjct  1648  NCYLSSVLLALQQIEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETM  1707

Query  1733  SYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQ  1792
             ++L QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+  K GV IPC CG+ 
Sbjct  1708  THLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKMGVSIPCVCGRD  1767

Query  1793  ATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGAL  1852
             AT+YLVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA 
Sbjct  1768  ATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAH  1827

Query  1853  LTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPI  1912
             LTK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV  TEI+PKLD YYKKDN+Y+TEQPI
Sbjct  1828  LTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPI  1887

Query  1913  DLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDY  1972
             DL+P QP PNASFDNFK  C N KFADDLNQ+TG+ KPASREL VTFFPDLNGDVVAIDY
Sbjct  1888  DLIPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDY  1947

Query  1973  KHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSED  2032
             +HY+ SFKKGAKLLHKPIVWH+N AT K T+KPNTWC+RCLWSTKPV+TSNSF+VL  ED
Sbjct  1948  RHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVED  2007

Query  2033  AQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGH  2092
              QGMDNLACE  +P  EEVVENPTIQK+V+EC+VKTTEVVG++ILKP++  +K+T+E+ H
Sbjct  2008  TQGMDNLACESQQPTPEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELDH  2067

Query  2093  TDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVST  2152
              DLMAAYV+N+S+TIKKPNELS  LGLKT+ATHG+AA+NSVPW  I  Y KPFL +   T
Sbjct  2068  EDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWGKILAYVKPFLGQAAVT  2127

Query  2153  TTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLE  2212
             T+N   R + R+  NYMPY  TLL QLCTFT+STNSRI+AS+PTTIAKN+V+ + + CL+
Sbjct  2128  TSNCAKRLVQRMFNNYMPYVLTLLFQLCTFTKSTNSRIRASLPTTIAKNSVRGIVRLCLD  2187

Query  2213  ASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLN  2272
             A  NY+KSP FSKL  I +W LLLS+CLGSLIY TAALGVL+SN G PSYC+G RE YLN
Sbjct  2188  AGINYVKSPKFSKLFTIAMWLLLLSICLGSLIYVTAALGVLLSNFGAPSYCSGVRESYLN  2247

Query  2273  STNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYI  2332
             S+NVT   +C GS PCSVCLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEWF AY+
Sbjct  2248  SSNVTTMDFCEGSFPCSVCLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWFFAYM  2307

Query  2333  LFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYY  2392
             LFT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYY
Sbjct  2308  LFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYY  2367

Query  2393  VWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNC  2452
             +WKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HNWNC
Sbjct  2368  IWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNC  2427

Query  2453  VNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKT  2512
             +NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSY+VDSV VKNG++HLYFDKAGQKT
Sbjct  2428  LNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYVVDSVAVKNGALHLYFDKAGQKT  2487

Query  2513  YERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLL  2572
             YERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES+AKSASVYYSQLMCQPILLL
Sbjct  2488  YERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESAAKSASVYYSQLMCQPILLL  2547

Query  2573  DQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLST  2632
             DQALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLST
Sbjct  2548  DQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLST  2607

Query  2633  FISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACI  2692
             F+SA+RQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLGACI
Sbjct  2608  FVSASRQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACI  2667

Query  2693  DCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVN  2752
             DC+ARHINAQVA+SHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVN
Sbjct  2668  DCNARHINAQVARSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVN  2727

Query  2753  VVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAI  2812
             V+TTKI+LKGGKIV+ W K ++K TL+ +  A + Y++ PVH++S H  +++EIIGYKAI
Sbjct  2728  VITTKISLKGGKIVSTWFKIMLKATLLCVLAALVCYIVMPVHILSVHGGYTNEIIGYKAI  2787

Query  2813  DGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGT  2872
               GVTRDI STD CFANKHA FD+WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGLPGT
Sbjct  2788  QDGVTRDIVSTDDCFANKHAGFDSWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGT  2847

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DF+TSACVLAAECTIFKDA GKPVPY
Sbjct  2848  VLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFSTSACVLAAECTIFKDAMGKPVPY  2907

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERS  2992
             CYDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPN YLEGSVRVVTTFD+EYCRHGTCERS
Sbjct  2908  CYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNAYLEGSVRVVTTFDAEYCRHGTCERS  2967

Query  2993  EAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGI  3052
             EAG+C+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI
Sbjct  2968  EAGICLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGI  3027

Query  3053  VAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYL  3112
             +AI+VTC AYYFM+FRRAFGEY+HVVA N  LFLMSFT+LCL P YSFLPGVYSV YLYL
Sbjct  3028  IAILVTCAAYYFMKFRRAFGEYNHVVAANAPLFLMSFTILCLAPAYSFLPGVYSVFYLYL  3087

Query  3113  TFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSF  3172
             TFY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KHF+WFF+NYL++RVVFNGV+F
Sbjct  3088  TFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHFHWFFNNYLRKRVVFNGVTF  3147

Query  3173  STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACC  3232
             STFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACC
Sbjct  3148  STFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACC  3207

Query  3233  HLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3292
             HLAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG
Sbjct  3208  HLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3267

Query  3293  LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKL  3352
             LWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+L
Sbjct  3268  LWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRL  3327

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
             KVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVG
Sbjct  3328  KVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVG  3387

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             FNIDYDCVSFCYMHHMELPT VHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLY
Sbjct  3388  FNIDYDCVSFCYMHHMELPTEVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLY  3447

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK  3532
             AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LK
Sbjct  3448  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALK  3507

Query  3533  ELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLL  3592
             ELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   KR +KGTHHW+LLT LTSLL
Sbjct  3508  ELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKRIVKGTHHWMLLTFLTSLL  3567

Query  3593  VLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNM  3652
             +LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNM
Sbjct  3568  ILVQSTQWSLFFFVYENAFLPFTLGIMAVAACAMLLVKHKHAFLCLFLLPSLATVAYFNM  3627

Query  3653  VYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLM  3712
             VYMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLL+LMTARTVYDD ARRVWTLM
Sbjct  3628  VYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLVLMTARTVYDDAARRVWTLM  3687

Query  3713  NVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFIT  3772
             NV+TLVYKVYYGNALDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FIT
Sbjct  3688  NVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFIT  3747

Query  3773  GNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
             GNTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK
Sbjct  3748  GNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3807

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             +SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV
Sbjct  3808  SSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3867

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
             QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP
Sbjct  3868  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3927

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             SYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDR+AAMQRKLEKMADQAMTQM
Sbjct  3928  SYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRNAAMQRKLEKMADQAMTQM  3987

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV
Sbjct  3988  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4047

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             V+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+M+NS NLAWPLIVTALR
Sbjct  4048  VVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMENSSNLAWPLIVTALR  4107

Query  4133  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLK  4192
             ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD QDLK
Sbjct  4108  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLK  4167

Query  4193  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL  4252
             WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYL+FIKGLNNLNRGMVLGSLAATVRL
Sbjct  4168  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLHFIKGLNNLNRGMVLGSLAATVRL  4227

Query  4253  QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4312
             QAGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP
Sbjct  4228  QAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4287

Query  4313  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV  4372
             EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV
Sbjct  4288  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV  4347

Query  4373  CGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
             CGMWKGYGCSCDQLREPM+QSADA +FLNGFAV
Sbjct  4348  CGMWKGYGCSCDQLREPMMQSADASTFLNGFAV  4380


> sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus 
HKU3 OX=442736 GN=1a PE=3 SV=1
Length=4376

 Score = 7475 bits (19396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3536/4411 (80%), Positives = 3930/4411 (89%), Gaps = 41/4411 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA +  HGH +VELVAEL+GIQ+GRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQLEQPYVFIKRSDALSTNHGHKVVELVAELDGIQFGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHS+G DLKS+DLGDELGTDP ED+++NWNTKH SG  REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
               TRYVDNNFCGPDGYPLECIKD LARAGK+ CTLSEQLD+I++KRGVYCCREHEHEI W
Sbjct  181   VVTRYVDNNFCGPDGYPLECIKDFLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERSEKSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSEKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVATPQECNDMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVCEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + EVGPEHS+A+YHN S ++T LRKGGRT  FGGCVFSYVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEVGPEHSVADYHNHSNIETRLRKGGRTKCFGGCVFSYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIG NHTG+ GE  E LN++LLEIL +E+VNINIVGDF+ NEE+AIILASF
Sbjct  421   AYWVPRASANIGANHTGITGENVETLNEDLLEILNRERVNINIVGDFRFNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SAS SAF+ETVKGLDYK+FK IVESCGN+KVT GK   GAWNIG+Q+SIL+PL  F S+A
Sbjct  481   SASPSAFIETVKGLDYKSFKVIVESCGNYKVTNGKPVTGAWNIGQQRSILTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIFSRTL+ A +S+  LQ+AA+T LDGIS+ SLRL+DAM++TSDL TN++VVMAY
Sbjct  541   AGVIRSIFSRTLDAANHSILDLQRAAVTTLDGISEQSLRLVDAMVYTSDLLTNSVVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ T QWL+N+ GT  +KLKPV  W+E K   GVEFLRD WEI+KF+ T   +++
Sbjct  601   VTGGLVQQTMQWLSNMLGTAVDKLKPVFTWVEAKLSAGVEFLRDAWEILKFLITGVFDVI  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI      IKE V+ F  +VNK L +C D + I G KL+ALNLGE F+  S+GLYR+C
Sbjct  661   KGQIQVATDNIKECVKIFLGVVNKALEMCLDQVTIAGTKLRALNLGEVFIAQSRGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG+   T + +EEVVLK+G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDAHDTVLTSEEVVLKSGELEALETPIDSFTSGAVVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVCINGLMLLE+++ E+YCAL+P ++ TNN F LKGGAP K VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCINGLMLLELENKEQYCALSPGLLATNNVFRLKGGAPVKGVTFGEDTVLEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELD R+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLTP+GIDLDE
Sbjct  841   KITFELDVRVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTPMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKP  959
             WS+AT+YLFD++GE KL+S MYCSFYPPDE+E+    E E+ E + ++EYGTEDDY+G P
Sbjct  901   WSVATFYLFDDAGEEKLSSRMYCSFYPPDEEEDCE--ECEDEEETCEHEYGTEDDYKGLP  958

Query  960   LEFGATSAALQ-PEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTP  1018
             LEFGA++      EEE+EEDWLDD  +     +                           
Sbjct  959   LEFGASTETPHVEEEEEEEDWLDDAIEAEPEPE---------------------------  991

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
              +    VN F GYLKLTDNV IK  DIV+EA+  KPTV+VNAAN +LKHGGGVAGALNKA
Sbjct  992   PLPEEPVNQFVGYLKLTDNVAIKCIDIVKEAQSAKPTVIVNAANTHLKHGGGVAGALNKA  1051

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENF  1138
             TN AMQ ESD+YI  NGPL VGGSC+LSGHNLA+ CLHVVGPN+N GED+QLLK AYENF
Sbjct  1052  TNGAMQNESDEYIRQNGPLTVGGSCLLSGHNLAEKCLHVVGPNLNAGEDVQLLKRAYENF  1111

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQ  1198
             N  +VLLAPLLSAGIFGA P+ SL++CV+ VRT VYLAV DK+LYD++V  +L+    K 
Sbjct  1112  NSQDVLLAPLLSAGIFGAKPLQSLKMCVEIVRTQVYLAVNDKSLYDQIVLDYLDSLKPK-  1170

Query  1199  VEQKIAEIPKEEVKPFITES---KPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLL  1255
                   E P +E +P + E    +P  E+      KIKAC++EVTTTLEETKFLT  LLL
Sbjct  1171  -----VESPNKEEEPKLEEPKAVQPVAEKPVDVKPKIKACIDEVTTTLEETKFLTNKLLL  1225

Query  1256  YIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAK  1315
             + DING L+ DS  ++   D++FL+KDAPYIVGDV+  G +T V+IP KK+GGTTEMLA+
Sbjct  1226  FADINGKLYQDSQNMLRGEDMSFLEKDAPYIVGDVITSGDITCVIIPAKKSGGTTEMLAR  1285

Query  1316  ALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNL  1375
             AL++VP   YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   NEK+E+LGTVSWNL
Sbjct  1286  ALKEVPVAEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSETPNEKEEVLGTVSWNL  1345

Query  1376  REMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLI  1435
             REMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK+QEG+VDYG RF+FYTSK  VAS+I
Sbjct  1346  REMLAHAEETRKLMPICLDVRAIMATIQRKYKGIKVQEGIVDYGVRFFFYTSKEPVASII  1405

Query  1436  NTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSK  1495
               LN LNE LVTMP+GYVTHGLNLEEAAR MRSLK PA VSVSSPDAVTAYNGYLTSSSK
Sbjct  1406  TKLNSLNEPLVTMPIGYVTHGLNLEEAARCMRSLKAPAVVSVSSPDAVTAYNGYLTSSSK  1465

Query  1496  TPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTS-NPTTFHLDGEVITFD  1554
             TPEE+F+ET SLAGSY+DWSYSGQ T+LG+EFLKRGDK VY+T+ +P  FHLDGEV+  D
Sbjct  1466  TPEEYFVETTSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTTGSPIEFHLDGEVLPLD  1525

Query  1555  NLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHE  1614
              LK+LLSLREV+TIKVFTTVDN NLHT +VDMSMTYGQQFGPTYLDGADVTKIKPH +HE
Sbjct  1526  KLKSLLSLREVKTIKVFTTVDNTNLHTHIVDMSMTYGQQFGPTYLDGADVTKIKPHVNHE  1585

Query  1615  GKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNC  1674
             GKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNC
Sbjct  1586  GKTFFVLPSDDTLRSEAFEYYHTIDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNC  1645

Query  1675  YLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSY  1734
             YL++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++
Sbjct  1646  YLSSVLLALQQVEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTH  1705

Query  1735  LFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQAT  1794
             L QHANL+S KRVLNVVCK CGQ+ TTLKGVEAVMYMGTLSY++ K GV IPC CG+ AT
Sbjct  1706  LLQHANLESAKRVLNVVCKHCGQKTTTLKGVEAVMYMGTLSYDELKTGVSIPCVCGRNAT  1765

Query  1795  KYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLT  1854
             +YLVQQES FVMMSAPPA+Y+L+ G F CA+EYTGNYQCGHY HIT+KETLY +DGA LT
Sbjct  1766  QYLVQQESSFVMMSAPPAEYKLQQGAFLCANEYTGNYQCGHYTHITAKETLYRVDGAHLT  1825

Query  1855  KSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL  1914
             K SEYKGP+TDVFYKE SYTT IKPV+YKLDGV  TEI+PKLD YYKK N+Y+TEQPIDL
Sbjct  1826  KMSEYKGPVTDVFYKETSYTTAIKPVSYKLDGVTYTEIEPKLDGYYKKGNAYYTEQPIDL  1885

Query  1915  VPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKH  1974
             VP QP PNASFDNFK  C N KFADDLNQ+TG+KKPASREL VTFFPDLNGDVVAIDY+H
Sbjct  1886  VPTQPMPNASFDNFKLTCSNTKFADDLNQMTGFKKPASRELTVTFFPDLNGDVVAIDYRH  1945

Query  1975  YTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQ  2034
             Y+ SFKKGAKL+HKPI+WH+N  TNK TYKPN WC+RCLWSTKPV+TSNSF+VL  ED Q
Sbjct  1946  YSTSFKKGAKLVHKPILWHINQTTNKTTYKPNIWCLRCLWSTKPVDTSNSFEVLVVEDTQ  2005

Query  2035  GMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTD  2094
             GMDNLACE     SEEVVENPT+QK+++EC+VKTTEVVG++ILKP+   +K+T+E+GH D
Sbjct  2006  GMDNLACESQTTTSEEVVENPTVQKEIIECDVKTTEVVGNVILKPSEEGVKVTQELGHED  2065

Query  2095  LMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTT  2154
             LMAAYV+ +S+TIKKPNELS  LGLKTLATHG AA+NSVPW  I  Y KPFL +    T+
Sbjct  2066  LMAAYVEETSITIKKPNELSLALGLKTLATHGAAAINSVPWSKILAYVKPFLGQTAVITS  2125

Query  2155  NIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEAS  2214
             N + +C+ RV +NYMPY  TLL QLCTFT+STNSRIKAS+PTTIAKN+VKSV K CL+  
Sbjct  2126  NCIKKCVQRVFSNYMPYVITLLFQLCTFTKSTNSRIKASLPTTIAKNSVKSVAKLCLDVC  2185

Query  2215  FNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNST  2274
              NY+KSP FSKL  I++W LLLS+CLGSL Y TA LGV +S+LG+PSYC G RE Y+NS+
Sbjct  2186  INYVKSPKFSKLFTIVMWLLLLSICLGSLTYVTAVLGVCLSSLGVPSYCDGVRELYINSS  2245

Query  2275  NVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILF  2334
             NVT   +C G  PCSVCLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEW LAY+LF
Sbjct  2246  NVTTMDFCQGYFPCSVCLSGLDSLDSYPALETIQVTISSYKLDLTFLGLAAEWLLAYMLF  2305

Query  2335  TRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVW  2394
             T+FFY+LGL+AIMQ FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYYVW
Sbjct  2306  TKFFYLLGLSAIMQAFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYVW  2365

Query  2395  KSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVN  2454
             KSYVH++DGC SSTCMMCYKRNRATRVECTTIVNGV+RSFYVYANGG+GFCK HNWNC+N
Sbjct  2366  KSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGVKRSFYVYANGGRGFCKAHNWNCLN  2425

Query  2455  CDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYE  2514
             CDTFCAGSTFISDEVARDLSLQFKRPINPTDQS+Y+VDSVTVKNG++HLYFDKAGQKTYE
Sbjct  2426  CDTFCAGSTFISDEVARDLSLQFKRPINPTDQSAYVVDSVTVKNGALHLYFDKAGQKTYE  2485

Query  2515  RHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQ  2574
             RH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES+AKSASVYYSQLMCQPILLLDQ
Sbjct  2486  RHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESAAKSASVYYSQLMCQPILLLDQ  2545

Query  2575  ALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFI  2634
             ALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLSTF+
Sbjct  2546  ALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFV  2605

Query  2635  SAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
             SAARQG VD+DV+TKDV+ECLKLSH SDIEVTGDSCNN+MLTYNKVENMTPRDLGACIDC
Sbjct  2606  SAARQGVVDTDVDTKDVIECLKLSHHSDIEVTGDSCNNFMLTYNKVENMTPRDLGACIDC  2665

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +ARHINAQVAKSHN++L+WNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVNV+
Sbjct  2666  NARHINAQVAKSHNVSLVWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVI  2725

Query  2755  TTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDG  2814
             TTKI+LKGGK+V+ W K L+KVTL+ +  A   Y+I PVH +S H  +++EIIGYKAI  
Sbjct  2726  TTKISLKGGKVVSTWFKLLLKVTLLCVLAALFCYVIMPVHSLSVHDGYTNEIIGYKAIQD  2785

Query  2815  GVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTIL  2874
             GVTRDI STD CFANKHA FD+WFSQRGGSY NDK CP++AA+ITRE+GF+VPGLPGT+L
Sbjct  2786  GVTRDIVSTDDCFANKHAGFDSWFSQRGGSYRNDKNCPVVAAIITREIGFIVPGLPGTVL  2845

Query  2875  RTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCY  2934
             R  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKPVPYCY
Sbjct  2846  RALNGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCY  2905

Query  2935  DTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEA  2994
             DTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTCERSE 
Sbjct  2906  DTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEV  2965

Query  2995  GVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVA  3054
             GVC+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI+A
Sbjct  2966  GVCLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIA  3025

Query  3055  IVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTF  3114
             I+VTC AYYFM+FRRAFGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYS+ YLYLTF
Sbjct  3026  ILVTCAAYYFMKFRRAFGEYNHVVAANALLFLMSFTILCLAPAYSFLPGVYSIFYLYLTF  3085

Query  3115  YLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFST  3174
             Y TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KHF+WFFSNYLK+RV+FNGV+FST
Sbjct  3086  YFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHFHWFFSNYLKKRVMFNGVTFST  3145

Query  3175  FEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL  3234
             FEEAALCTFLLNKEMYL+LRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACCHL
Sbjct  3146  FEEAALCTFLLNKEMYLRLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHL  3205

Query  3235  AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW  3294
             AKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW
Sbjct  3206  AKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW  3265

Query  3295  LDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKV  3354
             LDD VYCPRHV+CT+EDMLNPNY+DLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+LKV
Sbjct  3266  LDDTVYCPRHVVCTAEDMLNPNYDDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKV  3325

Query  3355  DTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFN  3414
             DT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVGFN
Sbjct  3326  DTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFN  3385

Query  3415  IDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAA  3474
             IDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAA
Sbjct  3386  IDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAA  3445

Query  3475  VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKEL  3534
             VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LKEL
Sbjct  3446  VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKEL  3505

Query  3535  LQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVL  3594
             LQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LTSLL+L
Sbjct  3506  LQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLIL  3565

Query  3595  VQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVY  3654
             VQSTQWSLFFF+YENAFLPFA+GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNMVY
Sbjct  3566  VQSTQWSLFFFVYENAFLPFALGIMAVAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVY  3625

Query  3655  MPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNV  3714
             MPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLLILMTARTVYDD ARRVWTLMNV
Sbjct  3626  MPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNV  3685

Query  3715  LTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGN  3774
             +TLVYKVYYGN+LDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FITGN
Sbjct  3686  ITLVYKVYYGNSLDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGN  3745

Query  3775  TLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNS  3834
             TLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK+S
Sbjct  3746  TLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSS  3805

Query  3835  IDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL  3894
             IDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL
Sbjct  3806  IDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL  3865

Query  3895  HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY  3954
             HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY
Sbjct  3866  HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY  3925

Query  3955  AAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYK  4014
             AA+ATAQEAYEQAV+NGDSEVVLKKLKKSLNVAKSEFD DAAMQRKLEKMADQAMTQMYK
Sbjct  3926  AAYATAQEAYEQAVSNGDSEVVLKKLKKSLNVAKSEFDHDAAMQRKLEKMADQAMTQMYK  3985

Query  4015  QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVI  4074
             QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV+
Sbjct  3986  QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVV  4045

Query  4075  PDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN  4134
             PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRAN
Sbjct  4046  PDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN  4105

Query  4135  SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
             SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN  KGGRFVLALLSD QDLKWA
Sbjct  4106  SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNAKGGRFVLALLSDHQDLKWA  4165

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
             RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA
Sbjct  4166  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4225

Query  4255  GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA  4314
             GNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA
Sbjct  4226  GNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA  4285

Query  4315  NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCG  4374
             NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCG
Sbjct  4286  NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCG  4345

Query  4375  MWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
             MWKGYGCSCDQLREPM+QSADA +FLNGFAV
Sbjct  4346  MWKGYGCSCDQLREPMMQSADASTFLNGFAV  4376


> sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS 
coronavirus OX=694009 GN=rep PE=1 SV=1
Length=7073

 Score = 7475 bits (19396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3540/4408 (80%), Positives = 3938/4408 (89%), Gaps = 37/4408 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA +  HGH +VELVAE++GIQYGRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYG DLKS+DLGDELGTDP ED+++NWNTKH SG  REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A TRYVDNNFCGPDGYPL+CIKD LARAGK+ CTLSEQLD+I++KRGVYCCR+HEHEIAW
Sbjct  181   AVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERS+KSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASP ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + E+GPEHS+A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASA+IG  HTG+ G+  E LN++LLEIL +E+VNINIVGDF LNEE+AIILASF
Sbjct  421   AYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAF++T+K LDYK+FK IVESCGN+KVTKGK  KGAWNIG+Q+S+L+PL  F S+A
Sbjct  481   SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIF+RTL+ A +S+  LQ+AA+TILDGIS+ SLRL+DAM++TSDL TN++++MAY
Sbjct  541   AGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ TSQWL+N+ GT  EKL+P+ +W+E K   GVEFL+D WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  IK+ V+ F  +VNK L +C D + I GAKL++LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG++  T + +EEVVLK G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVC+NGLMLLEIKD E+YCAL+P ++ TNN F LKGGAP K VTFG+DTV EVQGYK+V
Sbjct  781   TPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   RITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQ-YEYGTEDDYQGK  958
             WS+AT+YLFD++GE   +S MYCSFYPPDE+EE+    EEE    T  +EYGTEDDYQG 
Sbjct  901   WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGL  960

Query  959   PLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTP  1018
             PLEFGA++  ++ EEE+EEDWLDD ++Q+                   E+          
Sbjct  961   PLEFGASAETVRVEEEEEEDWLDDTTEQS-------------------EI-----EPEPE  996

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
                   VN F+GYLKLTDNV IK  DIV+EA+   P V+VNAAN++LKHGGGVAGALNKA
Sbjct  997   PTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKA  1056

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENF  1138
             TN AMQ ESDDYI  NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYENF
Sbjct  1057  TNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENF  1116

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQ  1198
             N  ++LLAPLLSAGIFGA P+ SL+VCV TVRT VY+AV DK LY+++V  +L+    + 
Sbjct  1117  NSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPR-  1175

Query  1199  VEQKIAEIPKEEVKPFITESK---PSVEQRKQDDK-KIKACVEEVTTTLEETKFLTENLL  1254
                   E PK+E  P   +SK    SV Q+  D K KIKAC++EVTTTLEETKFLT  LL
Sbjct  1176  -----VEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLL  1230

Query  1255  LYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLA  1314
             L+ DING L+ DS  ++   D++FL+KDAPY+VGDV+  G +T VVIP+KKAGGTTEML+
Sbjct  1231  LFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLS  1290

Query  1315  KALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWN  1374
             +AL+KVP D YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   N K+EILGTVSWN
Sbjct  1291  RALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWN  1350

Query  1375  LREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASL  1434
             LREMLAHAEETRKLMP+C++ +AI++TIQRKYKGIKIQEG+VDYG RF+FYTSK  VAS+
Sbjct  1351  LREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASI  1410

Query  1435  INTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS  1494
             I  LN LNE LVTMP+GYVTHG NLEEAAR MRSLK PA VSVSSPDAVT YNGYLTSSS
Sbjct  1411  ITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSS  1470

Query  1495  KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGEVITF  1553
             KT EEHF+ET+SLAGSY+DWSYSGQ T+LG+EFLKRGDK VY+T  +P  FHLDGEV++ 
Sbjct  1471  KTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSL  1530

Query  1554  DNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSH  1613
             D LK+LLSLREV+TIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKPH +H
Sbjct  1531  DKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNH  1590

Query  1614  EGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNN  1673
             EGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNN
Sbjct  1591  EGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNN  1650

Query  1674  CYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMS  1733
             CYL++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM+
Sbjct  1651  CYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMT  1710

Query  1734  YLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQA  1793
             +L QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+  K GV IPC CG+ A
Sbjct  1711  HLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDA  1770

Query  1794  TKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALL  1853
             T+YLVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA L
Sbjct  1771  TQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHL  1830

Query  1854  TKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPID  1913
             TK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV  TEI+PKLD YYKKDN+Y+TEQPID
Sbjct  1831  TKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPID  1890

Query  1914  LVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYK  1973
             LVP QP PNASFDNFK  C N KFADDLNQ+TG+ KPASREL VTFFPDLNGDVVAIDY+
Sbjct  1891  LVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYR  1950

Query  1974  HYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDA  2033
             HY+ SFKKGAKLLHKPIVWH+N AT K T+KPNTWC+RCLWSTKPV+TSNSF+VL  ED 
Sbjct  1951  HYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDT  2010

Query  2034  QGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHT  2093
             QGMDNLACE  +P SEEVVENPTIQK+V+EC+VKTTEVVG++ILKP++  +K+T+E+GH 
Sbjct  2011  QGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHE  2070

Query  2094  DLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTT  2153
             DLMAAYV+N+S+TIKKPNELS  LGLKT+ATHG+AA+NSVPW  I  Y KPFL +   TT
Sbjct  2071  DLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITT  2130

Query  2154  TNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEA  2213
             +N   R   RV  NYMPY FTLL QLCTFT+STNSRI+AS+PTTIAKN+VKSV K CL+A
Sbjct  2131  SNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDA  2190

Query  2214  SFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNS  2273
               NY+KSP FSKL  I +W LLLS+CLGSLI  TAA GVL+SN G PSYC G RE YLNS
Sbjct  2191  GINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNS  2250

Query  2274  TNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYIL  2333
             +NVT   +C GS PCS+CLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEW LAY+L
Sbjct  2251  SNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYML  2310

Query  2334  FTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYV  2393
             FT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYY+
Sbjct  2311  FTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYI  2370

Query  2394  WKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCV  2453
             WKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HNWNC+
Sbjct  2371  WKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCL  2430

Query  2454  NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTY  2513
             NCDTFC GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSV VKNG++HLYFDKAGQKTY
Sbjct  2431  NCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTY  2490

Query  2514  ERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLD  2573
             ERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES++KSASVYYSQLMCQPILLLD
Sbjct  2491  ERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLD  2550

Query  2574  QALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTF  2633
             QALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLSTF
Sbjct  2551  QALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTF  2610

Query  2634  ISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACID  2693
             +SAARQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLGACID
Sbjct  2611  VSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACID  2670

Query  2694  CSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNV  2753
             C+ARHINAQVAKSHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVNV
Sbjct  2671  CNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNV  2730

Query  2754  VTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAID  2813
             +TTKI+LKGGKIV+   K ++K TL+ +  A + Y++ PVH +S H  +++EIIGYKAI 
Sbjct  2731  ITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQ  2790

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTI  2873
              GVTRDI STD CFANKHA FD WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGLPGT+
Sbjct  2791  DGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTV  2850

Query  2874  LRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYC  2933
             LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKPVPYC
Sbjct  2851  LRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYC  2910

Query  2934  YDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSE  2993
             YDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTCERSE
Sbjct  2911  YDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSE  2970

Query  2994  AGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIV  3053
              G+C+STSGRWVLNN++YR+L GVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI+
Sbjct  2971  VGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGII  3030

Query  3054  AIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLT  3113
             AI+VTC AYYFM+FRR FGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYSV YLYLT
Sbjct  3031  AILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLT  3090

Query  3114  FYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFS  3173
             FY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KH +WFF+NYL++RV+FNGV+FS
Sbjct  3091  FYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFS  3150

Query  3174  TFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCH  3233
             TFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACCH
Sbjct  3151  TFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCH  3210

Query  3234  LAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3293
             LAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL
Sbjct  3211  LAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3270

Query  3294  WLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLK  3353
             WLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+LK
Sbjct  3271  WLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLK  3330

Query  3354  VDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGF  3413
             VDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVGF
Sbjct  3331  VDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGF  3390

Query  3414  NIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYA  3473
             NIDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLYA
Sbjct  3391  NIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA  3450

Query  3474  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKE  3533
             AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LKE
Sbjct  3451  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKE  3510

Query  3534  LLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLV  3593
             LLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LTSLL+
Sbjct  3511  LLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLI  3570

Query  3594  LVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMV  3653
             LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNMV
Sbjct  3571  LVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMV  3630

Query  3654  YMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMN  3713
             YMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLLILMTARTVYDD ARRVWTLMN
Sbjct  3631  YMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMN  3690

Query  3714  VLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITG  3773
             V+TLVYKVYYGNALDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FITG
Sbjct  3691  VITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITG  3750

Query  3774  NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKN  3833
             NTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK+
Sbjct  3751  NTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKS  3810

Query  3834  SIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ  3893
             SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ
Sbjct  3811  SIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQ  3870

Query  3894  LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPS  3953
             LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDIN+LCEEMLDNRATLQAIASEFSSLPS
Sbjct  3871  LHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPS  3930

Query  3954  YAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY  4013
             YAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY
Sbjct  3931  YAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMY  3990

Query  4014  KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV  4073
             KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV
Sbjct  3991  KQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV  4050

Query  4074  IPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA  4133
             +PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRA
Sbjct  4051  VPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRA  4110

Query  4134  NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKW  4193
             NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD QDLKW
Sbjct  4111  NSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKW  4170

Query  4194  ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ  4253
             ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Sbjct  4171  ARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ  4230

Query  4254  AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
             AGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE
Sbjct  4231  AGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4290

Query  4314  ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVC  4373
             ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVC
Sbjct  4291  ANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVC  4350

Query  4374  GMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             GMWKGYGCSCDQLREP++QSADA +FLN
Sbjct  4351  GMWKGYGCSCDQLREPLMQSADASTFLN  4378


> sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus 
279/2005 OX=389167 GN=1a PE=3 SV=1
Length=4388

 Score = 7462 bits (19360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3527/4416 (80%), Positives = 3928/4416 (89%), Gaps = 39/4416 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESL  G +EKTHVQLSLPVLQVRDVLVRGFGDSVEE L+EAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLALGVSEKTHVQLSLPVLQVRDVLVRGFGDSVEEALAEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA+   HG+ +VELVAEL+GIQYGRSG TLGVLVPHVGE PVAYR 
Sbjct  61    LPQLEQPYVFIKRSDAQGTNHGYKVVELVAELDGIQYGRSGTTLGVLVPHVGETPVAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYG DLKS+DLG ELGTDP ED+++NWNTKH  GV REL+RELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGIDLKSYDLGVELGTDPIEDYEQNWNTKHGGGVLRELIRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A+TRYVDNNFCGPDGYPLECIKDLLARAGK+ CTLSEQLD+I++KRGVYCCREHEHEI W
Sbjct  181   AFTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERSEKSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSEKSYERQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVATPQECNDMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVCEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + EVGPEHS+A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PANAVVKMPCPACQDPEVGPEHSVADYHNHSNIETRLRKGGRTKCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIG +HTG+ G+  E LN++L+EIL +++VNINIVGDF LNEE+AIILASF
Sbjct  421   AYWVPRASANIGASHTGITGDNVETLNEDLMEILNRDRVNINIVGDFHLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SAST AFV+TVKGLDYK FK IVESCGNFKVT+G+AKKGAWNIG++KSIL+PLY F S+A
Sbjct  481   SASTCAFVDTVKGLDYKTFKDIVESCGNFKVTRGRAKKGAWNIGQEKSILTPLYGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIF+R L+TA +S+  LQ+AAITILDGIS+ SLRLIDAM++TSDL TN+++VMAY
Sbjct  541   AGVIRSIFTRALDTANHSIPDLQRAAITILDGISEQSLRLIDAMVYTSDLLTNSVIVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ  +QWL+N+ GT  +KLKPV  W+E K   G+EFLRD WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQITQWLSNMLGTTVDKLKPVFTWVEAKLSAGIEFLRDAWEILKFLVTGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  +KE V+ F  ++NK L +C D +II GAKL+ LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNLKECVKAFLDVLNKALEMCIDQVIIAGAKLRTLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPL+APKE+ F EG++  T   +EEVVLK G+L+ LE P        ++G
Sbjct  721   IRGKEQLQLLMPLRAPKEVTFFEGDSHDTVFTSEEVVLKNGELEALETPVDSFTNGAVIG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVC+NGLMLLE+KD E+YCAL+P ++ TNN F+LKGGAP K VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCVNGLMLLELKDKEQYCALSPGLLATNNVFSLKGGAPVKGVTFGEDTVLEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   KITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQ--YEYGTEDDYQG  957
             WS+AT+YLFD++GE KL+S MYCSFYPPDE+E+  + E+EE  P     +EYGTEDDY+G
Sbjct  901   WSVATFYLFDDAGEEKLSSRMYCSFYPPDEEEDCEEYEDEEEIPEETCEHEYGTEDDYKG  960

Query  958   KPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELT  1017
              PLEFGA++                + QQ   +++     +    +   E          
Sbjct  961   LPLEFGAST----------------EIQQVDEEEEEDWLEEAIAAKPEPEPL--------  996

Query  1018  PVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNK  1077
                    VN F+GYLKLTDNV IK  DIV+EA+  KPTV+VNAANV+LKHGGGVAGALNK
Sbjct  997   ---PEEPVNQFTGYLKLTDNVAIKCVDIVKEAQHAKPTVIVNAANVHLKHGGGVAGALNK  1053

Query  1078  ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYEN  1137
             ATN AMQ ESDDYI  NGPL VGGSC+LSGHNLAK C+HVVGPN+N GED+QLLK+AY N
Sbjct  1054  ATNGAMQQESDDYIKKNGPLTVGGSCLLSGHNLAKKCMHVVGPNLNAGEDVQLLKAAYAN  1113

Query  1138  FNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEK  1197
             FN  +VLLAPLLSAGIFGA P+ SL++CV+TVRT VY AV D++LYD +V  +L+    K
Sbjct  1114  FNSQDVLLAPLLSAGIFGAKPLQSLKMCVETVRTQVYFAVNDQDLYDHVVLGYLDSLKPK  1173

Query  1198  QVE---QKIAEIPKEEVKPFITESKPSVEQ----RKQDDKKIKACVEEVTTTLEETKFLT  1250
              VE   Q+  E+ ++     +T+    +E+     K  D K KA +EEV T+LEETKFLT
Sbjct  1174  -VETPTQENLELKEQPAVETLTQENLELEELPVIEKPVDVKFKARIEEVNTSLEETKFLT  1232

Query  1251  ENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTT  1310
               LLL+ DING L+ DS  ++   D+ FL+KDAPYIVGDV+  G +T V+IP KKAGGTT
Sbjct  1233  SRLLLFADINGKLYQDSQNMLRGEDMFFLEKDAPYIVGDVISSGDITCVIIPAKKAGGTT  1292

Query  1311  EMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGT  1370
             EMLAKAL+KVP   YITTYPGQG  GYT+EEAKT L+KCKS FY+LPS   N+K+EILGT
Sbjct  1293  EMLAKALKKVPVSEYITTYPGQGCAGYTLEEAKTALRKCKSVFYVLPSKTPNDKEEILGT  1352

Query  1371  VSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTT  1430
             VSWNLREMLAHAEETRKLM +C++ KA++STI R+YKGIK+QEG+VDYG RF+FYTSK  
Sbjct  1353  VSWNLREMLAHAEETRKLMLICMDVKALMSTIHRRYKGIKVQEGIVDYGVRFFFYTSKEP  1412

Query  1431  VASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYL  1490
             VAS+I  LN LNE LVTMP+GYVTHGLNLEEAAR MRSLK PA VSVSSPDAVT YNGYL
Sbjct  1413  VASIITKLNLLNEPLVTMPIGYVTHGLNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYL  1472

Query  1491  TSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGE  1549
             TSSSKT EEHFIET+SLAG Y+DWSYSGQ T+LG+EFLKRGDK VY+T  +P  FHLDGE
Sbjct  1473  TSSSKTSEEHFIETVSLAGMYRDWSYSGQRTELGVEFLKRGDKVVYHTVGSPIQFHLDGE  1532

Query  1550  VITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKP  1609
             V+  D LK+LLSLREVRTIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKP
Sbjct  1533  VLLLDKLKSLLSLREVRTIKVFTTVDNTNLHTQIVDMSMTYGQQFGPTYLDGADVTKIKP  1592

Query  1610  HNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKW  1669
             H  HEGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQ+ GLTSIKW
Sbjct  1593  HAKHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQIGGLTSIKW  1652

Query  1670  ADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVR  1729
             ADNNCYL++ LL LQQIE+KFN PALQ+AYYRARAG+AANFCALILAY N+TVGELGDVR
Sbjct  1653  ADNNCYLSSVLLALQQIEVKFNAPALQEAYYRARAGDAANFCALILAYSNRTVGELGDVR  1712

Query  1730  ETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTC  1789
             ETM++L QHANL+S KRVLNVVCKTCGQ+ TTL GVEAVMYMGTLSYE+ K GV IPC C
Sbjct  1713  ETMTHLLQHANLESAKRVLNVVCKTCGQKSTTLTGVEAVMYMGTLSYEELKTGVTIPCIC  1772

Query  1790  GKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCID  1849
             G+ AT+YLVQQES FVMMSAPP++Y L+ G F CA+EYTG+YQCGHY H+T KETLY ID
Sbjct  1773  GRDATQYLVQQESSFVMMSAPPSEYTLQQGAFLCANEYTGSYQCGHYTHVTVKETLYRID  1832

Query  1850  GALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTE  1909
             GA LTK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV+ TEI PKLD YYKKDN+Y+TE
Sbjct  1833  GAYLTKMSEYKGPVTDVFYKEISYTTTIKPVSYKLDGVIYTEIQPKLDEYYKKDNAYYTE  1892

Query  1910  QPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVA  1969
             QPIDLVP QP PNASFDNFK  C N KFADDLNQ+TG+KKPASREL VTFFPDLNGDVVA
Sbjct  1893  QPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFKKPASRELSVTFFPDLNGDVVA  1952

Query  1970  IDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLK  2029
             IDY+HY+ SFKKGAKLLHKPI+WH+N  TNK TYKPNTWC+RCLWSTKPVETSNSF+VL+
Sbjct  1953  IDYRHYSASFKKGAKLLHKPIIWHINQTTNKTTYKPNTWCLRCLWSTKPVETSNSFEVLE  2012

Query  2030  SEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEE  2089
              ED QGMDNLACE   P SEEVVENPTIQK+V+EC+VKT EVVG++ILKP+   +K+T+E
Sbjct  2013  VEDTQGMDNLACESQTPTSEEVVENPTIQKEVIECDVKTIEVVGNVILKPSEEGVKVTQE  2072

Query  2090  VGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKV  2149
             +GH DLMAAYV+ +S+TIKKPNELS  LGL+TLATHG AA+NSVPW  I  Y KPFL + 
Sbjct  2073  LGHEDLMAAYVEETSITIKKPNELSLALGLRTLATHGAAAINSVPWSKILAYVKPFLGQA  2132

Query  2150  VSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKF  2209
               TTTN + RC+ RV  NYMPY  TLL QLCTFTRSTNSRI+AS+PTTIAKN+VKSV K 
Sbjct  2133  AVTTTNCIKRCVQRVFNNYMPYVITLLFQLCTFTRSTNSRIRASLPTTIAKNSVKSVAKL  2192

Query  2210  CLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREG  2269
             CL+   NY+KSP FSKL  I +W LLLS+CLGSLIY TAA GVL+SNLG+PSYC G RE 
Sbjct  2193  CLDVCINYVKSPKFSKLFTIAMWLLLLSICLGSLIYVTAAFGVLLSNLGIPSYCDGVRES  2252

Query  2270  YLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFL  2329
             Y+NS+NVT   +C GS  CSVCL+GLDSLD+YP+LETIQ+TISS+K DLT+ GL AEWFL
Sbjct  2253  YVNSSNVTTMDFCEGSFLCSVCLNGLDSLDSYPALETIQVTISSYKLDLTSLGLAAEWFL  2312

Query  2330  AYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFAS  2389
             AY+LFT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFA 
Sbjct  2313  AYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFAF  2372

Query  2390  FYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHN  2449
              YYVWKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HN
Sbjct  2373  CYYVWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKAHN  2432

Query  2450  WNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAG  2509
             WNC+NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSY+VDSV VKNG++HLYFDKAG
Sbjct  2433  WNCLNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYVVDSVAVKNGALHLYFDKAG  2492

Query  2510  QKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPI  2569
             QKTYERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES+AKSASVYYSQLMCQPI
Sbjct  2493  QKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESAAKSASVYYSQLMCQPI  2552

Query  2570  LLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNV  2629
             LLLDQALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD V
Sbjct  2553  LLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGV  2612

Query  2630  LSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLG  2689
             LSTF+SAARQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLG
Sbjct  2613  LSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLG  2672

Query  2690  ACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQ  2749
             ACIDC+ARHINAQVAKSHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQ
Sbjct  2673  ACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQ  2732

Query  2750  VVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGY  2809
             VVN +TTKI+LKGGKIV+ W K ++K TL+ +  A   Y+I PVH +S H  +++EIIGY
Sbjct  2733  VVNAITTKISLKGGKIVSTWFKLMLKATLLCVLAALFCYIIMPVHSLSVHDGYTNEIIGY  2792

Query  2810  KAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGL  2869
             KAI  GVTRDI +TD CFANKHA FD+WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGL
Sbjct  2793  KAIQDGVTRDIMATDDCFANKHAGFDSWFSQRGGSYRNDKSCPVVAAIITREIGFIVPGL  2852

Query  2870  PGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKP  2929
             PGT+LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKP
Sbjct  2853  PGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKP  2912

Query  2930  VPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
             VPYCYDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTC
Sbjct  2913  VPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTC  2972

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             ERSEAGVC+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VA
Sbjct  2973  ERSEAGVCLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVA  3032

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
             GGI+AI+VTC AYYFM+FRRAFGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYS+ Y
Sbjct  3033  GGIIAILVTCAAYYFMKFRRAFGEYNHVVAANALLFLMSFTILCLAPAYSFLPGVYSIFY  3092

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNG  3169
             LYLTFY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KH +WFF+NYL++RV+FNG
Sbjct  3093  LYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNG  3152

Query  3170  VSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREA  3229
             V+FSTFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREA
Sbjct  3153  VTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREA  3212

Query  3230  ACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT  3289
             ACCHLAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT
Sbjct  3213  ACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT  3272

Query  3290  LNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCV  3349
             LNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+
Sbjct  3273  LNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCL  3332

Query  3350  LKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCG  3409
             L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN+TIKGSFLNGSCG
Sbjct  3333  LRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNYTIKGSFLNGSCG  3392

Query  3410  SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLA  3469
             SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLA
Sbjct  3393  SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLA  3452

Query  3470  WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA  3529
             WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA
Sbjct  3453  WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA  3512

Query  3530  SLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILT  3589
             +LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LT
Sbjct  3513  ALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLT  3572

Query  3590  SLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAY  3649
             SLL+LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAY
Sbjct  3573  SLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAY  3632

Query  3650  FNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVW  3709
             FNMVYMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLL+LMTARTVYDD ARRVW
Sbjct  3633  FNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLVLMTARTVYDDAARRVW  3692

Query  3710  TLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIF  3769
             TLMNV+TLVYKVYYGN+LDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ 
Sbjct  3693  TLMNVITLVYKVYYGNSLDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLL  3752

Query  3770  FITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL  3829
             FITGNTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL
Sbjct  3753  FITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL  3812

Query  3830  PPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA  3889
             PPK+SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA
Sbjct  3813  PPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA  3872

Query  3890  QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS  3949
             QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS
Sbjct  3873  QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS  3932

Query  3950  SLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM  4009
             SLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM
Sbjct  3933  SLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM  3992

Query  4010  TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK  4069
             TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK
Sbjct  3993  TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK  4052

Query  4070  LMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVT  4129
             LMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNS NLAWPLIVT
Sbjct  4053  LMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSQNLAWPLIVT  4112

Query  4130  ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQ  4189
             ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD Q
Sbjct  4113  ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQ  4172

Query  4190  DLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAAT  4249
             DLKWARFPKSDGTGTIYTELEPPCRFVTDTP+GPKVKYLYFIKGLNNLNRGMVLGSLAAT
Sbjct  4173  DLKWARFPKSDGTGTIYTELEPPCRFVTDTPRGPKVKYLYFIKGLNNLNRGMVLGSLAAT  4232

Query  4250  VRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT  4309
             VRLQAGNATEVPANS VLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT
Sbjct  4233  VRLQAGNATEVPANSAVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT  4292

Query  4310  VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
             VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIP TCANDPVGFTLKNTV
Sbjct  4293  VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPATCANDPVGFTLKNTV  4352

Query  4370  CTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
             CTVCG WKGYGCSCDQLREPM+QSADA +FLNGFAV
Sbjct  4353  CTVCGTWKGYGCSCDQLREPMMQSADASTFLNGFAV  4388


> sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU3 OX=442736 GN=rep PE=3 SV=1
Length=7067

 Score = 7448 bits (19326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3532/4407 (80%), Positives = 3926/4407 (89%), Gaps = 41/4407 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA +  HGH +VELVAEL+GIQ+GRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQLEQPYVFIKRSDALSTNHGHKVVELVAELDGIQFGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHS+G DLKS+DLGDELGTDP ED+++NWNTKH SG  REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
               TRYVDNNFCGPDGYPLECIKD LARAGK+ CTLSEQLD+I++KRGVYCCREHEHEI W
Sbjct  181   VVTRYVDNNFCGPDGYPLECIKDFLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERSEKSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSEKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVATPQECNDMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVCEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + EVGPEHS+A+YHN S ++T LRKGGRT  FGGCVFSYVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEVGPEHSVADYHNHSNIETRLRKGGRTKCFGGCVFSYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIG NHTG+ GE  E LN++LLEIL +E+VNINIVGDF+ NEE+AIILASF
Sbjct  421   AYWVPRASANIGANHTGITGENVETLNEDLLEILNRERVNINIVGDFRFNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SAS SAF+ETVKGLDYK+FK IVESCGN+KVT GK   GAWNIG+Q+SIL+PL  F S+A
Sbjct  481   SASPSAFIETVKGLDYKSFKVIVESCGNYKVTNGKPVTGAWNIGQQRSILTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIFSRTL+ A +S+  LQ+AA+T LDGIS+ SLRL+DAM++TSDL TN++VVMAY
Sbjct  541   AGVIRSIFSRTLDAANHSILDLQRAAVTTLDGISEQSLRLVDAMVYTSDLLTNSVVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ T QWL+N+ GT  +KLKPV  W+E K   GVEFLRD WEI+KF+ T   +++
Sbjct  601   VTGGLVQQTMQWLSNMLGTAVDKLKPVFTWVEAKLSAGVEFLRDAWEILKFLITGVFDVI  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI      IKE V+ F  +VNK L +C D + I G KL+ALNLGE F+  S+GLYR+C
Sbjct  661   KGQIQVATDNIKECVKIFLGVVNKALEMCLDQVTIAGTKLRALNLGEVFIAQSRGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG+   T + +EEVVLK+G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDAHDTVLTSEEVVLKSGELEALETPIDSFTSGAVVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVCINGLMLLE+++ E+YCAL+P ++ TNN F LKGGAP K VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCINGLMLLELENKEQYCALSPGLLATNNVFRLKGGAPVKGVTFGEDTVLEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELD R+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLTP+GIDLDE
Sbjct  841   KITFELDVRVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTPMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKP  959
             WS+AT+YLFD++GE KL+S MYCSFYPPDE+E+    E E+ E + ++EYGTEDDY+G P
Sbjct  901   WSVATFYLFDDAGEEKLSSRMYCSFYPPDEEEDCE--ECEDEEETCEHEYGTEDDYKGLP  958

Query  960   LEFGATSAALQ-PEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTP  1018
             LEFGA++      EEE+EEDWLDD  +     +                           
Sbjct  959   LEFGASTETPHVEEEEEEEDWLDDAIEAEPEPE---------------------------  991

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
              +    VN F GYLKLTDNV IK  DIV+EA+  KPTV+VNAAN +LKHGGGVAGALNKA
Sbjct  992   PLPEEPVNQFVGYLKLTDNVAIKCIDIVKEAQSAKPTVIVNAANTHLKHGGGVAGALNKA  1051

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENF  1138
             TN AMQ ESD+YI  NGPL VGGSC+LSGHNLA+ CLHVVGPN+N GED+QLLK AYENF
Sbjct  1052  TNGAMQNESDEYIRQNGPLTVGGSCLLSGHNLAEKCLHVVGPNLNAGEDVQLLKRAYENF  1111

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQ  1198
             N  +VLLAPLLSAGIFGA P+ SL++CV+ VRT VYLAV DK+LYD++V  +L+    K 
Sbjct  1112  NSQDVLLAPLLSAGIFGAKPLQSLKMCVEIVRTQVYLAVNDKSLYDQIVLDYLDSLKPK-  1170

Query  1199  VEQKIAEIPKEEVKPFITES---KPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLL  1255
                   E P +E +P + E    +P  E+      KIKAC++EVTTTLEETKFLT  LLL
Sbjct  1171  -----VESPNKEEEPKLEEPKAVQPVAEKPVDVKPKIKACIDEVTTTLEETKFLTNKLLL  1225

Query  1256  YIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAK  1315
             + DING L+ DS  ++   D++FL+KDAPYIVGDV+  G +T V+IP KK+GGTTEMLA+
Sbjct  1226  FADINGKLYQDSQNMLRGEDMSFLEKDAPYIVGDVITSGDITCVIIPAKKSGGTTEMLAR  1285

Query  1316  ALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNL  1375
             AL++VP   YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   NEK+E+LGTVSWNL
Sbjct  1286  ALKEVPVAEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSETPNEKEEVLGTVSWNL  1345

Query  1376  REMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLI  1435
             REMLAHAEETRKLMP+C++ +AI++TIQRKYKGIK+QEG+VDYG RF+FYTSK  VAS+I
Sbjct  1346  REMLAHAEETRKLMPICLDVRAIMATIQRKYKGIKVQEGIVDYGVRFFFYTSKEPVASII  1405

Query  1436  NTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSK  1495
               LN LNE LVTMP+GYVTHGLNLEEAAR MRSLK PA VSVSSPDAVTAYNGYLTSSSK
Sbjct  1406  TKLNSLNEPLVTMPIGYVTHGLNLEEAARCMRSLKAPAVVSVSSPDAVTAYNGYLTSSSK  1465

Query  1496  TPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTS-NPTTFHLDGEVITFD  1554
             TPEE+F+ET SLAGSY+DWSYSGQ T+LG+EFLKRGDK VY+T+ +P  FHLDGEV+  D
Sbjct  1466  TPEEYFVETTSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTTGSPIEFHLDGEVLPLD  1525

Query  1555  NLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHE  1614
              LK+LLSLREV+TIKVFTTVDN NLHT +VDMSMTYGQQFGPTYLDGADVTKIKPH +HE
Sbjct  1526  KLKSLLSLREVKTIKVFTTVDNTNLHTHIVDMSMTYGQQFGPTYLDGADVTKIKPHVNHE  1585

Query  1615  GKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNC  1674
             GKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADNNC
Sbjct  1586  GKTFFVLPSDDTLRSEAFEYYHTIDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNC  1645

Query  1675  YLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSY  1734
             YL++ LL LQQ+E+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM++
Sbjct  1646  YLSSVLLALQQVEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTH  1705

Query  1735  LFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQAT  1794
             L QHANL+S KRVLNVVCK CGQ+ TTLKGVEAVMYMGTLSY++ K GV IPC CG+ AT
Sbjct  1706  LLQHANLESAKRVLNVVCKHCGQKTTTLKGVEAVMYMGTLSYDELKTGVSIPCVCGRNAT  1765

Query  1795  KYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLT  1854
             +YLVQQES FVMMSAPPA+Y+L+ G F CA+EYTGNYQCGHY HIT+KETLY +DGA LT
Sbjct  1766  QYLVQQESSFVMMSAPPAEYKLQQGAFLCANEYTGNYQCGHYTHITAKETLYRVDGAHLT  1825

Query  1855  KSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL  1914
             K SEYKGP+TDVFYKE SYTT IKPV+YKLDGV  TEI+PKLD YYKK N+Y+TEQPIDL
Sbjct  1826  KMSEYKGPVTDVFYKETSYTTAIKPVSYKLDGVTYTEIEPKLDGYYKKGNAYYTEQPIDL  1885

Query  1915  VPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKH  1974
             VP QP PNASFDNFK  C N KFADDLNQ+TG+KKPASREL VTFFPDLNGDVVAIDY+H
Sbjct  1886  VPTQPMPNASFDNFKLTCSNTKFADDLNQMTGFKKPASRELTVTFFPDLNGDVVAIDYRH  1945

Query  1975  YTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQ  2034
             Y+ SFKKGAKL+HKPI+WH+N  TNK TYKPN WC+RCLWSTKPV+TSNSF+VL  ED Q
Sbjct  1946  YSTSFKKGAKLVHKPILWHINQTTNKTTYKPNIWCLRCLWSTKPVDTSNSFEVLVVEDTQ  2005

Query  2035  GMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTD  2094
             GMDNLACE     SEEVVENPT+QK+++EC+VKTTEVVG++ILKP+   +K+T+E+GH D
Sbjct  2006  GMDNLACESQTTTSEEVVENPTVQKEIIECDVKTTEVVGNVILKPSEEGVKVTQELGHED  2065

Query  2095  LMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTT  2154
             LMAAYV+ +S+TIKKPNELS  LGLKTLATHG AA+NSVPW  I  Y KPFL +    T+
Sbjct  2066  LMAAYVEETSITIKKPNELSLALGLKTLATHGAAAINSVPWSKILAYVKPFLGQTAVITS  2125

Query  2155  NIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEAS  2214
             N + +C+ RV +NYMPY  TLL QLCTFT+STNSRIKAS+PTTIAKN+VKSV K CL+  
Sbjct  2126  NCIKKCVQRVFSNYMPYVITLLFQLCTFTKSTNSRIKASLPTTIAKNSVKSVAKLCLDVC  2185

Query  2215  FNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNST  2274
              NY+KSP FSKL  I++W LLLS+CLGSL Y TA LGV +S+LG+PSYC G RE Y+NS+
Sbjct  2186  INYVKSPKFSKLFTIVMWLLLLSICLGSLTYVTAVLGVCLSSLGVPSYCDGVRELYINSS  2245

Query  2275  NVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILF  2334
             NVT   +C G  PCSVCLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEW LAY+LF
Sbjct  2246  NVTTMDFCQGYFPCSVCLSGLDSLDSYPALETIQVTISSYKLDLTFLGLAAEWLLAYMLF  2305

Query  2335  TRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVW  2394
             T+FFY+LGL+AIMQ FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYYVW
Sbjct  2306  TKFFYLLGLSAIMQAFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYVW  2365

Query  2395  KSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVN  2454
             KSYVH++DGC SSTCMMCYKRNRATRVECTTIVNGV+RSFYVYANGG+GFCK HNWNC+N
Sbjct  2366  KSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGVKRSFYVYANGGRGFCKAHNWNCLN  2425

Query  2455  CDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYE  2514
             CDTFCAGSTFISDEVARDLSLQFKRPINPTDQS+Y+VDSVTVKNG++HLYFDKAGQKTYE
Sbjct  2426  CDTFCAGSTFISDEVARDLSLQFKRPINPTDQSAYVVDSVTVKNGALHLYFDKAGQKTYE  2485

Query  2515  RHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQ  2574
             RH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES+AKSASVYYSQLMCQPILLLDQ
Sbjct  2486  RHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESAAKSASVYYSQLMCQPILLLDQ  2545

Query  2575  ALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFI  2634
             ALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLSTF+
Sbjct  2546  ALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFV  2605

Query  2635  SAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
             SAARQG VD+DV+TKDV+ECLKLSH SDIEVTGDSCNN+MLTYNKVENMTPRDLGACIDC
Sbjct  2606  SAARQGVVDTDVDTKDVIECLKLSHHSDIEVTGDSCNNFMLTYNKVENMTPRDLGACIDC  2665

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +ARHINAQVAKSHN++L+WNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVNV+
Sbjct  2666  NARHINAQVAKSHNVSLVWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVI  2725

Query  2755  TTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDG  2814
             TTKI+LKGGK+V+ W K L+KVTL+ +  A   Y+I PVH +S H  +++EIIGYKAI  
Sbjct  2726  TTKISLKGGKVVSTWFKLLLKVTLLCVLAALFCYVIMPVHSLSVHDGYTNEIIGYKAIQD  2785

Query  2815  GVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTIL  2874
             GVTRDI STD CFANKHA FD+WFSQRGGSY NDK CP++AA+ITRE+GF+VPGLPGT+L
Sbjct  2786  GVTRDIVSTDDCFANKHAGFDSWFSQRGGSYRNDKNCPVVAAIITREIGFIVPGLPGTVL  2845

Query  2875  RTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCY  2934
             R  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKPVPYCY
Sbjct  2846  RALNGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCY  2905

Query  2935  DTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEA  2994
             DTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTCERSE 
Sbjct  2906  DTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEV  2965

Query  2995  GVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVA  3054
             GVC+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI+A
Sbjct  2966  GVCLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIA  3025

Query  3055  IVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTF  3114
             I+VTC AYYFM+FRRAFGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYS+ YLYLTF
Sbjct  3026  ILVTCAAYYFMKFRRAFGEYNHVVAANALLFLMSFTILCLAPAYSFLPGVYSIFYLYLTF  3085

Query  3115  YLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFST  3174
             Y TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KHF+WFFSNYLK+RV+FNGV+FST
Sbjct  3086  YFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHFHWFFSNYLKKRVMFNGVTFST  3145

Query  3175  FEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL  3234
             FEEAALCTFLLNKEMYL+LRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACCHL
Sbjct  3146  FEEAALCTFLLNKEMYLRLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHL  3205

Query  3235  AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW  3294
             AKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW
Sbjct  3206  AKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLW  3265

Query  3295  LDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKV  3354
             LDD VYCPRHV+CT+EDMLNPNY+DLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+LKV
Sbjct  3266  LDDTVYCPRHVVCTAEDMLNPNYDDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKV  3325

Query  3355  DTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFN  3414
             DT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVGFN
Sbjct  3326  DTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFN  3385

Query  3415  IDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAA  3474
             IDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLYAA
Sbjct  3386  IDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAA  3445

Query  3475  VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKEL  3534
             VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LKEL
Sbjct  3446  VINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKEL  3505

Query  3535  LQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVL  3594
             LQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LTSLL+L
Sbjct  3506  LQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLIL  3565

Query  3595  VQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVY  3654
             VQSTQWSLFFF+YENAFLPFA+GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNMVY
Sbjct  3566  VQSTQWSLFFFVYENAFLPFALGIMAVAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVY  3625

Query  3655  MPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNV  3714
             MPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLLILMTARTVYDD ARRVWTLMNV
Sbjct  3626  MPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNV  3685

Query  3715  LTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGN  3774
             +TLVYKVYYGN+LDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FITGN
Sbjct  3686  ITLVYKVYYGNSLDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGN  3745

Query  3775  TLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNS  3834
             TLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK+S
Sbjct  3746  TLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSS  3805

Query  3835  IDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL  3894
             IDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL
Sbjct  3806  IDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQL  3865

Query  3895  HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY  3954
             HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY
Sbjct  3866  HNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSY  3925

Query  3955  AAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYK  4014
             AA+ATAQEAYEQAV+NGDSEVVLKKLKKSLNVAKSEFD DAAMQRKLEKMADQAMTQMYK
Sbjct  3926  AAYATAQEAYEQAVSNGDSEVVLKKLKKSLNVAKSEFDHDAAMQRKLEKMADQAMTQMYK  3985

Query  4015  QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVI  4074
             QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV+
Sbjct  3986  QARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVV  4045

Query  4075  PDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN  4134
             PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNSPNLAWPLIVTALRAN
Sbjct  4046  PDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN  4105

Query  4135  SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
             SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN  KGGRFVLALLSD QDLKWA
Sbjct  4106  SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNAKGGRFVLALLSDHQDLKWA  4165

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
             RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA
Sbjct  4166  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4225

Query  4255  GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA  4314
             GNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA
Sbjct  4226  GNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEA  4285

Query  4315  NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCG  4374
             NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTVCG
Sbjct  4286  NMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCG  4345

Query  4375  MWKGYGCSCDQLREPMLQSADAQSFLN  4401
             MWKGYGCSCDQLREPM+QSADA +FLN
Sbjct  4346  MWKGYGCSCDQLREPMMQSADASTFLN  4372


> sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=rep PE=3 SV=1
Length=7071

 Score = 7448 bits (19324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3519/4409 (80%), Positives = 3932/4409 (89%), Gaps = 41/4409 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLV G NEKTHVQLSLPVLQVRDVLVRGFGDSVEE LSEAR+HLK GTCG+VE+EKGV
Sbjct  1     MESLVLGINEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKSGTCGIVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQ EQPYVFIKRSDA+   HGH + ELVAEL+G+QYGRSG TLGVLVPHVGE P+AYR 
Sbjct  61    LPQPEQPYVFIKRSDAQGTDHGHRVRELVAELDGVQYGRSGITLGVLVPHVGETPIAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHS+G DLKS+DLGDELGTDP ED+++NWNTKH SGV REL RELNGG
Sbjct  121   VLLRKNGNKGAGGHSFGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGVLRELTRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A TRYVDNNFCGPDGYPLECIKDLLARAGK+ CTLSEQLD+I++KRGVYCCR+H HEIAW
Sbjct  181   ALTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCRDHGHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERS+KSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG  TCGYL
Sbjct  301   RSVYPVATPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVSEGPNTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + E+GPEHS A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PTNAVVKMPCPACQDPEIGPEHSAADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASA+IG  HTG+ G+  E LN++LLEIL +E+VNINIVGDF+LNEE+AIILASF
Sbjct  421   AYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFQLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAF++T+K LDYK+FK IVESCGN+KVTKGK  KGAWNIG+ +S+L+PL  F S+A
Sbjct  481   SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPIKGAWNIGQHRSVLTPLCGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIFSRTL+ A +S+  LQ+AA+TILD IS+ SLRL+DAM++TS+L TN++++MAY
Sbjct  541   AGVIRSIFSRTLDAANHSIPDLQRAAVTILDSISEQSLRLVDAMVYTSNLLTNSVIIMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ TSQWL+N+  T  EKL+P+  W+E K   GVEFL+D WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQTSQWLSNLLDTTVEKLRPIFAWIEAKLSAGVEFLKDAWEILKFLITGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  IK+ V+ F  +VNK L +C D + I GAKL++LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNIKDCVKCFVDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPLKAPKE+ FLEG++  T + +EEVVLK G+L+ LE P        +VG
Sbjct  721   IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAVVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVCINGLMLLEIK  E+YCAL+P ++ TNN F LKGGAPTK VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCINGLMLLEIKANEQYCALSPGLLATNNVFRLKGGAPTKGVTFGEDTVVEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   RITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEP--STQYEYGTEDDYQG  957
             WS+AT+YLFD+SGE KL+S MYCSFYPPDE+E+  + EEEE     + ++EYGTE+DY+G
Sbjct  901   WSVATFYLFDDSGEEKLSSRMYCSFYPPDEEEDCEEYEEEEEVSERTCEHEYGTEEDYKG  960

Query  958   KPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELT  1017
              PLEFGA++  +Q EE++EEDWLDD  +     +                          
Sbjct  961   LPLEFGASTDIIQVEEQEEEDWLDDAVEAEPEPE--------------------------  994

Query  1018  PVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNK  1077
               +    VN  +GYLKLTDNV IK  DIVEEA+   P V+VNAAN++LKHGGGVAGALNK
Sbjct  995   -PLHEEPVNQLTGYLKLTDNVAIKCVDIVEEAQNANPMVIVNAANIHLKHGGGVAGALNK  1053

Query  1078  ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYEN  1137
             ATN AMQ ESD YI  NGPL VGGSC+LSGHNLAK CLHVVGPN+N GEDIQLLK+AYEN
Sbjct  1054  ATNGAMQKESDHYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYEN  1113

Query  1138  FNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEK  1197
             FN  ++LLAPLLSAGIFGA P+ SL++CV TVRT VY+ V DK LY+++V  +L+    K
Sbjct  1114  FNSQDILLAPLLSAGIFGAKPLQSLQMCVQTVRTQVYIVVNDKVLYEQVVMDYLDSLKPK  1173

Query  1198  QVEQKIAEIPKEEVKP---FITESKPSVEQRKQDDK-KIKACVEEVTTTLEETKFLTENL  1253
                    E PK+EV P   +    + SV Q+  D K KIKAC++EVTTTLEETKFLT  L
Sbjct  1174  ------VEAPKQEVLPKAEYPKVDEKSVVQKTIDVKPKIKACIDEVTTTLEETKFLTNKL  1227

Query  1254  LLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEML  1313
             LL+ DING L+ DS  ++   D++FL+KDAPY+VGDV+  G +T VVIP+KKAGGTTEML
Sbjct  1228  LLFTDINGKLYQDSKNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEML  1287

Query  1314  AKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSW  1373
             ++AL+KVP + YITTYPGQG  GYT+EEAKT LKKCKSAFY+LPS   N K+EILGTVSW
Sbjct  1288  SRALKKVPINEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSETPNAKEEILGTVSW  1347

Query  1374  NLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVAS  1433
             NLREMLAHAEETRKLMPVC++ +AI++TIQRKYKGIKIQEG+VDYG RF+FYTSK  VAS
Sbjct  1348  NLREMLAHAEETRKLMPVCMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVAS  1407

Query  1434  LINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSS  1493
             +I  LN LNE LVTMP+GYVTHG NLEEAAR MRSLK PA VSVSSPDAVT YNGYLTSS
Sbjct  1408  IITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAIVSVSSPDAVTTYNGYLTSS  1467

Query  1494  SKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGEVIT  1552
             SKT E+HF+ET+SLAGSY+DWSYSGQ T+LG+EFLKRG+K VY+T  +P  FHLDGEV+ 
Sbjct  1468  SKTSEDHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGEKIVYHTLESPVKFHLDGEVLP  1527

Query  1553  FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNS  1612
              D LK+LLSLREV+TIKVFTTVDN NLHTQ+VDMSMTYGQQ GPTYL+GADVTKIKPH +
Sbjct  1528  LDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQLGPTYLEGADVTKIKPHVN  1587

Query  1613  HEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADN  1672
             HEGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQV GLTSIKWADN
Sbjct  1588  HEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADN  1647

Query  1673  NCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETM  1732
             NCYL++ LL LQQIE+KFN PALQ+AYYRARAG+AANFCALILAY NKTVGELGDVRETM
Sbjct  1648  NCYLSSVLLALQQIEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETM  1707

Query  1733  SYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQ  1792
             ++L QHANL+S KRVLNVVCK CGQ+ TTL GVEAVMYMGTLSY+  K GV IPC CG+ 
Sbjct  1708  THLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKMGVSIPCVCGRD  1767

Query  1793  ATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGAL  1852
             AT+YLVQQES FVMMSAPPA+Y+L+ GTF CA+EYTGNYQCGHY HIT+KETLY IDGA 
Sbjct  1768  ATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAH  1827

Query  1853  LTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPI  1912
             LTK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV  TEI+PKLD YYKKDN+Y+TEQPI
Sbjct  1828  LTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPI  1887

Query  1913  DLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDY  1972
             DL+P QP PNASFDNFK  C N KFADDLNQ+TG+ KPASREL VTFFPDLNGDVVAIDY
Sbjct  1888  DLIPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDY  1947

Query  1973  KHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSED  2032
             +HY+ SFKKGAKLLHKPIVWH+N AT K T+KPNTWC+RCLWSTKPV+TSNSF+VL  ED
Sbjct  1948  RHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVED  2007

Query  2033  AQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGH  2092
              QGMDNLACE  +P  EEVVENPTIQK+V+EC+VKTTEVVG++ILKP++  +K+T+E+ H
Sbjct  2008  TQGMDNLACESQQPTPEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELDH  2067

Query  2093  TDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVST  2152
              DLMAAYV+N+S+TIKKPNELS  LGLKT+ATHG+AA+NSVPW  I  Y KPFL +   T
Sbjct  2068  EDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWGKILAYVKPFLGQAAVT  2127

Query  2153  TTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLE  2212
             T+N   R + R+  NYMPY  TLL QLCTFT+STNSRI+AS+PTTIAKN+V+ + + CL+
Sbjct  2128  TSNCAKRLVQRMFNNYMPYVLTLLFQLCTFTKSTNSRIRASLPTTIAKNSVRGIVRLCLD  2187

Query  2213  ASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLN  2272
             A  NY+KSP FSKL  I +W LLLS+CLGSLIY TAALGVL+SN G PSYC+G RE YLN
Sbjct  2188  AGINYVKSPKFSKLFTIAMWLLLLSICLGSLIYVTAALGVLLSNFGAPSYCSGVRESYLN  2247

Query  2273  STNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYI  2332
             S+NVT   +C GS PCSVCLSGLDSLD+YP+LETIQ+TISS+K DLT  GL AEWF AY+
Sbjct  2248  SSNVTTMDFCEGSFPCSVCLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWFFAYM  2307

Query  2333  LFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYY  2392
             LFT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFASFYY
Sbjct  2308  LFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYY  2367

Query  2393  VWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNC  2452
             +WKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HNWNC
Sbjct  2368  IWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNC  2427

Query  2453  VNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKT  2512
             +NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSY+VDSV VKNG++HLYFDKAGQKT
Sbjct  2428  LNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYVVDSVAVKNGALHLYFDKAGQKT  2487

Query  2513  YERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLL  2572
             YERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES+AKSASVYYSQLMCQPILLL
Sbjct  2488  YERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESAAKSASVYYSQLMCQPILLL  2547

Query  2573  DQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLST  2632
             DQALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD VLST
Sbjct  2548  DQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLST  2607

Query  2633  FISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACI  2692
             F+SA+RQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLGACI
Sbjct  2608  FVSASRQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACI  2667

Query  2693  DCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVN  2752
             DC+ARHINAQVA+SHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQVVN
Sbjct  2668  DCNARHINAQVARSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVN  2727

Query  2753  VVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAI  2812
             V+TTKI+LKGGKIV+ W K ++K TL+ +  A + Y++ PVH++S H  +++EIIGYKAI
Sbjct  2728  VITTKISLKGGKIVSTWFKIMLKATLLCVLAALVCYIVMPVHILSVHGGYTNEIIGYKAI  2787

Query  2813  DGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGT  2872
               GVTRDI STD CFANKHA FD+WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGLPGT
Sbjct  2788  QDGVTRDIVSTDDCFANKHAGFDSWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGT  2847

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DF+TSACVLAAECTIFKDA GKPVPY
Sbjct  2848  VLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFSTSACVLAAECTIFKDAMGKPVPY  2907

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERS  2992
             CYDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPN YLEGSVRVVTTFD+EYCRHGTCERS
Sbjct  2908  CYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNAYLEGSVRVVTTFDAEYCRHGTCERS  2967

Query  2993  EAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGI  3052
             EAG+C+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VAGGI
Sbjct  2968  EAGICLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGI  3027

Query  3053  VAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYL  3112
             +AI+VTC AYYFM+FRRAFGEY+HVVA N  LFLMSFT+LCL P YSFLPGVYSV YLYL
Sbjct  3028  IAILVTCAAYYFMKFRRAFGEYNHVVAANAPLFLMSFTILCLAPAYSFLPGVYSVFYLYL  3087

Query  3113  TFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSF  3172
             TFY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KHF+WFF+NYL++RVVFNGV+F
Sbjct  3088  TFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHFHWFFNNYLRKRVVFNGVTF  3147

Query  3173  STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACC  3232
             STFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREAACC
Sbjct  3148  STFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACC  3207

Query  3233  HLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3292
             HLAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG
Sbjct  3208  HLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3267

Query  3293  LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKL  3352
             LWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+L+L
Sbjct  3268  LWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRL  3327

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
             KVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN TIKGSFLNGSCGSVG
Sbjct  3328  KVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVG  3387

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             FNIDYDCVSFCYMHHMELPT VHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLAWLY
Sbjct  3388  FNIDYDCVSFCYMHHMELPTEVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLY  3447

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK  3532
             AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA+LK
Sbjct  3448  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALK  3507

Query  3533  ELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLL  3592
             ELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   KR +KGTHHW+LLT LTSLL
Sbjct  3508  ELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKRIVKGTHHWMLLTFLTSLL  3567

Query  3593  VLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNM  3652
             +LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAYFNM
Sbjct  3568  ILVQSTQWSLFFFVYENAFLPFTLGIMAVAACAMLLVKHKHAFLCLFLLPSLATVAYFNM  3627

Query  3653  VYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLM  3712
             VYMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLL+LMTARTVYDD ARRVWTLM
Sbjct  3628  VYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLVLMTARTVYDDAARRVWTLM  3687

Query  3713  NVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFIT  3772
             NV+TLVYKVYYGNALDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ FIT
Sbjct  3688  NVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFIT  3747

Query  3773  GNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
             GNTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK
Sbjct  3748  GNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3807

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             +SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV
Sbjct  3808  SSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3867

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
             QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP
Sbjct  3868  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3927

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             SYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDR+AAMQRKLEKMADQAMTQM
Sbjct  3928  SYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRNAAMQRKLEKMADQAMTQM  3987

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV
Sbjct  3988  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4047

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             V+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+M+NS NLAWPLIVTALR
Sbjct  4048  VVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMENSSNLAWPLIVTALR  4107

Query  4133  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLK  4192
             ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD QDLK
Sbjct  4108  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLK  4167

Query  4193  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL  4252
             WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYL+FIKGLNNLNRGMVLGSLAATVRL
Sbjct  4168  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLHFIKGLNNLNRGMVLGSLAATVRL  4227

Query  4253  QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4312
             QAGNATEVPANSTVLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP
Sbjct  4228  QAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4287

Query  4313  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV  4372
             EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTL+NTVCTV
Sbjct  4288  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTV  4347

Query  4373  CGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             CGMWKGYGCSCDQLREPM+QSADA +FLN
Sbjct  4348  CGMWKGYGCSCDQLREPMMQSADASTFLN  4376


> sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus 
279/2005 OX=389167 GN=rep PE=3 SV=1
Length=7079

 Score = 7444 bits (19315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3523/4412 (80%), Positives = 3924/4412 (89%), Gaps = 39/4412 (1%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESL  G +EKTHVQLSLPVLQVRDVLVRGFGDSVEE L+EAR+HLK+GTCGLVE+EKGV
Sbjct  1     MESLALGVSEKTHVQLSLPVLQVRDVLVRGFGDSVEEALAEAREHLKNGTCGLVELEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDA+   HG+ +VELVAEL+GIQYGRSG TLGVLVPHVGE PVAYR 
Sbjct  61    LPQLEQPYVFIKRSDAQGTNHGYKVVELVAELDGIQYGRSGTTLGVLVPHVGETPVAYRN  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYG DLKS+DLG ELGTDP ED+++NWNTKH  GV REL+RELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGIDLKSYDLGVELGTDPIEDYEQNWNTKHGGGVLRELIRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             A+TRYVDNNFCGPDGYPLECIKDLLARAGK+ CTLSEQLD+I++KRGVYCCREHEHEI W
Sbjct  181   AFTRYVDNNFCGPDGYPLECIKDLLARAGKSMCTLSEQLDYIESKRGVYCCREHEHEIVW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             +TERSEKSYE QTPFEIK AKKFDTF GECP FVFPLNS +K IQPRVEKKK +GFMGRI
Sbjct  241   FTERSEKSYERQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVA+P ECN M LSTLMKC+HC E SWQT DF+KATCE CGTENL  EG TTCGYL
Sbjct  301   RSVYPVATPQECNDMHLSTLMKCNHCDEVSWQTCDFLKATCEQCGTENLVCEGPTTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             P NAVVK+ CPAC + EVGPEHS+A+YHN S ++T LRKGGRT  FGGCVF+YVGC+NK 
Sbjct  361   PANAVVKMPCPACQDPEVGPEHSVADYHNHSNIETRLRKGGRTKCFGGCVFAYVGCYNKR  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIG +HTG+ G+  E LN++L+EIL +++VNINIVGDF LNEE+AIILASF
Sbjct  421   AYWVPRASANIGASHTGITGDNVETLNEDLMEILNRDRVNINIVGDFHLNEEVAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SAST AFV+TVKGLDYK FK IVESCGNFKVT+G+AKKGAWNIG++KSIL+PLY F S+A
Sbjct  481   SASTCAFVDTVKGLDYKTFKDIVESCGNFKVTRGRAKKGAWNIGQEKSILTPLYGFPSQA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             A V+RSIF+R L+TA +S+  LQ+AAITILDGIS+ SLRLIDAM++TSDL TN+++VMAY
Sbjct  541   AGVIRSIFTRALDTANHSIPDLQRAAITILDGISEQSLRLIDAMVYTSDLLTNSVIVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             +TGG+VQ  +QWL+N+ GT  +KLKPV  W+E K   G+EFLRD WEI+KF+ T   +IV
Sbjct  601   VTGGLVQQITQWLSNMLGTTVDKLKPVFTWVEAKLSAGIEFLRDAWEILKFLVTGVFDIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
              GQI   +  +KE V+ F  ++NK L +C D +II GAKL+ LNLGE F+  SKGLYR+C
Sbjct  661   KGQIQVASDNLKECVKAFLDVLNKALEMCIDQVIIAGAKLRTLNLGEVFIAQSKGLYRQC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             ++ +E+  LLMPL+APKE+ F EG++  T   +EEVVLK G+L+ LE P        ++G
Sbjct  721   IRGKEQLQLLMPLRAPKEVTFFEGDSHDTVFTSEEVVLKNGELEALETPVDSFTNGAVIG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSV  839
             TPVC+NGLMLLE+KD E+YCAL+P ++ TNN F+LKGGAP K VTFG+DTV+EVQGYK+V
Sbjct  781   TPVCVNGLMLLELKDKEQYCALSPGLLATNNVFSLKGGAPVKGVTFGEDTVLEVQGYKNV  840

Query  840   NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
              ITFELDER+DKVLNEKCS YTVE GTEV EFACVVA+AV+KTLQPVS+LLT +GIDLDE
Sbjct  841   KITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE  900

Query  900   WSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQ--YEYGTEDDYQG  957
             WS+AT+YLFD++GE KL+S MYCSFYPPDE+E+  + E+EE  P     +EYGTEDDY+G
Sbjct  901   WSVATFYLFDDAGEEKLSSRMYCSFYPPDEEEDCEEYEDEEEIPEETCEHEYGTEDDYKG  960

Query  958   KPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELT  1017
              PLEFGA++                + QQ   +++     +    +   E          
Sbjct  961   LPLEFGAST----------------EIQQVDEEEEEDWLEEAIAAKPEPEPL--------  996

Query  1018  PVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNK  1077
                    VN F+GYLKLTDNV IK  DIV+EA+  KPTV+VNAANV+LKHGGGVAGALNK
Sbjct  997   ---PEEPVNQFTGYLKLTDNVAIKCVDIVKEAQHAKPTVIVNAANVHLKHGGGVAGALNK  1053

Query  1078  ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYEN  1137
             ATN AMQ ESDDYI  NGPL VGGSC+LSGHNLAK C+HVVGPN+N GED+QLLK+AY N
Sbjct  1054  ATNGAMQQESDDYIKKNGPLTVGGSCLLSGHNLAKKCMHVVGPNLNAGEDVQLLKAAYAN  1113

Query  1138  FNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEK  1197
             FN  +VLLAPLLSAGIFGA P+ SL++CV+TVRT VY AV D++LYD +V  +L+    K
Sbjct  1114  FNSQDVLLAPLLSAGIFGAKPLQSLKMCVETVRTQVYFAVNDQDLYDHVVLGYLDSLKPK  1173

Query  1198  QVE---QKIAEIPKEEVKPFITESKPSVEQ----RKQDDKKIKACVEEVTTTLEETKFLT  1250
              VE   Q+  E+ ++     +T+    +E+     K  D K KA +EEV T+LEETKFLT
Sbjct  1174  -VETPTQENLELKEQPAVETLTQENLELEELPVIEKPVDVKFKARIEEVNTSLEETKFLT  1232

Query  1251  ENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTT  1310
               LLL+ DING L+ DS  ++   D+ FL+KDAPYIVGDV+  G +T V+IP KKAGGTT
Sbjct  1233  SRLLLFADINGKLYQDSQNMLRGEDMFFLEKDAPYIVGDVISSGDITCVIIPAKKAGGTT  1292

Query  1311  EMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGT  1370
             EMLAKAL+KVP   YITTYPGQG  GYT+EEAKT L+KCKS FY+LPS   N+K+EILGT
Sbjct  1293  EMLAKALKKVPVSEYITTYPGQGCAGYTLEEAKTALRKCKSVFYVLPSKTPNDKEEILGT  1352

Query  1371  VSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTT  1430
             VSWNLREMLAHAEETRKLM +C++ KA++STI R+YKGIK+QEG+VDYG RF+FYTSK  
Sbjct  1353  VSWNLREMLAHAEETRKLMLICMDVKALMSTIHRRYKGIKVQEGIVDYGVRFFFYTSKEP  1412

Query  1431  VASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYL  1490
             VAS+I  LN LNE LVTMP+GYVTHGLNLEEAAR MRSLK PA VSVSSPDAVT YNGYL
Sbjct  1413  VASIITKLNLLNEPLVTMPIGYVTHGLNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYL  1472

Query  1491  TSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYT-SNPTTFHLDGE  1549
             TSSSKT EEHFIET+SLAG Y+DWSYSGQ T+LG+EFLKRGDK VY+T  +P  FHLDGE
Sbjct  1473  TSSSKTSEEHFIETVSLAGMYRDWSYSGQRTELGVEFLKRGDKVVYHTVGSPIQFHLDGE  1532

Query  1550  VITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKP  1609
             V+  D LK+LLSLREVRTIKVFTTVDN NLHTQ+VDMSMTYGQQFGPTYLDGADVTKIKP
Sbjct  1533  VLLLDKLKSLLSLREVRTIKVFTTVDNTNLHTQIVDMSMTYGQQFGPTYLDGADVTKIKP  1592

Query  1610  HNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKW  1669
             H  HEGKTF+VLP+DDTLR EAFEYYHT D SFLGRYMSALNHTKKWK+PQ+ GLTSIKW
Sbjct  1593  HAKHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQIGGLTSIKW  1652

Query  1670  ADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVR  1729
             ADNNCYL++ LL LQQIE+KFN PALQ+AYYRARAG+AANFCALILAY N+TVGELGDVR
Sbjct  1653  ADNNCYLSSVLLALQQIEVKFNAPALQEAYYRARAGDAANFCALILAYSNRTVGELGDVR  1712

Query  1730  ETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTC  1789
             ETM++L QHANL+S KRVLNVVCKTCGQ+ TTL GVEAVMYMGTLSYE+ K GV IPC C
Sbjct  1713  ETMTHLLQHANLESAKRVLNVVCKTCGQKSTTLTGVEAVMYMGTLSYEELKTGVTIPCIC  1772

Query  1790  GKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCID  1849
             G+ AT+YLVQQES FVMMSAPP++Y L+ G F CA+EYTG+YQCGHY H+T KETLY ID
Sbjct  1773  GRDATQYLVQQESSFVMMSAPPSEYTLQQGAFLCANEYTGSYQCGHYTHVTVKETLYRID  1832

Query  1850  GALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTE  1909
             GA LTK SEYKGP+TDVFYKE SYTTTIKPV+YKLDGV+ TEI PKLD YYKKDN+Y+TE
Sbjct  1833  GAYLTKMSEYKGPVTDVFYKEISYTTTIKPVSYKLDGVIYTEIQPKLDEYYKKDNAYYTE  1892

Query  1910  QPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVA  1969
             QPIDLVP QP PNASFDNFK  C N KFADDLNQ+TG+KKPASREL VTFFPDLNGDVVA
Sbjct  1893  QPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFKKPASRELSVTFFPDLNGDVVA  1952

Query  1970  IDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLK  2029
             IDY+HY+ SFKKGAKLLHKPI+WH+N  TNK TYKPNTWC+RCLWSTKPVETSNSF+VL+
Sbjct  1953  IDYRHYSASFKKGAKLLHKPIIWHINQTTNKTTYKPNTWCLRCLWSTKPVETSNSFEVLE  2012

Query  2030  SEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEE  2089
              ED QGMDNLACE   P SEEVVENPTIQK+V+EC+VKT EVVG++ILKP+   +K+T+E
Sbjct  2013  VEDTQGMDNLACESQTPTSEEVVENPTIQKEVIECDVKTIEVVGNVILKPSEEGVKVTQE  2072

Query  2090  VGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKV  2149
             +GH DLMAAYV+ +S+TIKKPNELS  LGL+TLATHG AA+NSVPW  I  Y KPFL + 
Sbjct  2073  LGHEDLMAAYVEETSITIKKPNELSLALGLRTLATHGAAAINSVPWSKILAYVKPFLGQA  2132

Query  2150  VSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKF  2209
               TTTN + RC+ RV  NYMPY  TLL QLCTFTRSTNSRI+AS+PTTIAKN+VKSV K 
Sbjct  2133  AVTTTNCIKRCVQRVFNNYMPYVITLLFQLCTFTRSTNSRIRASLPTTIAKNSVKSVAKL  2192

Query  2210  CLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREG  2269
             CL+   NY+KSP FSKL  I +W LLLS+CLGSLIY TAA GVL+SNLG+PSYC G RE 
Sbjct  2193  CLDVCINYVKSPKFSKLFTIAMWLLLLSICLGSLIYVTAAFGVLLSNLGIPSYCDGVRES  2252

Query  2270  YLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFL  2329
             Y+NS+NVT   +C GS  CSVCL+GLDSLD+YP+LETIQ+TISS+K DLT+ GL AEWFL
Sbjct  2253  YVNSSNVTTMDFCEGSFLCSVCLNGLDSLDSYPALETIQVTISSYKLDLTSLGLAAEWFL  2312

Query  2330  AYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFAS  2389
             AY+LFT+FFY+LGL+AIMQ+FF YFA HFISNSWLMW II++VQMAP+SAMVRMYIFFA 
Sbjct  2313  AYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFAF  2372

Query  2390  FYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHN  2449
              YYVWKSYVH++DGC SSTCMMCYKRNRATRVECTTIVNG++RSFYVYANGG+GFCK HN
Sbjct  2373  CYYVWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKAHN  2432

Query  2450  WNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAG  2509
             WNC+NCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSY+VDSV VKNG++HLYFDKAG
Sbjct  2433  WNCLNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYVVDSVAVKNGALHLYFDKAG  2492

Query  2510  QKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPI  2569
             QKTYERH LSHFVNLDNLRANNTKGSLPINVIVFDGKSKC+ES+AKSASVYYSQLMCQPI
Sbjct  2493  QKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESAAKSASVYYSQLMCQPI  2552

Query  2570  LLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNV  2629
             LLLDQALVSDVGDS EV+VKMFDAYV+TFS+TF+VPMEKLK LVATA +ELAK V+LD V
Sbjct  2553  LLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGV  2612

Query  2630  LSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLG  2689
             LSTF+SAARQG VD+DV+TKDV+ECLKLSH SD+EVTGDSCNN+MLTYNKVENMTPRDLG
Sbjct  2613  LSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLG  2672

Query  2690  ACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQ  2749
             ACIDC+ARHINAQVAKSHN++LIWNVKD+MSLSEQLRKQIRSAAKKNN+PF+LTCATTRQ
Sbjct  2673  ACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQ  2732

Query  2750  VVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGY  2809
             VVN +TTKI+LKGGKIV+ W K ++K TL+ +  A   Y+I PVH +S H  +++EIIGY
Sbjct  2733  VVNAITTKISLKGGKIVSTWFKLMLKATLLCVLAALFCYIIMPVHSLSVHDGYTNEIIGY  2792

Query  2810  KAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGL  2869
             KAI  GVTRDI +TD CFANKHA FD+WFSQRGGSY NDK+CP++AA+ITRE+GF+VPGL
Sbjct  2793  KAIQDGVTRDIMATDDCFANKHAGFDSWFSQRGGSYRNDKSCPVVAAIITREIGFIVPGL  2852

Query  2870  PGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKP  2929
             PGT+LR  NGDFLHFLPRVFSAVGNICYTPSKLIEY+DFATSACVLAAECTIFKDA GKP
Sbjct  2853  PGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKP  2912

Query  2930  VPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
             VPYCYDTN+LEGS++Y  LRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFD+EYCRHGTC
Sbjct  2913  VPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTC  2972

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             ERSEAGVC+STSGRWVLNN++YR+LPGVFCGVDA+NL+ N+FTPL+QP+GALD+SAS+VA
Sbjct  2973  ERSEAGVCLSTSGRWVLNNEHYRALPGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVA  3032

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
             GGI+AI+VTC AYYFM+FRRAFGEY+HVVA N LLFLMSFT+LCL P YSFLPGVYS+ Y
Sbjct  3033  GGIIAILVTCAAYYFMKFRRAFGEYNHVVAANALLFLMSFTILCLAPAYSFLPGVYSIFY  3092

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNG  3169
             LYLTFY TNDVSFLAH+QW  MF+P+VPFWIT  Y+ CIS KH +WFF+NYL++RV+FNG
Sbjct  3093  LYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNG  3152

Query  3170  VSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREA  3229
             V+FSTFEEAALCTFLLNKEMYLKLRS+ LLPLTQYNRYLALYNKYKYFSGA+DTTSYREA
Sbjct  3153  VTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREA  3212

Query  3230  ACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT  3289
             ACCHLAKALNDFSNSG+DVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT
Sbjct  3213  ACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTT  3272

Query  3290  LNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCV  3349
             LNGLWLDD VYCPRHVICT+EDMLNPNYEDLLIRKSNH+FLVQAGNVQLRVIGHSMQNC+
Sbjct  3273  LNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCL  3332

Query  3350  LKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCG  3409
             L+LKVDT+NPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPN+TIKGSFLNGSCG
Sbjct  3333  LRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNYTIKGSFLNGSCG  3392

Query  3410  SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLA  3469
             SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG FYGPFVDRQTAQAAGTDTTIT+NVLA
Sbjct  3393  SVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLA  3452

Query  3470  WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA  3529
             WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA
Sbjct  3453  WLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCA  3512

Query  3530  SLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILT  3589
             +LKELLQNGMNGRTILGS +LEDEFTPFDVVRQCSGVTFQ   K+ +KGTHHW+LLT LT
Sbjct  3513  ALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLT  3572

Query  3590  SLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAY  3649
             SLL+LVQSTQWSLFFF+YENAFLPF +GI+A++A AM+ VKHKHAFLCLFLLPSLATVAY
Sbjct  3573  SLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAY  3632

Query  3650  FNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVW  3709
             FNMVYMPASWVMRIMTWL++ DTSLSG++LKDCVMYASA+VLL+LMTARTVYDD ARRVW
Sbjct  3633  FNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLVLMTARTVYDDAARRVW  3692

Query  3710  TLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIF  3769
             TLMNV+TLVYKVYYGN+LDQAISMWAL+ISVTSNYSGVVTT+MFLAR IVF+CVEY P+ 
Sbjct  3693  TLMNVITLVYKVYYGNSLDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLL  3752

Query  3770  FITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL  3829
             FITGNTLQCIMLVYCFLGY C CYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL
Sbjct  3753  FITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLL  3812

Query  3830  PPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA  3889
             PPK+SIDAFKLNIKLLG+GGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA
Sbjct  3813  PPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWA  3872

Query  3890  QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS  3949
             QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS
Sbjct  3873  QCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFS  3932

Query  3950  SLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM  4009
             SLPSYAA+ATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM
Sbjct  3933  SLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAM  3992

Query  4010  TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK  4069
             TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK
Sbjct  3993  TQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK  4052

Query  4070  LMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVT  4129
             LMVV+PDY TYKNTCDG TFTYASALWEIQQVVDADSKIVQLSEI+MDNS NLAWPLIVT
Sbjct  4053  LMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSQNLAWPLIVT  4112

Query  4130  ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQ  4189
             ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN +KGGRFVLALLSD Q
Sbjct  4113  ALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQ  4172

Query  4190  DLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAAT  4249
             DLKWARFPKSDGTGTIYTELEPPCRFVTDTP+GPKVKYLYFIKGLNNLNRGMVLGSLAAT
Sbjct  4173  DLKWARFPKSDGTGTIYTELEPPCRFVTDTPRGPKVKYLYFIKGLNNLNRGMVLGSLAAT  4232

Query  4250  VRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT  4309
             VRLQAGNATEVPANS VLSFCAFAVD AKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT
Sbjct  4233  VRLQAGNATEVPANSAVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAIT  4292

Query  4310  VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
             VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIP TCANDPVGFTLKNTV
Sbjct  4293  VTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPATCANDPVGFTLKNTV  4352

Query  4370  CTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             CTVCG WKGYGCSCDQLREPM+QSADA +FLN
Sbjct  4353  CTVCGTWKGYGCSCDQLREPMMQSADASTFLN  4384


> sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus 
HKU9 OX=694006 GN=1a PE=3 SV=1
Length=4248

 Score = 2320 bits (6013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1257/3091 (41%), Positives = 1830/3091 (59%), Gaps = 121/3091 (4%)

Query  1367  ILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY-GARFYFY  1425
             ++  VS +   M+   +E   L+PV ++  A +  ++R       +EG+    G  FY Y
Sbjct  1216  LVDVVSMSFSAMVNFGKEKGLLIPVVIDYPAFLKVLKR----FSPKEGLFSSNGYEFYGY  1271

Query  1426  TSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTA  1485
             +    +  +   LN L   L+ +P G++ +G  L  +A  MR L VP TV V S  +V  
Sbjct  1272  SRDKPLHEVSKDLNSLGRPLIMIPFGFIVNGQTLAVSAVSMRGLTVPHTVVVPSESSVPL  1331

Query  1486  YNGYLT---SSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIE----FLKRGDKSVYYT  1538
             Y  Y     S   T  + F+  I L G+ +DW     +  +  +      KRG+  + + 
Sbjct  1332  YRAYFNGVFSGDTTAVQDFVVDILLNGA-RDWDVLQTTCTVDRKVYKTICKRGNTYLCF-  1389

Query  1539  SNPTTFHLDGEVI-TFDNLKTLLSLREVRT------IKVFTTVDNINLHTQVVDMSMTYG  1591
              +   + + G+V+  F  +    +  E +       IKV TTVD IN  T +V  + +Y 
Sbjct  1390  DDTNLYAITGDVVLKFATVSKARAYLETKLCAPEPLIKVLTTVDGINYSTVLVSTAQSYR  1449

Query  1592  QQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAF-EYYHTTDPSFLGRYMSAL  1650
              Q G  + DG D +   P  + EG   Y   N  +  V A  EYY   D + + R MS  
Sbjct  1450  AQIGTVFCDGHDWSNKNPMPTDEGTHLYKQDNFSSAEVTAIREYYGVDDSNIIARAMSIR  1509

Query  1651  NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANF  1710
                + W Y  V+G   +   D+NCYL  A+  LQ I++ F+ P +  AY   + G     
Sbjct  1510  KTVQTWPYTVVDGRVLLAQRDSNCYLNVAISLLQDIDVSFSTPWVCRAYDALKGGNPLPM  1569

Query  1711  CALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMY  1770
               +++A    T G   D    +S +  H  + + +RV+  VC+ CG  Q    G +A  +
Sbjct  1570  AEVLIALGKATPGVSDDAHMVLSAVLNHGTV-TARRVMQTVCEHCGVSQMVFTGTDACTF  1628

Query  1771  MGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELK-HGTFTCASEYTG  1829
              G++  +     V + C CG+ A +Y+ +Q+SP+++MS  P Q  L   G +  A  + G
Sbjct  1629  YGSVVLDDLYAPVSVVCQCGRPAIRYVSEQKSPWLLMSCTPTQVPLDTSGIWKTAIVFRG  1688

Query  1830  NYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVC  1889
                 GHY +  +   +   D     ++S+ K P TD+ Y   S+T+  K  TY LDGV  
Sbjct  1689  PVTAGHYMYAVNGTLISVYDANTRRRTSDLKLPATDILYGPTSFTSDSKVETYYLDGVKR  1748

Query  1890  TEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFV-CDNIKFADDLNQLTGYK  1948
             T IDP    Y K+ + YFT  PI++V   P    S+D F    C N + A+  N+     
Sbjct  1749  TTIDPDFSKYVKRGDYYFTTAPIEVVA-APKLVTSYDGFYLSSCQNPQLAESFNKAINAT  1807

Query  1949  KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTW  2008
             K    +L +T +P++ GDVVAI   +   +   G+  + KP+++           +PNTW
Sbjct  1808  KTGPMKL-LTMYPNVAGDVVAISDDNVV-AHPYGSLHMGKPVLF---------VTRPNTW  1856

Query  2009  C-IRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENP-TIQKDVLECNV  2066
               +  L ST  V T N++DVL              D  PV+ E  E P +++  +    +
Sbjct  1857  KKLVPLLSTVVVNTPNTYDVLAV------------DPLPVNNETSEEPISVKAPIPLYGL  1904

Query  2067  KTTEVVGDIILKPANNS-LKITEEVGHTDLMAAYVDN-SSLTIKKPNELSRVLGLKTLAT  2124
             K T V+      P N   L   +E   TDL   YV+      + K + LS+VLGL+   +
Sbjct  1905  KATMVLNGTTYVPGNKGHLLCLKEFTLTDLQTFYVEGVQPFVLLKASHLSKVLGLRV--S  1962

Query  2125  HGLAAVNSVPWDTIANYAKPFLNKVVSTTT--NIVTRCLNRV------------CTNYMP  2170
                  VN +    +  YA   L   V+T+    +VTR + +             C   + 
Sbjct  1963  DSSLHVNHLSKGVVYAYAATRLTTRVTTSLLGGLVTRSVRKTADFVRSTNPGSKCVGLLC  2022

Query  2171  YFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSP----NFSKL  2226
              F+ L ++     +     +K S    IA NT   V    L    NYL+S     ++S+L
Sbjct  2023  LFYQLFMRFWLLVKKP-PIVKVS--GIIAYNTGCGVTTCVL----NYLRSRCGNISWSRL  2075

Query  2227  INII-----IWFLL--LSVCLGSLIYSTAALGVLMSNLGMPSYCTGYRE--GYLNSTNVT  2277
             + ++     IWF+   L++C           GV +S    PS  T ++   G +   +  
Sbjct  2076  LKLLRYMLYIWFVWTCLTIC-----------GVWLSEPYAPSLVTRFKYFLGIVMPCDYV  2124

Query  2278  IATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRF  2337
             +           +C++G+DSLD YP+L   Q    S  ++ T   ++ E F AY+L+T  
Sbjct  2125  LVNETGTGWLHHLCMAGMDSLD-YPALRMQQHRYGS-PYNYTYILMLLEAFFAYLLYTPA  2182

Query  2338  FYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY  2397
               ++G+ A++ L   Y  +  + NSWL+  +  ++++ P ++M+RMYI  A  +  +K +
Sbjct  2183  LPIVGILAVLHLIVLYLPIP-LGNSWLVVFLYYIIRLVPFTSMLRMYIVIAFLWLCYKGF  2241

Query  2398  VHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDT  2457
             +HV  GCN+  C+MCYK+N A R+EC+T+VNGV+R FYV ANGG  FC  HNWNCV+CDT
Sbjct  2242  LHVRYGCNNVACLMCYKKNVAKRIECSTVVNGVKRMFYVNANGGTHFCTKHNWNCVSCDT  2301

Query  2458  FCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHS  2517
             +   STFI  +VA DLS QFKRPI  TD++ Y V SV V+NG ++ YF+  GQ++YER  
Sbjct  2302  YTVDSTFICRQVALDLSAQFKRPIIHTDEAYYEVTSVEVRNGYVYCYFESDGQRSYERFP  2361

Query  2518  LSHFVNLDNLRANNTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQAL  2576
             +  F N+  L  +  KG+ P  NV+VFD  ++ EE++ K+A++YY+QL C+PILL+D+ +
Sbjct  2362  MDAFTNVSKLHYSELKGAAPAFNVLVFDATNRIEENAVKTAAIYYAQLACKPILLVDKRM  2421

Query  2577  VSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISA  2636
             V  VGD A +A  MF+AY   +   +++ M+K+K L +TA  +++  +++++VL  F+ +
Sbjct  2422  VGVVGDDATIARAMFEAYAQNYLLKYSIAMDKVKHLYSTALQQISSGMTVESVLKVFVGS  2481

Query  2637  ARQGFVD--SDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
              R    D  SDV+T D+V C++L HQ   E T DS NN + TY K + ++  ++G  +  
Sbjct  2482  TRAEAKDLESDVDTNDLVSCIRLCHQEGWEWTTDSWNNLVPTYIKQDTLSTLEVGQFMTA  2541

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +A+++NA +AK   + LIW   DF+ LSE +R+Q++ AA+K  L   +T ++ +  V  +
Sbjct  2542  NAKYVNANIAKGAAVNLIWRYADFIKLSESMRRQLKVAARKTGLNLLVTTSSLKADVPCM  2601

Query  2755  TTKIALKGG-KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAID  2813
              T   + GG + + +W + LI V ++ + +   ++  TP ++M         ++ +K ID
Sbjct  2602  VTPFKIIGGHRRIVSWRRVLIHVFMLLVVLNPQWF--TPWYIMRP---IEYNVVDFKVID  2656

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTI  2873
               V RDI S D CFANK + F+ W+S R GSY N + CP++  V++  VG +VPGLP   
Sbjct  2657  NAVIRDITSADQCFANKFSAFENWYSNRYGSYVNSRGCPMVVGVVSDIVGSLVPGLPARF  2716

Query  2874  LRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYC  2933
             LR      L  +     AVG++CYTP   I Y  F TSACVLAA CT+F  ASG+ +PYC
Sbjct  2717  LRVGT-TLLPLVNYGLGAVGSVCYTPHYAINYDVFDTSACVLAATCTLFSSASGERMPYC  2775

Query  2934  YDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCERS  2992
              D  +++ +  Y+ L+P   Y   + S  I+FP   +   V +V T   EYC+ G C+ S
Sbjct  2776  ADAALIQNASRYDMLKPHVMYPFYEHSGYIRFPEV-ISAGVHIVRTMAMEYCKVGRCDVS  2834

Query  2993  EAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGI  3052
             EAG+C+S   RWV+NN Y+R   GV+CG  A +L  NM  P+  P+GA+DI+ SI+ G +
Sbjct  2835  EAGLCMSLQPRWVVNNAYFRQQSGVYCGTSAFDLFMNMLLPIFTPVGAVDITTSILMGAL  2894

Query  3053  VAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYL  3112
             +A+VV+   YY +RFRRAFG+YS V+  N L F+++  VLCL   Y  LP +Y++++LY 
Sbjct  2895  LAVVVSMSLYYLLRFRRAFGDYSGVIFTNILAFVLNVIVLCLEGPYPMLPSIYAMVFLYA  2954

Query  3113  TFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSF  3172
             T Y  +D++ + H+ +++MF  +VP W+T+ YI+ + ++H  WF S   KR V    ++F
Sbjct  2955  TCYFGSDIACMMHVSFLIMFAGVVPLWVTVLYIVVVLSRHILWFASLCTKRTVQVGDLAF  3014

Query  3173  STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACC  3232
              +F++AAL TF+L+KE++L+L+ ++      Y +YLA+YNKYKY+SG MDT +YREAAC 
Sbjct  3015  HSFQDAALQTFMLDKEVFLRLKREI--SSDAYFKYLAMYNKYKYYSGPMDTAAYREAACS  3072

Query  3233  HLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3292
             HL  AL  +SN G D +YQPP+ S+ SA LQ+G  +MA PSG VE C+V+V  G+ TLNG
Sbjct  3073  HLVMALEKYSNGGGDTIYQPPRCSVASAALQAGLTRMAHPSGLVEPCLVKVNYGSMTLNG  3132

Query  3293  LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKL  3352
             +WLD+ V CPRHV+C+ +++ NP+Y  L +R +N++F V      +RVIGH+M+  +LKL
Sbjct  3133  IWLDNFVICPRHVMCSRDELANPDYPRLSMRAANYDFHVSQNGHNIRVIGHTMEGSLLKL  3192

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
              VD  NPKTP Y F+R+  GQ  S+LACY+G P+GVY C +R N T++ SFL GSCGS G
Sbjct  3193  TVDVNNPKTPAYSFIRVSTGQAMSLLACYDGLPTGVYTCTLRSNGTMRASFLCGSCGSPG  3252

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             F ++   V FCY+H +ELP G H GTD  G FYGPF D+Q  Q A  D TITVNVLAWLY
Sbjct  3253  FVMNGKEVQFCYLHQLELPNGTHTGTDFSGVFYGPFEDKQVPQLAAPDCTITVNVLAWLY  3312

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK  3532
             AAV++G+ WFL + + +  +FN  A+KY  + +T + + +L PL+A+TGI+V  M ++LK
Sbjct  3313  AAVLSGENWFLTKSSISPAEFNNCAVKYMCQSVTSESLQVLQPLAAKTGISVERMLSALK  3372

Query  3533  ELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLL  3592
              LL  G  GRTI+GS  LEDE TP+D+ RQ  GV  Q   +   + T  W  +  + ++L
Sbjct  3373  VLLSAGFCGRTIMGSCSLEDEHTPYDIGRQMLGVKLQGKFQSMFRWTLQWFAIIFVLTIL  3432

Query  3593  VLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNM  3652
             +L+Q  QW+    L     LP    +     F  + +KHKH +L ++LLP     AY+N 
Sbjct  3433  ILLQLAQWTFVGALPFTLLLPLIGFVAVCVGFVSLLIKHKHTYLTVYLLPVAMVTAYYNF  3492

Query  3653  VYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLM  3712
              Y P      +++  + V+         D +      V   L++ R V  D   R+W + 
Sbjct  3493  QYTPEGVQGYLLSLYNYVNPGRIDVIGTDLLTMLIISVACTLLSVRMVRTDAYSRIWYVC  3552

Query  3713  NVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFIT  3772
               +  +Y  + G+A   AIS    ++SV +NY+GV    ++ A+ +V++     P   + 
Sbjct  3553  TAVGWLYNCWTGSADTVAISYLTFMVSVFTNYTGVACASLYAAQFMVWVLKFLDPTILLL  3612

Query  3773  GNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
                 +C+++ Y  +GY CTCYFG+F L+NR FR TLG Y+Y+VS+QE RYMNS GLLPP 
Sbjct  3613  YGRFRCVLVCYLLVGYLCTCYFGVFNLINRLFRCTLGNYEYVVSSQELRYMNSHGLLPPT  3672

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             NS  A  LNIKL G+GG P  +V+T+QS M+D+KCTSVVLLSVLQQLRVESSSKLWA CV
Sbjct  3673  NSWQALMLNIKLAGIGGIPIYRVSTIQSNMTDLKCTSVVLLSVLQQLRVESSSKLWALCV  3732

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
             +LHN+IL +   TEAFE  VSLLSVLLS+ GA+++++LC  +L+N + LQA+ASEFS+L 
Sbjct  3733  KLHNEILASNSPTEAFEAFVSLLSVLLSLPGAINLDELCSSILENNSVLQAVASEFSNLS  3792

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             SY  +  AQ+AY+ AVA G     +  LKK++NVAKS  D+D A  RKLE+M++ AMT M
Sbjct  3793  SYVDYENAQKAYDTAVATGAPASTVNALKKAMNVAKSVLDKDVATTRKLERMSELAMTAM  3852

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YKQAR+ED+R+KVT+AMQTMLF M+R+LD+DAL+NI+NNAR+G VPL +IP T A KL++
Sbjct  3853  YKQARAEDRRSKVTAAMQTMLFNMIRRLDSDALSNILNNARNGVVPLGVIPRTAANKLLL  3912

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             V+PD++ Y  T    T TYA + W++ QV DAD K V  ++I+ +NS NLAWPL+VTA R
Sbjct  3913  VVPDFSVYTATITMPTLTYAGSAWDVMQVADADGKTVNATDITRENSVNLAWPLVVTAQR  3972

Query  4133  --ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQD  4190
               A S VKLQNNEL P  +++M+  AG +QTAC  D A+AYYN TK GR V+A+L+D   
Sbjct  3973  QQATSPVKLQNNELMPQTVKRMNVVAGVSQTACVTD-AVAYYNATKEGRHVMAILADTDG  4031

Query  4191  LKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATV  4250
             L +A+  KS G G +  ELEPPC+F+ DTPKGP +KYLYF KGL NL RG VLG+LA TV
Sbjct  4032  LAFAKVEKSTGDGFVILELEPPCKFMVDTPKGPALKYLYFTKGLKNLCRGTVLGTLACTV  4091

Query  4251  RLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITV  4310
             RL AG+ATEV +NS++LS C+F+VD    YKDYL +GG PI NCVKML  HTGTG AIT 
Sbjct  4092  RLHAGSATEVASNSSILSLCSFSVDPEATYKDYLDNGGSPIGNCVKMLTPHTGTGLAITA  4151

Query  4311  TPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC  4370
              P+AN+DQESFGGASCCLYCRCHI+HP   G C  KGK+VQIP    NDP+GF ++N VC
Sbjct  4152  KPDANIDQESFGGASCCLYCRCHIEHPGASGVCKYKGKFVQIPLVGVNDPIGFCIRNVVC  4211

Query  4371  TVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
              VC MW+GYGC C  LRE  LQ+ D + FLN
Sbjct  4212  AVCNMWQGYGCPCSSLREINLQARD-ECFLN  4241


 Score =  266 bits (680),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 324/1244 (26%), Positives = 519/1244 (42%), Gaps = 217/1244 (17%)

Query  28    VRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV--LPQLEQPYVFIKRSDARTAPHG-HV  84
             V G+   +EE L  A+Q L+     LV V   +   P +    V I  S       G   
Sbjct  29    VTGWDIPIEEALEYAKQQLRTPEPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQP  88

Query  85    MVELVAELEGIQYGRSGETLGVLVPH------VGEIPVAYRKVLLRKNGNKGAGGHSYGA  138
             + EL  + +G++YGR G T GVL+P       +G+I +  RK         G G +S   
Sbjct  89    IRELAMDKDGVRYGRGG-THGVLLPMQDPSFIMGDIDIQIRKY--------GIGANSPPD  139

Query  139   DLKSFDLGDELGTD--PYEDFQENW-NTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDG  195
              L  +D   + G D  PY DF +N   TK  +    ++      G      DNN     G
Sbjct  140   VLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGGDVYLSDQYG-----FDNN-----G  189

Query  196   YPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPF  255
               +E +  LL    K+  TL + L  +    G Y              R+E  Y+L   +
Sbjct  190   ILVEPVMKLLGVI-KSDFTLEQLLAAL----GKY--------------RTEDGYDLPDGY  230

Query  256   ---EIKLAKK------------FDTFNGECPNFVFPLN--SIIKTIQPRVEKKKLDGFMG  298
                 IK+ +K                    P + +P +  S+++  +P            
Sbjct  231   VKVAIKVGRKAVPVLKQSIFTVVGVTEQLVPGYYYPFSTSSVVEHTKPTRGGPVGKTVEA  290

Query  299   RIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTE-NLTKEGATTC  357
              + S+Y     N  N       +KC +C    W     +      CG E  LT    ++C
Sbjct  291   VMLSLY---GTNNYNPATPVARLKCSYCDYYGWTPLKDIGTVNCLCGAEFQLT----SSC  343

Query  358   GYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRT-IAFGGCVFSYVGC  416
                    V+K   P C          +       G++ I   G RT ++FGG ++S +G 
Sbjct  344   VDAESAGVIK---PGC----------VMLLDKSPGMRLI--PGNRTYVSFGGAIWSPIGK  388

Query  417   HNKCAYWVPRASANIGCNHTGVVGEG-SEGLNDNLLEILQKEKVNINIVGDFKLNEEIAI  475
              N    WVPRA + +   H+G VG G +  +N  L+E L +    I +  D   N   A 
Sbjct  389   VNGVTVWVPRAYSIVAGEHSGAVGSGDTVAINKELVEYLIE---GIRVDADTLDNPTCAT  445

Query  476   ILASFSASTSA----FVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILS  531
              +A+    T A     VE+++GL           C   K+  G          E    + 
Sbjct  446   FIANLDCDTKAPVVHTVESLQGL-----------CLANKIMLGDKP---LPTDEFHPFIV  491

Query  532   PLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLA  591
              L A+  + A    ++ SRT E  ++ VR  ++         +Q+  ++   +       
Sbjct  492   GL-AYHVQRACWYGALASRTFEAFRDFVRTEEER-------FAQFFGKVCAPI-------  536

Query  592   TNNLVVMAYITGGVVQLTSQWLTN------------IFGTVYEKLKPVLDWLEEKFKEGV  639
              N  V +AY TG V   ++  + N            +   V + LKP+L+W+ +K    +
Sbjct  537   -NGCVYLAYTTGRVTLFSAYQVLNTAIAKSKDAFGGVAAIVVDMLKPILEWVLKK----M  591

Query  640   EFLRDGW----EIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIII  695
                +  W    E +  +      +V G+       +     +   L+   ++    S+  
Sbjct  592   SIAKGAWLPYAEGLLALFKAQFTVVKGKFQFLRASLNSKCHSLCDLLTTIMSKLLTSVKW  651

Query  696   GGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLM-PLKAPKEIIFLEGETLPTEVLTE  754
              G K+ AL  G  +    KG+  +     +  GLL+ P +   E+  L+G+      LT+
Sbjct  652   AGCKVDALYTGTYYYFSRKGVLTEVQLCAKRLGLLLTPKQQKMEVEVLDGDFDAPVTLTD  711

Query  755   EVVLKTGDLQPLEQPTSEAVEAPLV-GTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTF  813
                L+  +   + +    A +  LV GT V +   + +  +D   Y     +  V    F
Sbjct  712   ---LELEECTGVLEEVFGASDVKLVKGTLVSLASKLFVRTEDGFLY-RYVKSGGVLGKAF  767

Query  814   TLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFAC  873
              L+GG  +KVTFGD+ V  +    +VN ++++ E +D +L++  + + VE GT++ + AC
Sbjct  768   RLRGGGVSKVTFGDEEVHTIPNTVTVNFSYDVCEGLDAILDKVMAPFQVEEGTKLEDLAC  827

Query  874   VVADAVIKTLQPV----SELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYP--P  927
             VV  AV + L  +       L P  I+L+++  +  +++ +  E  L   MY S     P
Sbjct  828   VVQKAVYERLSDLFSDCPAELRP--INLEDFLTSECFVYSKDYEKILMPEMYFSLEDAVP  885

Query  928   DEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQT  987
              +DE   D E+                              ++   + ++ WL D     
Sbjct  886   VDDEMVDDIED-----------------------------TVEQASDSDDQWLGD-----  911

Query  988   VGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVE  1047
                 +G+ED       TI +V     M  TP           GY K+ ++VYIK ADIV+
Sbjct  912   ----EGAEDCD----NTIQDVDVATSMT-TP----------CGYTKIAEHVYIKCADIVQ  952

Query  1048  EAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSG  1107
             EA+     V+VNAANV L HGGGVAGALN+ATNNAMQ ES +YI  NG L+ GG  +LS 
Sbjct  953   EARNYSYAVLVNAANVNLHHGGGVAGALNRATNNAMQKESSEYIKANGSLQPGGHVLLSS  1012

Query  1108  HNLAKH-CLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             H LA H  LHVVGP+   G+D+ LL + Y  +   + +L PL+SAGIFG     SL   V
Sbjct  1013  HGLASHGILHVVGPDKRLGQDLALLDAVYAAYTGFDSVLTPLVSAGIFGFTVEESLCSLV  1072

Query  1167  DTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEE  1210
               V    Y+ V+D+ LY++ +++  ++   +   Q +  I   E
Sbjct  1073  KNVACTTYVVVYDRQLYERALATSFDVPGPQSSVQHVPAIDWAE  1116


> sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU9 OX=694006 GN=rep PE=1 SV=1
Length=6930

 Score = 2318 bits (6006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1257/3091 (41%), Positives = 1830/3091 (59%), Gaps = 121/3091 (4%)

Query  1367  ILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY-GARFYFY  1425
             ++  VS +   M+   +E   L+PV ++  A +  ++R       +EG+    G  FY Y
Sbjct  1216  LVDVVSMSFSAMVNFGKEKGLLIPVVIDYPAFLKVLKR----FSPKEGLFSSNGYEFYGY  1271

Query  1426  TSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTA  1485
             +    +  +   LN L   L+ +P G++ +G  L  +A  MR L VP TV V S  +V  
Sbjct  1272  SRDKPLHEVSKDLNSLGRPLIMIPFGFIVNGQTLAVSAVSMRGLTVPHTVVVPSESSVPL  1331

Query  1486  YNGYLT---SSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIE----FLKRGDKSVYYT  1538
             Y  Y     S   T  + F+  I L G+ +DW     +  +  +      KRG+  + + 
Sbjct  1332  YRAYFNGVFSGDTTAVQDFVVDILLNGA-RDWDVLQTTCTVDRKVYKTICKRGNTYLCF-  1389

Query  1539  SNPTTFHLDGEVI-TFDNLKTLLSLREVRT------IKVFTTVDNINLHTQVVDMSMTYG  1591
              +   + + G+V+  F  +    +  E +       IKV TTVD IN  T +V  + +Y 
Sbjct  1390  DDTNLYAITGDVVLKFATVSKARAYLETKLCAPEPLIKVLTTVDGINYSTVLVSTAQSYR  1449

Query  1592  QQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAF-EYYHTTDPSFLGRYMSAL  1650
              Q G  + DG D +   P  + EG   Y   N  +  V A  EYY   D + + R MS  
Sbjct  1450  AQIGTVFCDGHDWSNKNPMPTDEGTHLYKQDNFSSAEVTAIREYYGVDDSNIIARAMSIR  1509

Query  1651  NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANF  1710
                + W Y  V+G   +   D+NCYL  A+  LQ I++ F+ P +  AY   + G     
Sbjct  1510  KTVQTWPYTVVDGRVLLAQRDSNCYLNVAISLLQDIDVSFSTPWVCRAYDALKGGNPLPM  1569

Query  1711  CALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMY  1770
               +++A    T G   D    +S +  H  + + +RV+  VC+ CG  Q    G +A  +
Sbjct  1570  AEVLIALGKATPGVSDDAHMVLSAVLNHGTV-TARRVMQTVCEHCGVSQMVFTGTDACTF  1628

Query  1771  MGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELK-HGTFTCASEYTG  1829
              G++  +     V + C CG+ A +Y+ +Q+SP+++MS  P Q  L   G +  A  + G
Sbjct  1629  YGSVVLDDLYAPVSVVCQCGRPAIRYVSEQKSPWLLMSCTPTQVPLDTSGIWKTAIVFRG  1688

Query  1830  NYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVC  1889
                 GHY +  +   +   D     ++S+ K P TD+ Y   S+T+  K  TY LDGV  
Sbjct  1689  PVTAGHYMYAVNGTLISVYDANTRRRTSDLKLPATDILYGPTSFTSDSKVETYYLDGVKR  1748

Query  1890  TEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFV-CDNIKFADDLNQLTGYK  1948
             T IDP    Y K+ + YFT  PI++V   P    S+D F    C N + A+  N+     
Sbjct  1749  TTIDPDFSKYVKRGDYYFTTAPIEVVA-APKLVTSYDGFYLSSCQNPQLAESFNKAINAT  1807

Query  1949  KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTW  2008
             K    +L +T +P++ GDVVAI   +   +   G+  + KP+++           +PNTW
Sbjct  1808  KTGPMKL-LTMYPNVAGDVVAISDDNVV-AHPYGSLHMGKPVLF---------VTRPNTW  1856

Query  2009  C-IRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENP-TIQKDVLECNV  2066
               +  L ST  V T N++DVL              D  PV+ E  E P +++  +    +
Sbjct  1857  KKLVPLLSTVVVNTPNTYDVLAV------------DPLPVNNETSEEPISVKAPIPLYGL  1904

Query  2067  KTTEVVGDIILKPANNS-LKITEEVGHTDLMAAYVDN-SSLTIKKPNELSRVLGLKTLAT  2124
             K T V+      P N   L   +E   TDL   YV+      + K + LS+VLGL+   +
Sbjct  1905  KATMVLNGTTYVPGNKGHLLCLKEFTLTDLQTFYVEGVQPFVLLKASHLSKVLGLRV--S  1962

Query  2125  HGLAAVNSVPWDTIANYAKPFLNKVVSTTT--NIVTRCLNRV------------CTNYMP  2170
                  VN +    +  YA   L   V+T+    +VTR + +             C   + 
Sbjct  1963  DSSLHVNHLSKGVVYAYAATRLTTRVTTSLLGGLVTRSVRKTADFVRSTNPGSKCVGLLC  2022

Query  2171  YFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSP----NFSKL  2226
              F+ L ++     +     +K S    IA NT   V    L    NYL+S     ++S+L
Sbjct  2023  LFYQLFMRFWLLVKKP-PIVKVS--GIIAYNTGCGVTTCVL----NYLRSRCGNISWSRL  2075

Query  2227  INII-----IWFLL--LSVCLGSLIYSTAALGVLMSNLGMPSYCTGYRE--GYLNSTNVT  2277
             + ++     IWF+   L++C           GV +S    PS  T ++   G +   +  
Sbjct  2076  LKLLRYMLYIWFVWTCLTIC-----------GVWLSEPYAPSLVTRFKYFLGIVMPCDYV  2124

Query  2278  IATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRF  2337
             +           +C++G+DSLD YP+L   Q    S  ++ T   ++ E F AY+L+T  
Sbjct  2125  LVNETGTGWLHHLCMAGMDSLD-YPALRMQQHRYGS-PYNYTYILMLLEAFFAYLLYTPA  2182

Query  2338  FYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY  2397
               ++G+ A++ L   Y  +  + NSWL+  +  ++++ P ++M+RMYI  A  +  +K +
Sbjct  2183  LPIVGILAVLHLIVLYLPIP-LGNSWLVVFLYYIIRLVPFTSMLRMYIVIAFLWLCYKGF  2241

Query  2398  VHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDT  2457
             +HV  GCN+  C+MCYK+N A R+EC+T+VNGV+R FYV ANGG  FC  HNWNCV+CDT
Sbjct  2242  LHVRYGCNNVACLMCYKKNVAKRIECSTVVNGVKRMFYVNANGGTHFCTKHNWNCVSCDT  2301

Query  2458  FCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHS  2517
             +   STFI  +VA DLS QFKRPI  TD++ Y V SV V+NG ++ YF+  GQ++YER  
Sbjct  2302  YTVDSTFICRQVALDLSAQFKRPIIHTDEAYYEVTSVEVRNGYVYCYFESDGQRSYERFP  2361

Query  2518  LSHFVNLDNLRANNTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQAL  2576
             +  F N+  L  +  KG+ P  NV+VFD  ++ EE++ K+A++YY+QL C+PILL+D+ +
Sbjct  2362  MDAFTNVSKLHYSELKGAAPAFNVLVFDATNRIEENAVKTAAIYYAQLACKPILLVDKRM  2421

Query  2577  VSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISA  2636
             V  VGD A +A  MF+AY   +   +++ M+K+K L +TA  +++  +++++VL  F+ +
Sbjct  2422  VGVVGDDATIARAMFEAYAQNYLLKYSIAMDKVKHLYSTALQQISSGMTVESVLKVFVGS  2481

Query  2637  ARQGFVD--SDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
              R    D  SDV+T D+V C++L HQ   E T DS NN + TY K + ++  ++G  +  
Sbjct  2482  TRAEAKDLESDVDTNDLVSCIRLCHQEGWEWTTDSWNNLVPTYIKQDTLSTLEVGQFMTA  2541

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +A+++NA +AK   + LIW   DF+ LSE +R+Q++ AA+K  L   +T ++ +  V  +
Sbjct  2542  NAKYVNANIAKGAAVNLIWRYADFIKLSESMRRQLKVAARKTGLNLLVTTSSLKADVPCM  2601

Query  2755  TTKIALKGG-KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAID  2813
              T   + GG + + +W + LI V ++ + +   ++  TP ++M         ++ +K ID
Sbjct  2602  VTPFKIIGGHRRIVSWRRVLIHVFMLLVVLNPQWF--TPWYIMRP---IEYNVVDFKVID  2656

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTI  2873
               V RDI S D CFANK + F+ W+S R GSY N + CP++  V++  VG +VPGLP   
Sbjct  2657  NAVIRDITSADQCFANKFSAFENWYSNRYGSYVNSRGCPMVVGVVSDIVGSLVPGLPARF  2716

Query  2874  LRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYC  2933
             LR      L  +     AVG++CYTP   I Y  F TSACVLAA CT+F  ASG+ +PYC
Sbjct  2717  LRVGT-TLLPLVNYGLGAVGSVCYTPHYAINYDVFDTSACVLAATCTLFSSASGERMPYC  2775

Query  2934  YDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCERS  2992
              D  +++ +  Y+ L+P   Y   + S  I+FP   +   V +V T   EYC+ G C+ S
Sbjct  2776  ADAALIQNASRYDMLKPHVMYPFYEHSGYIRFPEV-ISAGVHIVRTMAMEYCKVGRCDVS  2834

Query  2993  EAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGI  3052
             EAG+C+S   RWV+NN Y+R   GV+CG  A +L  NM  P+  P+GA+DI+ SI+ G +
Sbjct  2835  EAGLCMSLQPRWVVNNAYFRQQSGVYCGTSAFDLFMNMLLPIFTPVGAVDITTSILMGAL  2894

Query  3053  VAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYL  3112
             +A+VV+   YY +RFRRAFG+YS V+  N L F+++  VLCL   Y  LP +Y++++LY 
Sbjct  2895  LAVVVSMSLYYLLRFRRAFGDYSGVIFTNILAFVLNVIVLCLEGPYPMLPSIYAMVFLYA  2954

Query  3113  TFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSF  3172
             T Y  +D++ + H+ +++MF  +VP W+T+ YI+ + ++H  WF S   KR V    ++F
Sbjct  2955  TCYFGSDIACMMHVSFLIMFAGVVPLWVTVLYIVVVLSRHILWFASLCTKRTVQVGDLAF  3014

Query  3173  STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACC  3232
              +F++AAL TF+L+KE++L+L+ ++      Y +YLA+YNKYKY+SG MDT +YREAAC 
Sbjct  3015  HSFQDAALQTFMLDKEVFLRLKREI--SSDAYFKYLAMYNKYKYYSGPMDTAAYREAACS  3072

Query  3233  HLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG  3292
             HL  AL  +SN G D +YQPP+ S+ SA LQ+G  +MA PSG VE C+V+V  G+ TLNG
Sbjct  3073  HLVMALEKYSNGGGDTIYQPPRCSVASAALQAGLTRMAHPSGLVEPCLVKVNYGSMTLNG  3132

Query  3293  LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKL  3352
             +WLD+ V CPRHV+C+ +++ NP+Y  L +R +N++F V      +RVIGH+M+  +LKL
Sbjct  3133  IWLDNFVICPRHVMCSRDELANPDYPRLSMRAANYDFHVSQNGHNIRVIGHTMEGSLLKL  3192

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
              VD  NPKTP Y F+R+  GQ  S+LACY+G P+GVY C +R N T++ SFL GSCGS G
Sbjct  3193  TVDVNNPKTPAYSFIRVSTGQAMSLLACYDGLPTGVYTCTLRSNGTMRASFLCGSCGSPG  3252

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             F ++   V FCY+H +ELP G H GTD  G FYGPF D+Q  Q A  D TITVNVLAWLY
Sbjct  3253  FVMNGKEVQFCYLHQLELPNGTHTGTDFSGVFYGPFEDKQVPQLAAPDCTITVNVLAWLY  3312

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK  3532
             AAV++G+ WFL + + +  +FN  A+KY  + +T + + +L PL+A+TGI+V  M ++LK
Sbjct  3313  AAVLSGENWFLTKSSISPAEFNNCAVKYMCQSVTSESLQVLQPLAAKTGISVERMLSALK  3372

Query  3533  ELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLL  3592
              LL  G  GRTI+GS  LEDE TP+D+ RQ  GV  Q   +   + T  W  +  + ++L
Sbjct  3373  VLLSAGFCGRTIMGSCSLEDEHTPYDIGRQMLGVKLQGKFQSMFRWTLQWFAIIFVLTIL  3432

Query  3593  VLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNM  3652
             +L+Q  QW+    L     LP    +     F  + +KHKH +L ++LLP     AY+N 
Sbjct  3433  ILLQLAQWTFVGALPFTLLLPLIGFVAVCVGFVSLLIKHKHTYLTVYLLPVAMVTAYYNF  3492

Query  3653  VYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLM  3712
              Y P      +++  + V+         D +      V   L++ R V  D   R+W + 
Sbjct  3493  QYTPEGVQGYLLSLYNYVNPGRIDVIGTDLLTMLIISVACTLLSVRMVRTDAYSRIWYVC  3552

Query  3713  NVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFIT  3772
               +  +Y  + G+A   AIS    ++SV +NY+GV    ++ A+ +V++     P   + 
Sbjct  3553  TAVGWLYNCWTGSADTVAISYLTFMVSVFTNYTGVACASLYAAQFMVWVLKFLDPTILLL  3612

Query  3773  GNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
                 +C+++ Y  +GY CTCYFG+F L+NR FR TLG Y+Y+VS+QE RYMNS GLLPP 
Sbjct  3613  YGRFRCVLVCYLLVGYLCTCYFGVFNLINRLFRCTLGNYEYVVSSQELRYMNSHGLLPPT  3672

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             NS  A  LNIKL G+GG P  +V+T+QS M+D+KCTSVVLLSVLQQLRVESSSKLWA CV
Sbjct  3673  NSWQALMLNIKLAGIGGIPIYRVSTIQSNMTDLKCTSVVLLSVLQQLRVESSSKLWALCV  3732

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
             +LHN+IL +   TEAFE  VSLLSVLLS+ GA+++++LC  +L+N + LQA+ASEFS+L 
Sbjct  3733  KLHNEILASNSPTEAFEAFVSLLSVLLSLPGAINLDELCSSILENNSVLQAVASEFSNLS  3792

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             SY  +  AQ+AY+ AVA G     +  LKK++NVAKS  D+D A  RKLE+M++ AMT M
Sbjct  3793  SYVDYENAQKAYDTAVATGAPASTVNALKKAMNVAKSVLDKDVATTRKLERMSELAMTAM  3852

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YKQAR+ED+R+KVT+AMQTMLF M+R+LD+DAL+NI+NNAR+G VPL +IP T A KL++
Sbjct  3853  YKQARAEDRRSKVTAAMQTMLFNMIRRLDSDALSNILNNARNGVVPLGVIPRTAANKLLL  3912

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             V+PD++ Y  T    T TYA + W++ QV DAD K V  ++I+ +NS NLAWPL+VTA R
Sbjct  3913  VVPDFSVYTATITMPTLTYAGSAWDVMQVADADGKTVNATDITRENSVNLAWPLVVTAQR  3972

Query  4133  --ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQD  4190
               A S VKLQNNEL P  +++M+  AG +QTAC  D A+AYYN TK GR V+A+L+D   
Sbjct  3973  QQATSPVKLQNNELMPQTVKRMNVVAGVSQTACVTD-AVAYYNATKEGRHVMAILADTDG  4031

Query  4191  LKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATV  4250
             L +A+  KS G G +  ELEPPC+F+ DTPKGP +KYLYF KGL NL RG VLG+LA TV
Sbjct  4032  LAFAKVEKSTGDGFVILELEPPCKFMVDTPKGPALKYLYFTKGLKNLCRGTVLGTLACTV  4091

Query  4251  RLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITV  4310
             RL AG+ATEV +NS++LS C+F+VD    YKDYL +GG PI NCVKML  HTGTG AIT 
Sbjct  4092  RLHAGSATEVASNSSILSLCSFSVDPEATYKDYLDNGGSPIGNCVKMLTPHTGTGLAITA  4151

Query  4311  TPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC  4370
              P+AN+DQESFGGASCCLYCRCHI+HP   G C  KGK+VQIP    NDP+GF ++N VC
Sbjct  4152  KPDANIDQESFGGASCCLYCRCHIEHPGASGVCKYKGKFVQIPLVGVNDPIGFCIRNVVC  4211

Query  4371  TVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
              VC MW+GYGC C  LRE  LQ+ D + FLN
Sbjct  4212  AVCNMWQGYGCPCSSLREINLQARD-ECFLN  4241


 Score =  267 bits (683),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 326/1244 (26%), Positives = 519/1244 (42%), Gaps = 217/1244 (17%)

Query  28    VRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV--LPQLEQPYVFIKRSDARTAPHG-HV  84
             V G+   +EE L  A+Q L+     LV V   +   P +    V I  S       G   
Sbjct  29    VTGWDIPIEEALEYAKQQLRTPEPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQP  88

Query  85    MVELVAELEGIQYGRSGETLGVLVPH------VGEIPVAYRKVLLRKNGNKGAGGHSYGA  138
             + EL  + +G++YGR G T GVL+P       +G+I +  RK         G G +S   
Sbjct  89    IRELAMDKDGVRYGRGG-THGVLLPMQDPSFIMGDIDIQIRKY--------GIGANSPPD  139

Query  139   DLKSFDLGDELGTD--PYEDFQENW-NTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDG  195
              L  +D   + G D  PY DF +N   TK  +    ++      G      DNN     G
Sbjct  140   VLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGGDVYLSDQYG-----FDNN-----G  189

Query  196   YPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPF  255
               +E +  LL    K+  TL + L  +    G Y              R+E  Y+L   +
Sbjct  190   ILVEPVMKLLGVI-KSDFTLEQLLAAL----GKY--------------RTEDGYDLPDGY  230

Query  256   ---EIKLAKK------------FDTFNGECPNFVFPLN--SIIKTIQPRVEKKKLDGFMG  298
                 IK+ +K                    P + +P +  S+++  +P            
Sbjct  231   VKVAIKVGRKAVPVLKQSIFTVVGVTEQLVPGYYYPFSTSSVVEHTKPTRGGPVGKTVEA  290

Query  299   RIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTE-NLTKEGATTC  357
              + S+Y     N  N       +KC +C    W     +      CG E  LT    ++C
Sbjct  291   VMLSLY---GTNNYNPATPVARLKCSYCDYYGWTPLKDIGTVNCLCGAEFQLT----SSC  343

Query  358   GYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRT-IAFGGCVFSYVGC  416
                    V+K   P C          +       G++ I   G RT ++FGG ++S +G 
Sbjct  344   VDAESAGVIK---PGC----------VMLLDKSPGMRLI--PGNRTYVSFGGAIWSPIGK  388

Query  417   HNKCAYWVPRASANIGCNHTGVVGEGSE-GLNDNLLEILQKEKVNINIVGDFKLNEEIAI  475
              N    WVPRA + +   H+G VG G    +N  L+E L +    I +  D   N   A 
Sbjct  389   VNGVTVWVPRAYSIVAGEHSGAVGSGDTVAINKELVEYLIE---GIRVDADTLDNPTCAT  445

Query  476   ILASFSASTSA----FVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILS  531
              +A+    T A     VE+++GL           C   K+  G          E    + 
Sbjct  446   FIANLDCDTKAPVVHTVESLQGL-----------CLANKIMLGDKP---LPTDEFHPFIV  491

Query  532   PLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLA  591
              L A+  + A    ++ SRT E  ++ VR  ++         +Q+  ++   +       
Sbjct  492   GL-AYHVQRACWYGALASRTFEAFRDFVRTEEER-------FAQFFGKVCAPI-------  536

Query  592   TNNLVVMAYITGGVVQLTSQWLTNI--------FG----TVYEKLKPVLDWLEEKFKEGV  639
              N  V +AY TG V   ++  + N         FG     V + LKP+L+W+ +K    +
Sbjct  537   -NGCVYLAYTTGRVTLFSAYQVLNTAIAKSKDAFGGVAAIVVDMLKPILEWVLKK----M  591

Query  640   EFLRDGW----EIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIII  695
                +  W    E +  +      +V G+       +     +   L+   ++    S+  
Sbjct  592   SIAKGAWLPYAEGLLALFKAQFTVVKGKFQFLRASLNSKCHSLCDLLTTIMSKLLTSVKW  651

Query  696   GGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLM-PLKAPKEIIFLEGETLPTEVLTE  754
              G K+ AL  G  +    KG+  +     +  GLL+ P +   E+  L+G+      LT+
Sbjct  652   AGCKVDALYTGTYYYFSRKGVLTEVQLCAKRLGLLLTPKQQKMEVEVLDGDFDAPVTLTD  711

Query  755   EVVLKTGDLQPLEQPTSEAVEAPLV-GTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTF  813
                L+  +   + +    A +  LV GT V +   + +  +D   Y     +  V    F
Sbjct  712   ---LELEECTGVLEEVFGASDVKLVKGTLVSLASKLFVRTEDGFLY-RYVKSGGVLGKAF  767

Query  814   TLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFAC  873
              L+GG  +KVTFGD+ V  +    +VN ++++ E +D +L++  + + VE GT++ + AC
Sbjct  768   RLRGGGVSKVTFGDEEVHTIPNTVTVNFSYDVCEGLDAILDKVMAPFQVEEGTKLEDLAC  827

Query  874   VVADAVIKTLQPV----SELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYP--P  927
             VV  AV + L  +       L P  I+L+++  +  +++ +  E  L   MY S     P
Sbjct  828   VVQKAVYERLSDLFSDCPAELRP--INLEDFLTSECFVYSKDYEKILMPEMYFSLEDAVP  885

Query  928   DEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQT  987
              +DE   D E+                              ++   + ++ WL D     
Sbjct  886   VDDEMVDDIED-----------------------------TVEQASDSDDQWLGD-----  911

Query  988   VGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVE  1047
                 +G+ED       TI +V     M  TP           GY K+ ++VYIK ADIV+
Sbjct  912   ----EGAEDCD----NTIQDVDVATSMT-TP----------CGYTKIAEHVYIKCADIVQ  952

Query  1048  EAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSG  1107
             EA+     V+VNAANV L HGGGVAGALN+ATNNAMQ ES +YI  NG L+ GG  +LS 
Sbjct  953   EARNYSYAVLVNAANVNLHHGGGVAGALNRATNNAMQKESSEYIKANGSLQPGGHVLLSS  1012

Query  1108  HNLAKH-CLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             H LA H  LHVVGP+   G+D+ LL + Y  +   + +L PL+SAGIFG     SL   V
Sbjct  1013  HGLASHGILHVVGPDKRLGQDLALLDAVYAAYTGFDSVLTPLVSAGIFGFTVEESLCSLV  1072

Query  1167  DTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEE  1210
               V    Y+ V+D+ LY++ +++  ++   +   Q +  I   E
Sbjct  1073  KNVACTTYVVVYDRQLYERALATSFDVPGPQSSVQHVPAIDWAE  1116


> sp|K9N638|R1A_CVEMC Replicase polyprotein 1a OS=Middle East respiratory 
syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=1a PE=1 SV=1
Length=4391

 Score = 2196 bits (5690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1249/3279 (38%), Positives = 1856/3279 (57%), Gaps = 185/3279 (6%)

Query  1259  INGNLHPDSATLVSDIDITFLKKDAPYIVGD-VVQEGVLTA-----VVIPTKKAGGTTEM  1312
             I G ++  S   V      ++    P  VGD V+ +G   A     VV P  +A     +
Sbjct  1156  IAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSL  1215

Query  1313  LAK---ALRKVPTDNYITTYPGQGLNG--------YTVEEAKTVLKKCKSAFYILPSIIS  1361
             L+K   A+   P    +T     G+ G        Y + EAKT +    ++  +  S+  
Sbjct  1216  LSKCYKAMNAYPL--VVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTI  1273

Query  1362  NEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGAR  1421
              +  + L      LR  +  A++    + VC +  A    ++ K      +   VD G +
Sbjct  1274  VDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVD-GVQ  1332

Query  1422  FYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPD  1481
             +Y YTSK T+  ++   N  +  +++MPLGYV+HGL+L +A   +R + VP    +++ +
Sbjct  1333  YYCYTSKDTLDDILQQANK-SVGIISMPLGYVSHGLDLIQAGSVVRRVNVPYVCLLANKE  1391

Query  1482  AVTAYNGYLTSSSK--TPEEHFIETISLAGSYKDWSYSG-----QSTQLGIEFLKRGDKS  1534
                     L S      P E FI+ +   G Y  W         Q  +L  + L   D++
Sbjct  1392  Q----EAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLN-KLLHWSDQT  1446

Query  1535  VYYTSNPTTFHLDGEVITFDNLKTLLSLREVRT-----IKVFTTVDNINLHTQVVDMSMT  1589
             + Y  +      +     F+ L    +  + RT     I+V  TVD +N  T V++   T
Sbjct  1447  ICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNT  1506

Query  1590  YGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAF-EYYHTTDPSFLGRYMS  1648
             Y  Q G  + +GAD++   P     G + Y+  N      +A  E Y   DP+FL R+ S
Sbjct  1507  YRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYS  1566

Query  1649  ALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI-ELKFNPPALQDAYYRARAGEA  1707
                   KWK    + + S+K +DNNCYL   ++TL  + ++KF  PALQ A+ + + G++
Sbjct  1567  LKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDS  1626

Query  1708  ANFCALILAYCNKTVGELGDVRETMSYLFQHANLD-SCKRVLNVVCKTCGQQQTTLKGVE  1766
              +F ALI+AY N T G   D    +  +   A L  S + V    C  CG +   L+G++
Sbjct  1627  TDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLK  1686

Query  1767  AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGT---FTC  1823
             A  Y+G  + E  +  +   C CG +  + +V+  +P++++S  P +  +   T   F  
Sbjct  1687  ACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVA  1746

Query  1824  ASEYTG-NYQCGHYKHITSKETLYC-IDGALLTKSSEYKGPITDVFYKENSYTTTIKPVT  1881
              + + G     GHY H   K  L    D   ++K+S++K  +TDV +    Y++    V 
Sbjct  1747  FNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR  1806

Query  1882  YKLDGVVCTEIDPKLDNYYKKDNSYFT-EQPIDLVPNQPYPNASFDNFKFVCDNIKFADD  1940
             Y LDG   TE+DP L  +Y KD  YFT E P+   P      + + N   V  + +   D
Sbjct  1807  YSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGD  1866

Query  1941  -----LNQLTGY--KKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWH  1993
                   N L G+   KP +++   +F P  +GDV+  ++  Y P +K GA    KPI+W 
Sbjct  1867  AISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILW-  1925

Query  1994  VNNATNKATY-----KPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVS  2048
                  NKA+Y     K N   +R ++   P+E  N F  L  E              PV 
Sbjct  1926  ----VNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVEST------------PVE  1969

Query  2049  EEVVENPTIQKD--VLECNVKTTEVVGDIILKPANNS-LKITEEVGHTDLMAAYVD-NSS  2104
                V+   +Q++  +++C       V D +   A++S   + E +   DL   YVD    
Sbjct  1970  PPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQ  2029

Query  2105  LTIKKPNELSRVLGLKTLATHGL---AAVNSVPWDTIANYAKPFLNK----VVSTTTNIV  2157
             + + K N LS +L L T+ +  +   AA  S+       +   F  K       T T  V
Sbjct  2030  VIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAV  2089

Query  2158  TRCLNRV-------------CTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTT---IAKN  2201
               C+  V             C +++   F L L   + ++   + +K S   T   +  N
Sbjct  2090  GSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGN  2149

Query  2202  TVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSN-----  2256
              VK      ++ S + L+  ++   + +++      V L S+ +      VL S+     
Sbjct  2150  VVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFED  2209

Query  2257  --------------LGMPSYCTGYREGYLNSTNVTIATYCTG-SIPCSVCLSGLDSLDTY  2301
                           LG+ S C G    Y  + +  + T+C   S  C+ CL   DS+  Y
Sbjct  2210  AQGLKKFYKEVRAYLGISSACDGLASAY-RANSFDVPTFCANRSAMCNWCLISQDSITHY  2268

Query  2302  PSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISN  2361
             P+L+ +Q  +S +  ++       E  LAY+L+T  F  L LA  +  FF+  ++     
Sbjct  2269  PALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWR  2328

Query  2362  SW------LMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKR  2415
             S+        WL  ++    P++ +VRMY   A  + + K Y HV++GC  + C++CYKR
Sbjct  2329  SYNYAVSSAFWLFTHI----PMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKR  2384

Query  2416  NRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSL  2475
             NR TRVE +T+V G +R+FY+ ANGG  FC+ HNWNCV+CDT   G+TFI +EVA DL+ 
Sbjct  2385  NRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTT  2444

Query  2476  QFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLR----ANN  2531
               +RPIN TD+S Y VDSVTVK   +   + + GQ  YER  L  F NLD L+       
Sbjct  2445  ALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKT  2504

Query  2532  TKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMF  2591
             T G    N I++D   + +ES A+SA VYYSQ++C+ ILL+D +LV+ VGDS+E+A KMF
Sbjct  2505  TTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMF  2564

Query  2592  DAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAAR-QGFVDSDVETKD  2650
             D++VN+F S +NV  +KL+ L++TA   + +  +  +VL+TFI AAR    V+SDVET +
Sbjct  2565  DSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNE  2624

Query  2651  VVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIA  2710
             +V+ ++ +H+ DI++T +S NNY+ +Y K ++++  DLG+ IDC+A  +N  V ++ N A
Sbjct  2625  IVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGA  2684

Query  2711  LIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNN--  2768
              IWN   +M LS+ L++QIR A +K NL F+LT +  R   N+++ +      KIV    
Sbjct  2685  CIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVR--FTANKIVGGAP  2742

Query  2769  -W--------LKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRD  2819
              W        LK  +  T++    A + YL  P   M     +   I+ +K +D G+ RD
Sbjct  2743  TWFNALRDFTLKGYVLATIIVFLCAVLMYLCLPTFSMVPVEFYEDRILDFKVLDNGIIRD  2802

Query  2820  IASTDTCFANKHADFDTWFSQR-GGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTN  2878
             +   D CFANKH  F  W+ +  GG Y N   CPL  AVI    G  +P +P T L   N
Sbjct  2803  VNPDDKCFANKHRSFTQWYHEHVGGVYDNSITCPLTVAVIAGVAGARIPDVP-TTLAWVN  2861

Query  2879  GDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNV  2938
                + F+ RVF+  G++CYTP   I Y  F+ S C+L +ECT+F+DA G+  PYC+D  V
Sbjct  2862  NQIIFFVSRVFANTGSVCYTPIDEIPYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTV  2921

Query  2939  LEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVC  2997
             L G+ AY  +RP  RY L DG++ I+FP    E ++R+  T  ++YCR G+CE ++ GVC
Sbjct  2922  LPGAFAYSQMRPHVRYDLYDGNMFIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVC  2981

Query  2998  VSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVV  3057
             ++T+G W + ND++ + PGV+CG D ++++  +   L QPI    ++ S+V G  +   +
Sbjct  2982  ITTNGSWAIFNDHHLNRPGVYCGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFL  3041

Query  3058  TCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLT  3117
             T L YY  + +RAF +Y+       +  +++   +C           Y+ +Y Y TFY T
Sbjct  3042  TLLFYYINKVKRAFADYTQCAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFT  3101

Query  3118  NDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV-VF-NGVSFSTF  3175
             N+ +F+ H+ W +MF P+VP W+T  Y + +  +HF+W  + + K+ V VF +G    +F
Sbjct  3102  NEPAFIMHVSWYIMFGPIVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSF  3161

Query  3176  EEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLA  3235
             ++AA   F++NK+ Y  LR+   L    Y+R+L L+NKYKYFSGAM+T +YREAA CHLA
Sbjct  3162  QDAASNIFVINKDTYAALRNS--LTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLA  3219

Query  3236  KALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWL  3295
             KAL  +S +GSD+LYQPP  SITS VLQSG  KM+ PSG VE CMVQVTCG+ TLNGLWL
Sbjct  3220  KALQTYSETGSDLLYQPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWL  3279

Query  3296  DDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKL  3352
             D+ V+CPRHV+C ++ + +PNY+ LLI  +NH+F VQ        LRV+GH+MQ  +LKL
Sbjct  3280  DNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKL  3339

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
              VD ANP TP Y F  ++PG  FSVLACYNG P+G +   MRPN+TIKGSFL GSCGSVG
Sbjct  3340  TVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVG  3399

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             +  +   ++FCYMH MEL  G H G+  +G  YG F+D+Q  Q   TD   +VNV+AWLY
Sbjct  3400  YTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLY  3459

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASL  3531
             AA++NG  WF+    T++  FN  A+   + E +    VD+L   + +TG+A+  +  ++
Sbjct  3460  AAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDML---AVKTGVAIEQLLYAI  3516

Query  3532  KELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSL  3591
             ++L   G  G+ ILGS +LEDEFTP DV  Q  GV  QS V++   GT HWL  T++++ 
Sbjct  3517  QQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTY  3575

Query  3592  LVLVQSTQWSLFFFLYENAFLP---FAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVA  3648
             ++++Q+T+++L+ +L+E   +P   F +  + M AF M+ VKHKH FL LFLLP    + 
Sbjct  3576  VIILQATKFTLWNYLFET--IPTQLFPLLFVTM-AFVMLLVKHKHTFLTLFLLPVAICLT  3632

Query  3649  YFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDG  3704
             Y N+VY P    +S ++ +  WL   +  +      D  +Y S  ++L+++  R      
Sbjct  3633  YANIVYEPTTPISSALIAVANWLAPTNAYMRTTH-TDIGVYISMSLVLVIVVKRLYNPSL  3691

Query  3705  ARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVE  3764
             +     L + +  +Y    G A    I+    + ++TS+Y+  V   + LA+   +    
Sbjct  3692  SNFALALCSGVMWLYTYSIGEA-SSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFA  3750

Query  3765  YCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMN  3824
             Y P   +    ++ I+L+Y  LG+ CTCYFG+F LLN   R  +GVYD+ VSTQEFR+M 
Sbjct  3751  YSPQLTLVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMT  3810

Query  3825  SQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESS  3884
             +  L  P+NS +A  LN KL+G+GG PCIKVA +QSK++D+KCTSVVLLSVLQQL +E++
Sbjct  3811  ANNLTAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEAN  3870

Query  3885  SKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAI  3944
             S+ WA CV+ HNDIL A D +EAFEK VSL + L++  G VD++ L  ++ D  + LQA 
Sbjct  3871  SRAWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT  3930

Query  3945  ASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK  4003
              SEFS L ++A    AQ+AY++A+ +GD S  VLK L+K++N+AK+ +++D A+ RKLE+
Sbjct  3931  LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLER  3990

Query  4004  MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP  4063
             MADQAMT MYKQAR+EDK+AK+ SAMQTMLF M++KLDND LN II+NAR+GC+PL++IP
Sbjct  3991  MADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLSVIP  4050

Query  4064  LTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLA  4123
             L  + KL VVIPD+  +       +  YA ALW+I  + + D++IV+ S++ +D++ NL 
Sbjct  4051  LCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDV-VDSNENLT  4109

Query  4124  WPLIVTALRAN-SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVL  4182
             WPL++   RA+ SAVKLQNNE+ P  L+ M  +AG  QT C + ++LAYY   +G + ++
Sbjct  4110  WPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNC-NTSSLAYYEPVQGRKMLM  4168

Query  4183  ALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMV  4242
             ALLSD   LKWAR    DG  ++  EL+PPC+F+   PKGP+++YLYF+K LNNL+RG V
Sbjct  4169  ALLSDNAYLKWARVEGKDGFVSV--ELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQV  4226

Query  4243  LGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHT  4302
             LG +AATVRLQAG+ TE  +NS+VLS   F VD  KAY D++ +GG P+TNCVKML   T
Sbjct  4227  LGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKT  4286

Query  4303  GTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG  4362
             GTG AI+V PE+  DQE++GGAS CLYCR HI+HP+  G C  KGK+VQIP  C  DPVG
Sbjct  4287  GTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVG  4346

Query  4363  FTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             F L NT C VC  W GYGC+CD LR+  L  +   +FLN
Sbjct  4347  FCLSNTPCNVCQYWIGYGCNCDSLRQAALPQSKDSNFLN  4385


 Score =  274 bits (700),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 296/1193 (25%), Positives = 514/1193 (43%), Gaps = 151/1193 (13%)

Query  101   GETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN  160
             G+ +G+  P+  E+    + +LLRK G    GG+ Y      ++  +    +  +DF+ +
Sbjct  123   GKPIGMFFPYDIELVTGKQNILLRKYGR---GGYHYTP--FHYERDNTSCPEWMDDFEAD  177

Query  161   WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAG-----KASCTL  215
                K++    + L+++L GG  T  VD   CG DG P+     L+A+ G          +
Sbjct  178   PKGKYA----QNLLKKLIGGDVTP-VDQYMCGVDGKPISAYAFLMAKDGITKLADVEADV  232

Query  216   SEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVF  275
             + + D      G    + + + + W+ ER +  Y  Q+ F I    + D      P++ F
Sbjct  233   AARAD----DEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQKDGVENTPPHY-F  287

Query  276   PLNSIIKTIQPR----------VEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDH  325
              L   I T+ PR          +++K L  F G+        S      +  S  ++C  
Sbjct  288   TLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGK-------ESLENPTYIYHSAFIECGS  340

Query  326   CGETSWQTGDFVKATCEFCGTENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGP--EH  382
             CG  SW TG+ ++     CG      +    + G +  NA++   CP           +H
Sbjct  341   CGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGDSCSSNCKH  400

Query  383   SLAE---YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVV  439
             S+A+   Y +E     I      T+ FGG  ++Y GC     Y+VPRA + +      + 
Sbjct  401   SVAQLVSYLSER-CNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSVVSRIGDSIF  459

Query  440   GEGSEGLNDNLLEI----LQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLD  495
               G  G  + + +I    L++ + ++N VG+F +N+ +  IL+  + +     + +KG+ 
Sbjct  460   -TGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVDKIRQLLKGVT  518

Query  496   YKAFKQIVESCGNFKVTKGKAKKGAWNIG----EQKSILSPLYAFAS--EAARVVRSIFS  549
                 +  +    +  VT G     A N+G    +  +I +P        E+ + V +I  
Sbjct  519   LDKLRDYLADY-DVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLGESFKKVATIPY  577

Query  550   RTLETAQNSV-----RVLQKAAITILD-GISQYSLRLIDAMMFTSDLATNNLVVMAYITG  603
             +   + ++++      VL +     +D G+S +S  L D +    DL+    V   Y   
Sbjct  578   KVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCV----DLS----VASTYFLV  629

Query  604   GVVQ-LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGG  662
              ++Q  T  +++ I  +    +  +LD   E  +    FL D   + +     A      
Sbjct  630   RLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRNAYVYTSQ  689

Query  663   QIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKA-LNLGETFVTHSKGLYRKCV  721
               V    ++   V+    L+NK + L    +   G+ + A +  G   +    G Y  CV
Sbjct  690   GFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIFPSGTYY-CV  748

Query  722   KSR-----EETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDL-----QPLEQPTS  771
              ++     ++  +++P +  K+ +   G   PT+  T   V  + ++       LEQ   
Sbjct  749   TTKAKSVQQDLDVILPGEFSKKQL---GLLQPTDNSTTVSVTVSSNMVETVVGQLEQTNM  805

Query  772   EAVEAPLVGTPVCINGLMLLEIKDTEKYCALAP---NMMVTNNTFTLKGGAPTK-VTFGD  827
              + +  +VG  V I+  + +  K+ + + A  P   N       F LKGGAP K V FG 
Sbjct  806   HSPDV-IVGDYVIISEKLFVRSKEEDGF-AFYPACTNGHAVPTLFRLKGGAPVKKVAFGG  863

Query  828   DTVIEVQGYKSVNITFELDERIDKVL-NEKCSAYTVELGTEVNEFACVVADAVIKTLQPV  886
             D V EV   +SV + + +   +D +L +     + V+    + EFA VV + V   L  +
Sbjct  864   DQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLLVKL  923

Query  887   SELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEE------------EG  934
                +     DLD++  A  Y F+  G+   +S M  S +P + DEE            E 
Sbjct  924   LRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEEGES  983

Query  935   DCEEEEFEPSTQYEYGTEDDY------QGKPL-EFGATSAALQPEEEQEEDWLDDDSQQT  987
             +C  E         +   DD       +  PL E    + ++Q E +  E  ++D +Q  
Sbjct  984   ECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIAQVV  1043

Query  988   VGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIE-----------------------  1024
             +         +T  +   VEV PQ+ ++L    QTI+                       
Sbjct  1044  IADTL----QETPVVSDTVEVPPQV-VKLPSEPQTIQPEVKEVAPVYEADTEQTQSVTVK  1098

Query  1025  ---------VNSFSGYLK--LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAG  1073
                      V+  S +    +T+ V I   D ++ AK    +V+VNAAN +LKHGGG+AG
Sbjct  1099  PKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGGIAG  1158

Query  1074  ALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKS  1133
             A+N A+  A+Q ESD+YI   GPL+VG S +L GH+LAK+ LHVVGP+    +D+ LL  
Sbjct  1159  AINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSLLSK  1218

Query  1134  AYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKL  1186
              Y+  N + +++ PL+SAGIFG  P  S    +   +T V + V  +++Y  L
Sbjct  1219  CYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSL  1271


> sp|K9N7C7|R1AB_CVEMC Replicase polyprotein 1ab OS=Middle East 
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=rep PE=1 SV=1
Length=7078

 Score = 2190 bits (5675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1248/3278 (38%), Positives = 1855/3278 (57%), Gaps = 185/3278 (6%)

Query  1259  INGNLHPDSATLVSDIDITFLKKDAPYIVGD-VVQEGVLTA-----VVIPTKKAGGTTEM  1312
             I G ++  S   V      ++    P  VGD V+ +G   A     VV P  +A     +
Sbjct  1156  IAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSL  1215

Query  1313  LAK---ALRKVPTDNYITTYPGQGLNG--------YTVEEAKTVLKKCKSAFYILPSIIS  1361
             L+K   A+   P    +T     G+ G        Y + EAKT +    ++  +  S+  
Sbjct  1216  LSKCYKAMNAYPL--VVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTI  1273

Query  1362  NEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGAR  1421
              +  + L      LR  +  A++    + VC +  A    ++ K      +   VD G +
Sbjct  1274  VDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVD-GVQ  1332

Query  1422  FYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPD  1481
             +Y YTSK T+  ++   N  +  +++MPLGYV+HGL+L +A   +R + VP    +++ +
Sbjct  1333  YYCYTSKDTLDDILQQANK-SVGIISMPLGYVSHGLDLIQAGSVVRRVNVPYVCLLANKE  1391

Query  1482  AVTAYNGYLTSSSK--TPEEHFIETISLAGSYKDWSYSG-----QSTQLGIEFLKRGDKS  1534
                     L S      P E FI+ +   G Y  W         Q  +L  + L   D++
Sbjct  1392  Q----EAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLN-KLLHWSDQT  1446

Query  1535  VYYTSNPTTFHLDGEVITFDNLKTLLSLREVRT-----IKVFTTVDNINLHTQVVDMSMT  1589
             + Y  +      +     F+ L    +  + RT     I+V  TVD +N  T V++   T
Sbjct  1447  ICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNT  1506

Query  1590  YGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAF-EYYHTTDPSFLGRYMS  1648
             Y  Q G  + +GAD++   P     G + Y+  N      +A  E Y   DP+FL R+ S
Sbjct  1507  YRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYS  1566

Query  1649  ALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQI-ELKFNPPALQDAYYRARAGEA  1707
                   KWK    + + S+K +DNNCYL   ++TL  + ++KF  PALQ A+ + + G++
Sbjct  1567  LKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDS  1626

Query  1708  ANFCALILAYCNKTVGELGDVRETMSYLFQHANLD-SCKRVLNVVCKTCGQQQTTLKGVE  1766
              +F ALI+AY N T G   D    +  +   A L  S + V    C  CG +   L+G++
Sbjct  1627  TDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLK  1686

Query  1767  AVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGT---FTC  1823
             A  Y+G  + E  +  +   C CG +  + +V+  +P++++S  P +  +   T   F  
Sbjct  1687  ACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVA  1746

Query  1824  ASEYTG-NYQCGHYKHITSKETLYC-IDGALLTKSSEYKGPITDVFYKENSYTTTIKPVT  1881
              + + G     GHY H   K  L    D   ++K+S++K  +TDV +    Y++    V 
Sbjct  1747  FNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR  1806

Query  1882  YKLDGVVCTEIDPKLDNYYKKDNSYFT-EQPIDLVPNQPYPNASFDNFKFVCDNIKFADD  1940
             Y LDG   TE+DP L  +Y KD  YFT E P+   P      + + N   V  + +   D
Sbjct  1807  YSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGD  1866

Query  1941  -----LNQLTGY--KKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWH  1993
                   N L G+   KP +++   +F P  +GDV+  ++  Y P +K GA    KPI+W 
Sbjct  1867  AISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILW-  1925

Query  1994  VNNATNKATY-----KPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVS  2048
                  NKA+Y     K N   +R ++   P+E  N F  L  E              PV 
Sbjct  1926  ----VNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVEST------------PVE  1969

Query  2049  EEVVENPTIQKD--VLECNVKTTEVVGDIILKPANNS-LKITEEVGHTDLMAAYVD-NSS  2104
                V+   +Q++  +++C       V D +   A++S   + E +   DL   YVD    
Sbjct  1970  PPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQ  2029

Query  2105  LTIKKPNELSRVLGLKTLATHGL---AAVNSVPWDTIANYAKPFLNK----VVSTTTNIV  2157
             + + K N LS +L L T+ +  +   AA  S+       +   F  K       T T  V
Sbjct  2030  VIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAV  2089

Query  2158  TRCLNRV-------------CTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTT---IAKN  2201
               C+  V             C +++   F L L   + ++   + +K S   T   +  N
Sbjct  2090  GSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGN  2149

Query  2202  TVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSN-----  2256
              VK      ++ S + L+  ++   + +++      V L S+ +      VL S+     
Sbjct  2150  VVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFED  2209

Query  2257  --------------LGMPSYCTGYREGYLNSTNVTIATYCTG-SIPCSVCLSGLDSLDTY  2301
                           LG+ S C G    Y  + +  + T+C   S  C+ CL   DS+  Y
Sbjct  2210  AQGLKKFYKEVRAYLGISSACDGLASAY-RANSFDVPTFCANRSAMCNWCLISQDSITHY  2268

Query  2302  PSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISN  2361
             P+L+ +Q  +S +  ++       E  LAY+L+T  F  L LA  +  FF+  ++     
Sbjct  2269  PALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWR  2328

Query  2362  SW------LMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKR  2415
             S+        WL  ++    P++ +VRMY   A  + + K Y HV++GC  + C++CYKR
Sbjct  2329  SYNYAVSSAFWLFTHI----PMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKR  2384

Query  2416  NRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSL  2475
             NR TRVE +T+V G +R+FY+ ANGG  FC+ HNWNCV+CDT   G+TFI +EVA DL+ 
Sbjct  2385  NRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTT  2444

Query  2476  QFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLR----ANN  2531
               +RPIN TD+S Y VDSVTVK   +   + + GQ  YER  L  F NLD L+       
Sbjct  2445  ALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKT  2504

Query  2532  TKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMF  2591
             T G    N I++D   + +ES A+SA VYYSQ++C+ ILL+D +LV+ VGDS+E+A KMF
Sbjct  2505  TTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMF  2564

Query  2592  DAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAAR-QGFVDSDVETKD  2650
             D++VN+F S +NV  +KL+ L++TA   + +  +  +VL+TFI AAR    V+SDVET +
Sbjct  2565  DSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNE  2624

Query  2651  VVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIA  2710
             +V+ ++ +H+ DI++T +S NNY+ +Y K ++++  DLG+ IDC+A  +N  V ++ N A
Sbjct  2625  IVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGA  2684

Query  2711  LIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNN--  2768
              IWN   +M LS+ L++QIR A +K NL F+LT +  R   N+++ +      KIV    
Sbjct  2685  CIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVR--FTANKIVGGAP  2742

Query  2769  -W--------LKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRD  2819
              W        LK  +  T++    A + YL  P   M     +   I+ +K +D G+ RD
Sbjct  2743  TWFNALRDFTLKGYVLATIIVFLCAVLMYLCLPTFSMVPVEFYEDRILDFKVLDNGIIRD  2802

Query  2820  IASTDTCFANKHADFDTWFSQR-GGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTN  2878
             +   D CFANKH  F  W+ +  GG Y N   CPL  AVI    G  +P +P T L   N
Sbjct  2803  VNPDDKCFANKHRSFTQWYHEHVGGVYDNSITCPLTVAVIAGVAGARIPDVP-TTLAWVN  2861

Query  2879  GDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNV  2938
                + F+ RVF+  G++CYTP   I Y  F+ S C+L +ECT+F+DA G+  PYC+D  V
Sbjct  2862  NQIIFFVSRVFANTGSVCYTPIDEIPYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTV  2921

Query  2939  LEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVC  2997
             L G+ AY  +RP  RY L DG++ I+FP    E ++R+  T  ++YCR G+CE ++ GVC
Sbjct  2922  LPGAFAYSQMRPHVRYDLYDGNMFIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVC  2981

Query  2998  VSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVV  3057
             ++T+G W + ND++ + PGV+CG D ++++  +   L QPI    ++ S+V G  +   +
Sbjct  2982  ITTNGSWAIFNDHHLNRPGVYCGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFL  3041

Query  3058  TCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLT  3117
             T L YY  + +RAF +Y+       +  +++   +C           Y+ +Y Y TFY T
Sbjct  3042  TLLFYYINKVKRAFADYTQCAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFT  3101

Query  3118  NDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV-VF-NGVSFSTF  3175
             N+ +F+ H+ W +MF P+VP W+T  Y + +  +HF+W  + + K+ V VF +G    +F
Sbjct  3102  NEPAFIMHVSWYIMFGPIVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSF  3161

Query  3176  EEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLA  3235
             ++AA   F++NK+ Y  LR+   L    Y+R+L L+NKYKYFSGAM+T +YREAA CHLA
Sbjct  3162  QDAASNIFVINKDTYAALRNS--LTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLA  3219

Query  3236  KALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWL  3295
             KAL  +S +GSD+LYQPP  SITS VLQSG  KM+ PSG VE CMVQVTCG+ TLNGLWL
Sbjct  3220  KALQTYSETGSDLLYQPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWL  3279

Query  3296  DDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKL  3352
             D+ V+CPRHV+C ++ + +PNY+ LLI  +NH+F VQ        LRV+GH+MQ  +LKL
Sbjct  3280  DNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKL  3339

Query  3353  KVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVG  3412
              VD ANP TP Y F  ++PG  FSVLACYNG P+G +   MRPN+TIKGSFL GSCGSVG
Sbjct  3340  TVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVG  3399

Query  3413  FNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLY  3472
             +  +   ++FCYMH MEL  G H G+  +G  YG F+D+Q  Q   TD   +VNV+AWLY
Sbjct  3400  YTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLY  3459

Query  3473  AAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASL  3531
             AA++NG  WF+    T++  FN  A+   + E +    VD+L   + +TG+A+  +  ++
Sbjct  3460  AAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDML---AVKTGVAIEQLLYAI  3516

Query  3532  KELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSL  3591
             ++L   G  G+ ILGS +LEDEFTP DV  Q  GV  QS V++   GT HWL  T++++ 
Sbjct  3517  QQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTY  3575

Query  3592  LVLVQSTQWSLFFFLYENAFLP---FAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVA  3648
             ++++Q+T+++L+ +L+E   +P   F +  + M AF M+ VKHKH FL LFLLP    + 
Sbjct  3576  VIILQATKFTLWNYLFET--IPTQLFPLLFVTM-AFVMLLVKHKHTFLTLFLLPVAICLT  3632

Query  3649  YFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDG  3704
             Y N+VY P    +S ++ +  WL   +  +      D  +Y S  ++L+++  R      
Sbjct  3633  YANIVYEPTTPISSALIAVANWLAPTNAYMRTTH-TDIGVYISMSLVLVIVVKRLYNPSL  3691

Query  3705  ARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVE  3764
             +     L + +  +Y    G A    I+    + ++TS+Y+  V   + LA+   +    
Sbjct  3692  SNFALALCSGVMWLYTYSIGEA-SSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFA  3750

Query  3765  YCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMN  3824
             Y P   +    ++ I+L+Y  LG+ CTCYFG+F LLN   R  +GVYD+ VSTQEFR+M 
Sbjct  3751  YSPQLTLVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMT  3810

Query  3825  SQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESS  3884
             +  L  P+NS +A  LN KL+G+GG PCIKVA +QSK++D+KCTSVVLLSVLQQL +E++
Sbjct  3811  ANNLTAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEAN  3870

Query  3885  SKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAI  3944
             S+ WA CV+ HNDIL A D +EAFEK VSL + L++  G VD++ L  ++ D  + LQA 
Sbjct  3871  SRAWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT  3930

Query  3945  ASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKLKKSLNVAKSEFDRDAAMQRKLEK  4003
              SEFS L ++A    AQ+AY++A+ +GD S  VLK L+K++N+AK+ +++D A+ RKLE+
Sbjct  3931  LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLER  3990

Query  4004  MADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIP  4063
             MADQAMT MYKQAR+EDK+AK+ SAMQTMLF M++KLDND LN II+NAR+GC+PL++IP
Sbjct  3991  MADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLSVIP  4050

Query  4064  LTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLA  4123
             L  + KL VVIPD+  +       +  YA ALW+I  + + D++IV+ S++ +D++ NL 
Sbjct  4051  LCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDV-VDSNENLT  4109

Query  4124  WPLIVTALRAN-SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVL  4182
             WPL++   RA+ SAVKLQNNE+ P  L+ M  +AG  QT C + ++LAYY   +G + ++
Sbjct  4110  WPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNC-NTSSLAYYEPVQGRKMLM  4168

Query  4183  ALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMV  4242
             ALLSD   LKWAR    DG  ++  EL+PPC+F+   PKGP+++YLYF+K LNNL+RG V
Sbjct  4169  ALLSDNAYLKWARVEGKDGFVSV--ELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQV  4226

Query  4243  LGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHT  4302
             LG +AATVRLQAG+ TE  +NS+VLS   F VD  KAY D++ +GG P+TNCVKML   T
Sbjct  4227  LGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKT  4286

Query  4303  GTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG  4362
             GTG AI+V PE+  DQE++GGAS CLYCR HI+HP+  G C  KGK+VQIP  C  DPVG
Sbjct  4287  GTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVG  4346

Query  4363  FTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFL  4400
             F L NT C VC  W GYGC+CD LR+  L  +   +FL
Sbjct  4347  FCLSNTPCNVCQYWIGYGCNCDSLRQAALPQSKDSNFL  4384


 Score =  274 bits (701),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 302/1196 (25%), Positives = 519/1196 (43%), Gaps = 157/1196 (13%)

Query  101   GETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN  160
             G+ +G+  P+  E+    + +LLRK G    GG+ Y      ++  +    +  +DF+ +
Sbjct  123   GKPIGMFFPYDIELVTGKQNILLRKYGR---GGYHYTP--FHYERDNTSCPEWMDDFEAD  177

Query  161   WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAG-----KASCTL  215
                K++    + L+++L GG  T  VD   CG DG P+     L+A+ G          +
Sbjct  178   PKGKYA----QNLLKKLIGGDVTP-VDQYMCGVDGKPISAYAFLMAKDGITKLADVEADV  232

Query  216   SEQLD---FIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPN  272
             + + D   FI  K  +Y        + W+ ER +  Y  Q+ F I    + D      P+
Sbjct  233   AARADDEGFITLKNNLY-------RLVWHVERKDVPYPKQSIFTINSVVQKDGVENTPPH  285

Query  273   FVFPLNSIIKTIQPR----------VEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMK  322
             + F L   I T+ PR          +++K L  F G+        S      +  S  ++
Sbjct  286   Y-FTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGK-------ESLENPTYIYHSAFIE  337

Query  323   CDHCGETSWQTGDFVKATCEFCGTENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGP-  380
             C  CG  SW TG+ ++     CG      +    + G +  NA++   CP          
Sbjct  338   CGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGDSCSSN  397

Query  381   -EHSLAE---YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHT  436
              +HS+A+   Y +E     I      T+ FGG  ++Y GC     Y+VPRA + +     
Sbjct  398   CKHSVAQLVSYLSER-CNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSVVS-RIG  455

Query  437   GVVGEGSEGLNDNLLEI----LQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVK  492
               +  G  G  + + +I    L++ + ++N VG+F +N+ +  IL+  + +     + +K
Sbjct  456   DSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVDKIRQLLK  515

Query  493   GLDYKAFKQIVESCGNFKVTKGKAKKGAWNIG----EQKSILSPLYAFAS--EAARVVRS  546
             G+     +  +    +  VT G     A N+G    +  +I +P        E+ + V +
Sbjct  516   GVTLDKLRDYLADY-DVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLGESFKKVAT  574

Query  547   IFSRTLETAQNSV-----RVLQKAAITILD-GISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             I  +   + ++++      VL +     +D G+S +S  L D +    DL+    V   Y
Sbjct  575   IPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCV----DLS----VASTY  626

Query  601   ITGGVVQ-LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEI  659
                 ++Q  T  +++ I  +    +  +LD   E  +    FL D   + +     A   
Sbjct  627   FLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRNAYVY  686

Query  660   VGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKA-LNLGETFVTHSKGLYR  718
                  V    ++   V+    L+NK + L    +   G+ + A +  G   +    G Y 
Sbjct  687   TSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIFPSGTYY  746

Query  719   KCVKSR-----EETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDL-----QPLEQ  768
              CV ++     ++  +++P +  K+ +   G   PT+  T   V  + ++       LEQ
Sbjct  747   -CVTTKAKSVQQDLDVILPGEFSKKQL---GLLQPTDNSTTVSVTVSSNMVETVVGQLEQ  802

Query  769   PTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAP---NMMVTNNTFTLKGGAPTK-VT  824
                 + +  +VG  V I+  + +  K+ + + A  P   N       F LKGGAP K V 
Sbjct  803   TNMHSPDV-IVGDYVIISEKLFVRSKEEDGF-AFYPACTNGHAVPTLFRLKGGAPVKKVA  860

Query  825   FGDDTVIEVQGYKSVNITFELDERIDKVL-NEKCSAYTVELGTEVNEFACVVADAVIKTL  883
             FG D V EV   +SV + + +   +D +L +     + V+    + EFA VV + V   L
Sbjct  861   FGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLL  920

Query  884   QPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEE---EE  940
               +   +     DLD++  A  Y F+  G+   +S M  S +P + DEE  + E    EE
Sbjct  921   VKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEE  980

Query  941   FEPSTQYEYGTE----------DDY-----QGKPL-EFGATSAALQPEEEQEEDWLDDDS  984
              E     E  TE          D++     +  PL E    + ++Q E +  E  ++D +
Sbjct  981   GESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIA  1040

Query  985   QQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIE--------------------  1024
             Q  +         +T  +   VEV PQ+ ++L    QTI+                    
Sbjct  1041  QVVIADTL----QETPVVSDTVEVPPQV-VKLPSEPQTIQPEVKEVAPVYEADTEQTQSV  1095

Query  1025  ------------VNSFSGYLK--LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGG  1070
                         V+  S +    +T+ V I   D ++ AK    +V+VNAAN +LKHGGG
Sbjct  1096  TVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGG  1155

Query  1071  VAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQL  1130
             +AGA+N A+  A+Q ESD+YI   GPL+VG S +L GH+LAK+ LHVVGP+    +D+ L
Sbjct  1156  IAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSL  1215

Query  1131  LKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKL  1186
             L   Y+  N + +++ PL+SAGIFG  P  S    +   +T V + V  +++Y  L
Sbjct  1216  LSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSL  1271


> sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus 
HKU5 OX=694008 GN=1a PE=3 SV=1
Length=4481

 Score = 2179 bits (5646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1223/3124 (39%), Positives = 1810/3124 (58%), Gaps = 140/3124 (4%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C +  A    ++ +   +  +   VD G ++Y Y+SK  +  +I   N   + +  MP+
Sbjct  1379  ICTDQSANAKLLKGRGVDLTKKTQTVD-GVKYYLYSSKDPLTDIITAANAC-KGICAMPI  1436

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L +A + ++ + VP    ++S D V   N  +  + +TPE+ FI T+   G 
Sbjct  1437  GYVTHGLDLAQAGQQVKKITVPYVCLLASKDQVPILNSDV--AVQTPEQSFINTVIANGG  1494

Query  1511  YKDWSY-SGQSTQLGIEF---LKRGDKSVYYTSNPTTFHLDGEV-ITFDNL---KTLLSL  1562
             Y  W   +G+    G+ +   L   D+++ Y  N   + + G++ + FD+L   +T L+ 
Sbjct  1495  YHCWHLVTGELIVKGVSYRKLLNWSDQTICYADN-KFYVVKGQIALPFDSLEKCRTYLTS  1553

Query  1563  R--EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             R  + + + V  T+D +N  T V++ + TY  Q G  +  G+D++   P     G+  Y+
Sbjct  1554  RAAQQKNVDVLVTIDGVNFRTVVLNNTTTYRVQLGSVFYKGSDISDTIPTEKMSGEAVYL  1613

Query  1621  LPN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATA  1679
               N  +  +    E Y T D +FL RY S L   KKWKY   +G+ S+K   NNCY+   
Sbjct  1614  ADNLSEAEKAVLSEVYGTADTAFLHRYYSLLALVKKWKYTVHDGVKSLKLNSNNCYVNVT  1673

Query  1680  LLTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH  1738
             +L L  + E+KF  PALQ AY + + G++  F ALI+AY + T GE  D    +  +   
Sbjct  1674  MLMLDMLKEIKFIVPALQAAYLKHKGGDSTEFIALIMAYGDCTYGEPDDASRLLHTILSK  1733

Query  1739  ANLDS-CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYL  1797
             A L +  K V    C  CG Q TT  G++A +Y+G  S ++     +  C CG    + L
Sbjct  1734  AELTTQAKMVWRQWCNVCGVQDTTTTGLKACIYVGMNSLDELHATHEECCQCGDVRKRQL  1793

Query  1798  VQQESPFVMMSAPPAQYELKHGTFTCASEYTG-------NYQCGHYKHITSKETL-YCID  1849
             V+  +P++++S       +   + +   +YT            GHY H+  K+ L Y  D
Sbjct  1794  VEHNAPWLLLSGLNEAKVMTPTSQSAGPDYTAFNVFQGVETSVGHYLHVRVKDNLLYKYD  1853

Query  1850  GALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTE  1909
                L+K+S+ K  +TDV+Y +  Y+     V Y LDG    ++DP L  +Y KD  YFT+
Sbjct  1854  SGSLSKTSDMKCKMTDVYYPKQRYSADCNVVVYSLDGNTWADVDPDLSAFYMKDGKYFTK  1913

Query  1910  QPI------DLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGY--KKPASRELKVTFFP  1961
             +P+       ++    Y N+          +   +   N L G+   KP S++L  +FFP
Sbjct  1914  KPVIEYSPATILSGSVYTNSCLVGHDGTIGSDAISSSFNNLLGFDNSKPVSKKLTYSFFP  1973

Query  1962  DLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVET  2021
             D  GDV+  +Y  Y P +K GA L  KPI+W  N+  + A  K N   +R ++   PV  
Sbjct  1974  DFEGDVILTEYSTYDPIYKNGAMLHGKPILWVNNSKFDSALNKFNRATLRQVYDIAPVTL  2033

Query  2022  SNSFDVLKSEDAQGMDNLAC-EDLKPVSE-EVVENPTIQKDVLECNVKTTEVVGD---II  2076
              N + VL+    Q ++  A  ED KP S  +V E+   +  +++C       V D    +
Sbjct  2034  ENKYTVLQDNQIQQVEVEAPKEDAKPQSPVQVAEDIDNKLPIIKCKGLKKPFVKDGYSFV  2093

Query  2077  LKPANNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPW  2135
               P    + + + +G  DL A YVD N  L + K N  S +  + T+    L+ + +   
Sbjct  2094  NDP--QGVNVIDTLGIDDLRALYVDRNLRLIVLKENNWSALFNIHTVEKGDLSVIAASGS  2151

Query  2136  DT----IANYAKPFLNKVVSTTTNIVT---RCLNRVCTNYMP------YFFTLLLQLC--  2180
              T    I   A     +  S T N+ T   + L R+  N +         F LL  L   
Sbjct  2152  ITRRVKILLGASSLFAQFASVTVNVTTAMGKALGRMTRNVITNTGIIGQGFALLKMLLIL  2211

Query  2181  --TFTRSTN-SRIKASMPTTIAKNTVKS-VGKFCLEASFNYLKSPNFSKLINIIIWFLLL  2236
               TF +S N S +K  +        V + V K C  A+++ L    F ++       LL 
Sbjct  2212  PFTFWKSKNQSTVKVEVGALRTAGIVTTNVVKQCASAAYDVLVV-KFKRIDWKSTLRLLF  2270

Query  2237  SVC------------------LGSLIYSTAALGVLM------SNLGMPSYCTGYREGYLN  2272
              +C                  L S +    A G+L       S LG+ S C G  E Y N
Sbjct  2271  LICTTGLLLSSLYYLFLFHQVLTSDVMLDGAEGMLATYRELRSYLGIHSLCDGMVEAYRN  2330

Query  2273  STNVTIATYCTG-SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAY  2331
               +  +  +C+  S  C+ CL G DSL  Y + + IQ  ++S+  ++     V E+ LAY
Sbjct  2331  -VSYDVNDFCSNRSALCNWCLIGQDSLTRYSAFQMIQTHVTSYVINIDWVWFVMEFALAY  2389

Query  2332  ILFTRFFYVLGLAAIMQLFFSYFA--VHFISNSWLMWLIINLVQMAPISAMVRMYIFFAS  2389
             +L+T  F VL L    Q FFSY    V++ S ++L+      V   P+  +VR+Y F A 
Sbjct  2390  VLYTSTFNVLLLVVSSQYFFSYTGAFVNWRSYNYLVSGYFFCVTHIPLLGLVRIYNFLAC  2449

Query  2390  FYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHN  2449
              +++ + Y HV++GC  + C++CYKRNR TRVE +T+V G +R+FY+ ANGG  FC  HN
Sbjct  2450  LWFLRRFYNHVINGCKDTACLLCYKRNRLTRVEASTVVCGSKRTFYIVANGGTSFCCRHN  2509

Query  2450  WNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAG  2509
             WNCV+CDT   G+TFI +EVA DL+   +R + PTD+S Y V+SVTVK+  + L++ + G
Sbjct  2510  WNCVDCDTAGIGNTFICEEVANDLTTSLRRLVKPTDKSHYYVESVTVKDSVVQLHYSREG  2569

Query  2510  QKTYERHSLSHFVNLDNLRAN---NTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLM  2565
                YER+ L +F NLD L+      T   +P  N +++D   + +E+ A+SA VYYSQ++
Sbjct  2570  ASCYERYPLCYFTNLDKLKFKEVCKTPTGIPEHNFLIYDSSDRGQENLARSACVYYSQVL  2629

Query  2566  CQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVS  2625
              +P+LL+D  +V+ VGDS E+A KM D+YVN+F S F V  +KL  LVATA   + +   
Sbjct  2630  SKPMLLVDSNMVTTVGDSREIASKMLDSYVNSFISLFGVNRDKLDKLVATARDCVKRGDD  2689

Query  2626  LDNVLSTFISAAR-QGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMT  2684
                V+ TF  AAR    V+SDVET  +V+ L+ +++ D+++T +  NNY+ +Y K +++ 
Sbjct  2690  FQTVIKTFTDAARGPAGVESDVETSSIVDALQYAYKHDLQLTTEGFNNYVPSYIKPDSVA  2749

Query  2685  PRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTC  2744
               DLG  ID +A  +N    ++ N A IWN  D+M LS+ L++QIR A +K N+PF+LT 
Sbjct  2750  TADLGCLIDLNAASVNQTSIRNANGACIWNSSDYMKLSDSLKRQIRIACRKCNIPFRLTT  2809

Query  2745  ATTRQVVNVVTTKIA---LKGGKIVNNWLKQLIK--------VTLVFLFVAAIFYLITPV  2793
             +  R   N+++ K +   L GG     WL +L          VTLV   +A + YL  P 
Sbjct  2810  SRLRSADNILSVKFSATKLSGG--APKWLLKLRDFTWKSYCVVTLVVFAMAVLSYLCLPA  2867

Query  2794  HVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQR-GGSYTNDKACP  2852
               MS+ +     I+ YK ++ G+ RDI  +DTCFANK+  F  WF++  GG + ND +CP
Sbjct  2868  FNMSQVSFHEDRILTYKVVENGIIRDITPSDTCFANKYQSFSKWFNEHYGGLFNNDISCP  2927

Query  2853  LIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSA  2912
             +  AVI    G  VP LP  +        L F+ RVF++  N+CYTP+  I Y  F+ S 
Sbjct  2928  VTVAVIAGVAGARVPNLPANVAWVGRQIVL-FVSRVFASSNNVCYTPTAEIPYERFSDSG  2986

Query  2913  CVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEG  2971
             CVLA+ECT+F+DA GK  PYCYD  VL G+ AY+ ++P  RY + D  + I+FP    E 
Sbjct  2987  CVLASECTLFRDAEGKINPYCYDPTVLPGASAYDQMKPHVRYDMYDSDMYIKFPEVVFES  3046

Query  2972  SVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMF  3031
             ++R+  T  + YCR G+CE +  GVC++T+G W + ND+Y + PGV+CG +  +++  + 
Sbjct  3047  TLRITKTLATRYCRFGSCEDANEGVCITTNGSWAIYNDHYANKPGVYCGDNYFDIVRRLG  3106

Query  3032  TPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTV  3091
               L QP+    +S S+  G ++ I +T   YY  + +RA  +Y+          L++   
Sbjct  3107  LSLFQPVTYFQLSTSLALGVMLCIFLTIAFYYVNKVKRALADYTQCAVVAVAAALLNSLC  3166

Query  3092  LCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTK  3151
             LC       L   Y+ +Y Y TFYLT + +F+ H+ W VMF  +VP W+  AYI+ +  +
Sbjct  3167  LCFVVSNPLLVLPYTALYYYATFYLTGEPAFVMHVSWFVMFGTVVPIWMVFAYIVGVCLR  3226

Query  3152  HFYWFFSNYLKRRV-VF-NGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQ--YNRY  3207
             H  W  + + K+ V VF +G    +F++AA   F++NK+ Y+ LR+ +    TQ  YNRY
Sbjct  3227  HLLWVMAYFSKKHVEVFTDGKLNCSFQDAAANIFVINKDTYVALRNSI----TQDSYNRY  3282

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFR  3267
             L+++NKYKY+SGAMDT SYREA+  HL KAL  +S +GSDVL+QPP  S+TS+VLQSG  
Sbjct  3283  LSMFNKYKYYSGAMDTASYREASAAHLCKALQVYSETGSDVLFQPPNCSVTSSVLQSGLV  3342

Query  3268  KMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNH  3327
             KMA PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ K+N 
Sbjct  3343  KMAAPSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVSKTNL  3402

Query  3328  NFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGS  3384
             +F+VQ        LRV+GH+M   +LKL V++ANP+TP Y F  ++PG +FSVLACYNG 
Sbjct  3403  SFIVQKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLACYNGR  3462

Query  3385  PSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNF  3444
             P+GV+   MR N TIKGSFL GSCGSVG+  + + ++FCYMH MEL  G H G   +G  
Sbjct  3463  PTGVFMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAFDGVM  3522

Query  3445  YGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-E  3503
             YG F DRQ  Q   +D   T+N++AWLYAA++NG  WF+    T +  FN  AM   + E
Sbjct  3523  YGAFEDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSNQFTE  3582

Query  3504  PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC  3563
              +    VD+L   + +TG++V  +  ++ + L  G  G+TILG+++LEDEFTP DV  Q 
Sbjct  3583  FIGTQSVDML---AHKTGVSVEQLLYAI-QTLHKGFQGKTILGNSMLEDEFTPDDVNMQV  3638

Query  3564  SGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSA  3623
              GV  QS VKR   G  HWL  T+L + +  +Q T+++++ +L+E   L     ++ + A
Sbjct  3639  MGVVMQSGVKRISYGLVHWLFTTLLLAYVATLQLTKFTIWNYLFEVIPLQLTPLVLCVMA  3698

Query  3624  FAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKL  3679
               M+ VKHKH FL LFLLP+   + Y N+VY P    +S ++ +  WL+     +     
Sbjct  3699  CVMLTVKHKHTFLTLFLLPTAICLTYANIVYEPQTPVSSALIAVANWLNPASVYMRTTH-  3757

Query  3680  KDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIIS  3739
              D  +Y S    L ++  R    + +     L + +   Y    G+     ++    + +
Sbjct  3758  TDLGVYLSLCFALAVVVRRLYRPNASNLALALGSAMVWFYTYTTGDC-SSPLTYLMFLTT  3816

Query  3740  VTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCL  3799
             +TS+Y+  V   + +A+    +   Y P        ++ ++L+Y  +GYFCT YFG+F L
Sbjct  3817  LTSDYTVTVFLAVNVAKFFARVVFLYAPHAGFIFPEVKLVLLMYLAVGYFCTVYFGVFSL  3876

Query  3800  LNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ  3859
             LN   R+ LGVYDY VSTQEFRY+   GL  P+NS +A +LN+KL+G+GG PCIK+A+VQ
Sbjct  3877  LNLKLRVPLGVYDYTVSTQEFRYLTGNGLHAPRNSWEALRLNMKLIGIGGTPCIKIASVQ  3936

Query  3860  SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLL  3919
             SK++D+KCTSVVLLSVLQQL +E++SK WA CV+LHNDIL A D TEAF+  V L + L+
Sbjct  3937  SKLTDLKCTSVVLLSVLQQLHLEANSKAWAHCVKLHNDILAATDPTEAFDNFVCLFATLM  3996

Query  3920  SMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLK  3978
             S    VD+  L  ++LD+ + LQA  SEFS L SYA    AQ +Y++A+ +GD S  VLK
Sbjct  3997  SFSANVDLEALASDLLDHPSVLQATLSEFSHLASYAELEAAQSSYQKALNSGDASPQVLK  4056

Query  3979  KLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLR  4038
              L+K++N+AK+ +++D A+ RKLE+MA+QAMT MYKQAR+EDK+AK+ SAMQTMLF M++
Sbjct  4057  ALQKAVNIAKNAYEKDKAVARKLERMAEQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIK  4116

Query  4039  KLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEI  4098
             KLDND LN +I+NAR+GCVPL+++PL  + KL VVIPD   +       + +YA ALW+I
Sbjct  4117  KLDNDVLNGVISNARNGCVPLSVVPLCASNKLRVVIPDITIWNKVVTWPSLSYAGALWDI  4176

Query  4099  QQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR-ANSAVKLQNNELSPVALRQMSCAAG  4157
               + + D ++V+ S+++  N  +L WPL++   R A+SAV LQNNE+ P  L+ M  +AG
Sbjct  4177  SLINNVDGEVVKSSDVTETNE-SLTWPLVLECTRAASSAVTLQNNEIRPSGLKTMVVSAG  4235

Query  4158  TTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVT  4217
                  C + ++LAYY   +G + ++ +LS+   LKWA+    DG   I  EL+PPC+F+ 
Sbjct  4236  IDHANC-NTSSLAYYEPVEGRKMLMGILSENAHLKWAKVEGRDGFVNI--ELQPPCKFLI  4292

Query  4218  DTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAA  4277
               PKGP+V+YLYF+K LNNL+RG +LG +AATVRLQAG+ TE   NS+VLS   F+VD  
Sbjct  4293  AGPKGPEVRYLYFVKNLNNLHRGQLLGHIAATVRLQAGSNTEFAINSSVLSAVTFSVDPG  4352

Query  4278  KAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP  4337
             KAY D++ +GG P+TNCVKML   TGTG A++V PEAN DQ+++GGAS CLYCR HI+HP
Sbjct  4353  KAYLDFVNAGGAPLTNCVKMLTPKTGTGIAVSVKPEANADQDTYGGASVCLYCRAHIEHP  4412

Query  4338  NPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQ  4397
             +  G C  KGK+VQ+P     DPVGF L+NT C VC  W G+GC+CD LR   +  +   
Sbjct  4413  DVTGVCKFKGKFVQVPLHI-RDPVGFCLQNTPCNVCQFWIGHGCNCDALRGTTIPQSKDS  4471

Query  4398  SFLN  4401
             +FLN
Sbjct  4472  NFLN  4475


 Score =  177 bits (450),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 250/1066 (23%), Positives = 445/1066 (42%), Gaps = 91/1066 (9%)

Query  13    HVQLSLPVLQVRDVLVR---GFGDSVEEVLSEARQHLKDGTCGLV--EVEKGVLPQLEQP  67
             HV L   +    D++++    F D  E       + L  G+  L   +  KG +  L  P
Sbjct  28    HVSLKASLCDAGDLVLKISPWFMDG-ESAYKHVSEQLSKGSKLLFVPQTLKGFIRHLPGP  86

Query  68    YVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETL-----GVLVPHVGEIPVAYRKVL  122
              V++             MV  +A       G  G TL     G+  P   ++     + L
Sbjct  87    RVYLVERLTGGTYSDPFMVNQLAYQNAAGEGVIGTTLQGKRVGMFFPFDADLVTGEFQFL  146

Query  123   LRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAY  182
             LRK   KG GG+ +       D   +    PY D  +          ++ L+++L GG +
Sbjct  147   LRK---KGFGGNRFR------DAPWDYNWTPYSDLMDALEADPCGKYSQSLLKKLVGGDF  197

Query  183   TRYVDNNFCGPDGYPLECIKDLLARAG--KASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             T  +D   CG +G P+     L+A  G  K +   +E     D+ R +   +   + I W
Sbjct  198   TP-IDQYMCGKNGKPIAEFAALMASEGITKLADVEAEVKSRTDSDRYI-VFKNKLYRIVW  255

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
               +R + +Y  Q+ F +    + DT   + P   F + S I+ I P    +       + 
Sbjct  256   NVQRKDVAYSKQSAFTMNSIVQLDTME-DVPRHSFTIGSEIQVIAPSTAVQANGHLNLKQ  314

Query  301   RSVYPV---ASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKE-GATT  356
             R +Y      + +E N +  S  + C  CG+ SW TG+ V+     CG      +    +
Sbjct  315   RLLYAFYGKQAVSEPNYIYHSAYVDCTSCGKGSWLTGNAVQGFACDCGAHYCANDVDLQS  374

Query  357   CGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRT--IAFGGCVFSYV  414
              G + +NAV+   CP   + E   +H+L +  +    K  +   G+T  + +GG +++Y+
Sbjct  375   SGLVRKNAVLLTTCPCNKDGEC--KHTLPQLVSMMTDKCDVEVVGKTFILTYGGVIYAYM  432

Query  415   GCHNKCAYWVPRASA---NIG-CNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLN  470
             GC     +++PRA +    IG    TG  G  S+      L  L++ +  IN V +F L 
Sbjct  433   GCSGGTMHFIPRAKSCVSKIGDAIFTGCTGTWSKVCETANL-FLERAQHAINFVNEFVLT  491

Query  471   EEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSIL  530
             E +  +L+  ++S     +  +   ++  +  +   G + VT G   +G  N+G      
Sbjct  492   ETVVALLSGTTSSIEELRDLCRNATFEKVRDYLTPRG-WIVTMGSYIEGVINVGAAGVCN  550

Query  531   SPLYA-----------FASEAARVVR--SIFSRTLETAQNSV--RVLQKAAITILDGISQ  575
             + L A           F   AA   +  S    TL+   +S+  RV       I   ++ 
Sbjct  551   AALNAPFIVLSGLGESFKKVAATPWKLCSSLRETLDHYADSITYRVF---PYDIPCDVTD  607

Query  576   YSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKF  635
             Y+  L+D  + T   A     V  Y+   V QLT+     +F +    +   +      +
Sbjct  608   YTALLLDCAVLTGASA---YFVARYVDEKVEQLTNL----VFSSCQSAVAAFVQACMSTY  660

Query  636   KEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIII  695
             K   +F+ D + ++K +S           V       + ++ F  +++K + L   ++  
Sbjct  661   KATAKFISDMFTLIKVVSERLYVYTSVGFVVVGDYSSQLLKQFMHILSKAMQLLHTTVSW  720

Query  696   GGAKLKAL--NLGETFVTHSKGLYRKCVKSR---EETGLLMPLK-APKEIIFLE----GE  745
              G+KL ++  N  ++ V  S   Y    + R   ++  L++P   + K+I  LE      
Sbjct  721   AGSKLPSVVYNGRDSLVFPSGTYYCVSTQGRSLQDQFDLVIPGDLSKKQIGILEPTPNST  780

Query  746   TLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCI-NGLMLLEIKDTEK-YCALA  803
             T+  ++ T  V +  G L+P ++ + E V    VG  V I N + +  ++D+E  +  L 
Sbjct  781   TVDKKINTNVVEVVVGQLEPTKEHSPELV----VGDYVIISNKIFVRSVEDSETVFYPLC  836

Query  804   PNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSVNITFELDERIDKVL-NEKCSAYT  861
              +  +    F LKGGAP K V FG +   E+   +SV++ +++   +D +L   + + +T
Sbjct  837   TDGKIVPTLFRLKGGAPPKGVKFGGEQTKEITAVRSVSVDYDVHPVLDALLAGSELATFT  896

Query  862   VELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMY  921
             VE    V +F  VV D VI+ L  +       G DL++++    Y+++  G+   +S M 
Sbjct  897   VEKDLPVKDFVDVVKDEVIELLSKLLRGYNVDGFDLEDFADTPCYVYNAEGDLAWSSTMT  956

Query  922   CSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLD  981
              S  P +E EEE D +  E E  ++     ED+       + A   A+ P E+ + D L 
Sbjct  957   FSVNPVEEVEEECDDDYVEDEYLSEEMLVEEDEN-----SWAAAVEAVIPMEDVQLDTLV  1011

Query  982   DDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNS  1027
              +   +    D +E   T      VEV     +E + V    EV S
Sbjct  1012  AEIDVSEPADDVAEQASTEE----VEVPSACVLEASQVANAAEVES  1053


 Score =  139 bits (349),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 0/158 (0%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             ++ L ++V +   D +  A+  +  ++VNAAN +LKHGGG+A A+++A+   +Q ESDDY
Sbjct  1192  HIVLNNDVTLVFGDAIAVARATEDCILVNAANTHLKHGGGIAAAIDRASGGLVQAESDDY  1251

Query  1091  IATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLS  1150
             +   GPL VG S +L GH LA   LHVVGP+    +DIQLLK  Y+ FN++ ++++PL+S
Sbjct  1252  VNFYGPLNVGDSTLLKGHGLATGILHVVGPDARANQDIQLLKRCYKAFNKYPLVVSPLIS  1311

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVS  1188
             AGIF  +P  SL   +  V T  Y+ V  + +Y+ L +
Sbjct  1312  AGIFCVEPRVSLEYLLSVVHTKTYVVVNSEKVYNDLAA  1349


> sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU5 OX=694008 GN=rep PE=3 SV=1
Length=7182

 Score = 2174 bits (5632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1220/3120 (39%), Positives = 1808/3120 (58%), Gaps = 132/3120 (4%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C +  A    ++ +   +  +   VD G ++Y Y+SK  +  +I   N   + +  MP+
Sbjct  1379  ICTDQSANAKLLKGRGVDLTKKTQTVD-GVKYYLYSSKDPLTDIITAANAC-KGICAMPI  1436

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L +A + ++ + VP    ++S D V   N  +  + +TPE+ FI T+   G 
Sbjct  1437  GYVTHGLDLAQAGQQVKKITVPYVCLLASKDQVPILNSDV--AVQTPEQSFINTVIANGG  1494

Query  1511  YKDWSY-SGQSTQLGIEF---LKRGDKSVYYTSNPTTFHLDGEV-ITFDNL---KTLLSL  1562
             Y  W   +G+    G+ +   L   D+++ Y  N   + + G++ + FD+L   +T L+ 
Sbjct  1495  YHCWHLVTGELIVKGVSYRKLLNWSDQTICYADN-KFYVVKGQIALPFDSLEKCRTYLTS  1553

Query  1563  R--EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             R  + + + V  T+D +N  T V++ + TY  Q G  +  G+D++   P     G+  Y+
Sbjct  1554  RAAQQKNVDVLVTIDGVNFRTVVLNNTTTYRVQLGSVFYKGSDISDTIPTEKMSGEAVYL  1613

Query  1621  LPN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATA  1679
               N  +  +    E Y T D +FL RY S L   KKWKY   +G+ S+K   NNCY+   
Sbjct  1614  ADNLSEAEKAVLSEVYGTADTAFLHRYYSLLALVKKWKYTVHDGVKSLKLNSNNCYVNVT  1673

Query  1680  LLTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH  1738
             +L L  + E+KF  PALQ AY + + G++  F ALI+AY + T GE  D    +  +   
Sbjct  1674  MLMLDMLKEIKFIVPALQAAYLKHKGGDSTEFIALIMAYGDCTYGEPDDASRLLHTILSK  1733

Query  1739  ANLDS-CKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYL  1797
             A L +  K V    C  CG Q TT  G++A +Y+G  S ++     +  C CG    + L
Sbjct  1734  AELTTQAKMVWRQWCNVCGVQDTTTTGLKACIYVGMNSLDELHATHEECCQCGDVRKRQL  1793

Query  1798  VQQESPFVMMSAPPAQYELKHGTFTCASEYTG-------NYQCGHYKHITSKETL-YCID  1849
             V+  +P++++S       +   + +   +YT            GHY H+  K+ L Y  D
Sbjct  1794  VEHNAPWLLLSGLNEAKVMTPTSQSAGPDYTAFNVFQGVETSVGHYLHVRVKDNLLYKYD  1853

Query  1850  GALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTE  1909
                L+K+S+ K  +TDV+Y +  Y+     V Y LDG    ++DP L  +Y KD  YFT+
Sbjct  1854  SGSLSKTSDMKCKMTDVYYPKQRYSADCNVVVYSLDGNTWADVDPDLSAFYMKDGKYFTK  1913

Query  1910  QPI------DLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGY--KKPASRELKVTFFP  1961
             +P+       ++    Y N+          +   +   N L G+   KP S++L  +FFP
Sbjct  1914  KPVIEYSPATILSGSVYTNSCLVGHDGTIGSDAISSSFNNLLGFDNSKPVSKKLTYSFFP  1973

Query  1962  DLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVET  2021
             D  GDV+  +Y  Y P +K GA L  KPI+W  N+  + A  K N   +R ++   PV  
Sbjct  1974  DFEGDVILTEYSTYDPIYKNGAMLHGKPILWVNNSKFDSALNKFNRATLRQVYDIAPVTL  2033

Query  2022  SNSFDVLKSEDAQGMDNLAC-EDLKPVSE-EVVENPTIQKDVLECNVKTTEVVGD---II  2076
              N + VL+    Q ++  A  ED KP S  +V E+   +  +++C       V D    +
Sbjct  2034  ENKYTVLQDNQIQQVEVEAPKEDAKPQSPVQVAEDIDNKLPIIKCKGLKKPFVKDGYSFV  2093

Query  2077  LKPANNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPW  2135
               P    + + + +G  DL A YVD N  L + K N  S +  + T+    L+ + +   
Sbjct  2094  NDP--QGVNVIDTLGIDDLRALYVDRNLRLIVLKENNWSALFNIHTVEKGDLSVIAASGS  2151

Query  2136  DT----IANYAKPFLNKVVSTTTNIVT---RCLNRVCTNYMP------YFFTLLLQLC--  2180
              T    I   A     +  S T N+ T   + L R+  N +         F LL  L   
Sbjct  2152  ITRRVKILLGASSLFAQFASVTVNVTTAMGKALGRMTRNVITNTGIIGQGFALLKMLLIL  2211

Query  2181  --TFTRSTN-SRIKASMPTTIAKNTVKS-VGKFCLEASFNYLKSPNFSKLINIIIWFLLL  2236
               TF +S N S +K  +        V + V K C  A+++ L    F ++       LL 
Sbjct  2212  PFTFWKSKNQSTVKVEVGALRTAGIVTTNVVKQCASAAYDVLVV-KFKRIDWKSTLRLLF  2270

Query  2237  SVC------------------LGSLIYSTAALGVLM------SNLGMPSYCTGYREGYLN  2272
              +C                  L S +    A G+L       S LG+ S C G  E Y N
Sbjct  2271  LICTTGLLLSSLYYLFLFHQVLTSDVMLDGAEGMLATYRELRSYLGIHSLCDGMVEAYRN  2330

Query  2273  STNVTIATYCTG-SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAY  2331
               +  +  +C+  S  C+ CL G DSL  Y + + IQ  ++S+  ++     V E+ LAY
Sbjct  2331  -VSYDVNDFCSNRSALCNWCLIGQDSLTRYSAFQMIQTHVTSYVINIDWVWFVMEFALAY  2389

Query  2332  ILFTRFFYVLGLAAIMQLFFSYFA--VHFISNSWLMWLIINLVQMAPISAMVRMYIFFAS  2389
             +L+T  F VL L    Q FFSY    V++ S ++L+      V   P+  +VR+Y F A 
Sbjct  2390  VLYTSTFNVLLLVVSSQYFFSYTGAFVNWRSYNYLVSGYFFCVTHIPLLGLVRIYNFLAC  2449

Query  2390  FYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHN  2449
              +++ + Y HV++GC  + C++CYKRNR TRVE +T+V G +R+FY+ ANGG  FC  HN
Sbjct  2450  LWFLRRFYNHVINGCKDTACLLCYKRNRLTRVEASTVVCGSKRTFYIVANGGTSFCCRHN  2509

Query  2450  WNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAG  2509
             WNCV+CDT   G+TFI +EVA DL+   +R + PTD+S Y V+SVTVK+  + L++ + G
Sbjct  2510  WNCVDCDTAGIGNTFICEEVANDLTTSLRRLVKPTDKSHYYVESVTVKDSVVQLHYSREG  2569

Query  2510  QKTYERHSLSHFVNLDNLRAN---NTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLM  2565
                YER+ L +F NLD L+      T   +P  N +++D   + +E+ A+SA VYYSQ++
Sbjct  2570  ASCYERYPLCYFTNLDKLKFKEVCKTPTGIPEHNFLIYDSSDRGQENLARSACVYYSQVL  2629

Query  2566  CQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVS  2625
              +P+LL+D  +V+ VGDS E+A KM D+YVN+F S F V  +KL  LVATA   + +   
Sbjct  2630  SKPMLLVDSNMVTTVGDSREIASKMLDSYVNSFISLFGVNRDKLDKLVATARDCVKRGDD  2689

Query  2626  LDNVLSTFISAAR-QGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMT  2684
                V+ TF  AAR    V+SDVET  +V+ L+ +++ D+++T +  NNY+ +Y K +++ 
Sbjct  2690  FQTVIKTFTDAARGPAGVESDVETSSIVDALQYAYKHDLQLTTEGFNNYVPSYIKPDSVA  2749

Query  2685  PRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTC  2744
               DLG  ID +A  +N    ++ N A IWN  D+M LS+ L++QIR A +K N+PF+LT 
Sbjct  2750  TADLGCLIDLNAASVNQTSIRNANGACIWNSSDYMKLSDSLKRQIRIACRKCNIPFRLTT  2809

Query  2745  ATTRQVVNVVTTKIA---LKGG------KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHV  2795
             +  R   N+++ K +   L GG      K+ +   K    VTLV   +A + YL  P   
Sbjct  2810  SRLRSADNILSVKFSATKLSGGAPKWLLKLRDFTWKSYCVVTLVVFAMAVLSYLCLPAFN  2869

Query  2796  MSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQR-GGSYTNDKACPLI  2854
             MS+ +     I+ YK ++ G+ RDI  +DTCFANK+  F  WF++  GG + ND +CP+ 
Sbjct  2870  MSQVSFHEDRILTYKVVENGIIRDITPSDTCFANKYQSFSKWFNEHYGGLFNNDISCPVT  2929

Query  2855  AAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACV  2914
              AVI    G  VP LP  +        L F+ RVF++  N+CYTP+  I Y  F+ S CV
Sbjct  2930  VAVIAGVAGARVPNLPANVAWVGRQIVL-FVSRVFASSNNVCYTPTAEIPYERFSDSGCV  2988

Query  2915  LAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEGSV  2973
             LA+ECT+F+DA GK  PYCYD  VL G+ AY+ ++P  RY + D  + I+FP    E ++
Sbjct  2989  LASECTLFRDAEGKINPYCYDPTVLPGASAYDQMKPHVRYDMYDSDMYIKFPEVVFESTL  3048

Query  2974  RVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTP  3033
             R+  T  + YCR G+CE +  GVC++T+G W + ND+Y + PGV+CG +  +++  +   
Sbjct  3049  RITKTLATRYCRFGSCEDANEGVCITTNGSWAIYNDHYANKPGVYCGDNYFDIVRRLGLS  3108

Query  3034  LIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLC  3093
             L QP+    +S S+  G ++ I +T   YY  + +RA  +Y+          L++   LC
Sbjct  3109  LFQPVTYFQLSTSLALGVMLCIFLTIAFYYVNKVKRALADYTQCAVVAVAAALLNSLCLC  3168

Query  3094  LTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHF  3153
                    L   Y+ +Y Y TFYLT + +F+ H+ W VMF  +VP W+  AYI+ +  +H 
Sbjct  3169  FVVSNPLLVLPYTALYYYATFYLTGEPAFVMHVSWFVMFGTVVPIWMVFAYIVGVCLRHL  3228

Query  3154  YWFFSNYLKRRV-VF-NGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALY  3211
              W  + + K+ V VF +G    +F++AA   F++NK+ Y+ LR+ +      YNRYL+++
Sbjct  3229  LWVMAYFSKKHVEVFTDGKLNCSFQDAAANIFVINKDTYVALRNSI--TQDSYNRYLSMF  3286

Query  3212  NKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAF  3271
             NKYKY+SGAMDT SYREA+  HL KAL  +S +GSDVL+QPP  S+TS+VLQSG  KMA 
Sbjct  3287  NKYKYYSGAMDTASYREASAAHLCKALQVYSETGSDVLFQPPNCSVTSSVLQSGLVKMAA  3346

Query  3272  PSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLV  3331
             PSG VE CMVQVTCG+ TLNGLWLD+ V+CPRHV+C ++ + +PNY+ LL+ K+N +F+V
Sbjct  3347  PSGVVENCMVQVTCGSMTLNGLWLDNYVWCPRHVMCPADQLSDPNYDALLVSKTNLSFIV  3406

Query  3332  Q---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGV  3388
             Q        LRV+GH+M   +LKL V++ANP+TP Y F  ++PG +FSVLACYNG P+GV
Sbjct  3407  QKNVGAPANLRVVGHTMVGTLLKLTVESANPQTPAYTFTTVKPGASFSVLACYNGRPTGV  3466

Query  3389  YQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPF  3448
             +   MR N TIKGSFL GSCGSVG+  + + ++FCYMH MEL  G H G   +G  YG F
Sbjct  3467  FMVNMRQNSTIKGSFLCGSCGSVGYTQEGNVINFCYMHQMELSNGTHTGCAFDGVMYGAF  3526

Query  3449  VDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQ  3507
              DRQ  Q   +D   T+N++AWLYAA++NG  WF+    T +  FN  AM   + E +  
Sbjct  3527  EDRQVHQVQLSDKYCTINIVAWLYAAILNGCNWFVKPNKTGIATFNEWAMSNQFTEFIGT  3586

Query  3508  DHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVT  3567
               VD+L   + +TG++V  +  ++ + L  G  G+TILG+++LEDEFTP DV  Q  GV 
Sbjct  3587  QSVDML---AHKTGVSVEQLLYAI-QTLHKGFQGKTILGNSMLEDEFTPDDVNMQVMGVV  3642

Query  3568  FQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMM  3627
              QS VKR   G  HWL  T+L + +  +Q T+++++ +L+E   L     ++ + A  M+
Sbjct  3643  MQSGVKRISYGLVHWLFTTLLLAYVATLQLTKFTIWNYLFEVIPLQLTPLVLCVMACVML  3702

Query  3628  FVKHKHAFLCLFLLPSLATVAYFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKLKDCV  3683
              VKHKH FL LFLLP+   + Y N+VY P    +S ++ +  WL+     +      D  
Sbjct  3703  TVKHKHTFLTLFLLPTAICLTYANIVYEPQTPVSSALIAVANWLNPASVYMRTTH-TDLG  3761

Query  3684  MYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSN  3743
             +Y S    L ++  R    + +     L + +   Y    G+     ++    + ++TS+
Sbjct  3762  VYLSLCFALAVVVRRLYRPNASNLALALGSAMVWFYTYTTGDC-SSPLTYLMFLTTLTSD  3820

Query  3744  YSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             Y+  V   + +A+    +   Y P        ++ ++L+Y  +GYFCT YFG+F LLN  
Sbjct  3821  YTVTVFLAVNVAKFFARVVFLYAPHAGFIFPEVKLVLLMYLAVGYFCTVYFGVFSLLNLK  3880

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
              R+ LGVYDY VSTQEFRY+   GL  P+NS +A +LN+KL+G+GG PCIK+A+VQSK++
Sbjct  3881  LRVPLGVYDYTVSTQEFRYLTGNGLHAPRNSWEALRLNMKLIGIGGTPCIKIASVQSKLT  3940

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             D+KCTSVVLLSVLQQL +E++SK WA CV+LHNDIL A D TEAF+  V L + L+S   
Sbjct  3941  DLKCTSVVLLSVLQQLHLEANSKAWAHCVKLHNDILAATDPTEAFDNFVCLFATLMSFSA  4000

Query  3924  AVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKLKK  3982
              VD+  L  ++LD+ + LQA  SEFS L SYA    AQ +Y++A+ +GD S  VLK L+K
Sbjct  4001  NVDLEALASDLLDHPSVLQATLSEFSHLASYAELEAAQSSYQKALNSGDASPQVLKALQK  4060

Query  3983  SLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN  4042
             ++N+AK+ +++D A+ RKLE+MA+QAMT MYKQAR+EDK+AK+ SAMQTMLF M++KLDN
Sbjct  4061  AVNIAKNAYEKDKAVARKLERMAEQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDN  4120

Query  4043  DALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVV  4102
             D LN +I+NAR+GCVPL+++PL  + KL VVIPD   +       + +YA ALW+I  + 
Sbjct  4121  DVLNGVISNARNGCVPLSVVPLCASNKLRVVIPDITIWNKVVTWPSLSYAGALWDISLIN  4180

Query  4103  DADSKIVQLSEISMDNSPNLAWPLIVTALR-ANSAVKLQNNELSPVALRQMSCAAGTTQT  4161
             + D ++V+ S+++  N  +L WPL++   R A+SAV LQNNE+ P  L+ M  +AG    
Sbjct  4181  NVDGEVVKSSDVTETNE-SLTWPLVLECTRAASSAVTLQNNEIRPSGLKTMVVSAGIDHA  4239

Query  4162  ACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPK  4221
              C + ++LAYY   +G + ++ +LS+   LKWA+    DG   I  EL+PPC+F+   PK
Sbjct  4240  NC-NTSSLAYYEPVEGRKMLMGILSENAHLKWAKVEGRDGFVNI--ELQPPCKFLIAGPK  4296

Query  4222  GPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYK  4281
             GP+V+YLYF+K LNNL+RG +LG +AATVRLQAG+ TE   NS+VLS   F+VD  KAY 
Sbjct  4297  GPEVRYLYFVKNLNNLHRGQLLGHIAATVRLQAGSNTEFAINSSVLSAVTFSVDPGKAYL  4356

Query  4282  DYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKG  4341
             D++ +GG P+TNCVKML   TGTG A++V PEAN DQ+++GGAS CLYCR HI+HP+  G
Sbjct  4357  DFVNAGGAPLTNCVKMLTPKTGTGIAVSVKPEANADQDTYGGASVCLYCRAHIEHPDVTG  4416

Query  4342  FCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
              C  KGK+VQ+P     DPVGF L+NT C VC  W G+GC+CD LR   +  +   +FLN
Sbjct  4417  VCKFKGKFVQVPLH-IRDPVGFCLQNTPCNVCQFWIGHGCNCDALRGTTIPQSKDSNFLN  4475


 Score =  179 bits (453),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 248/1066 (23%), Positives = 444/1066 (42%), Gaps = 91/1066 (9%)

Query  13    HVQLSLPVLQVRDVLVR---GFGDSVEEVLSEARQHLKDGTCGLV--EVEKGVLPQLEQP  67
             HV L   +    D++++    F D  E       + L  G+  L   +  KG +  L  P
Sbjct  28    HVSLKASLCDAGDLVLKISPWFMDG-ESAYKHVSEQLSKGSKLLFVPQTLKGFIRHLPGP  86

Query  68    YVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETL-----GVLVPHVGEIPVAYRKVL  122
              V++             MV  +A       G  G TL     G+  P   ++     + L
Sbjct  87    RVYLVERLTGGTYSDPFMVNQLAYQNAAGEGVIGTTLQGKRVGMFFPFDADLVTGEFQFL  146

Query  123   LRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAY  182
             LRK   KG GG+ +       D   +    PY D  +          ++ L+++L GG +
Sbjct  147   LRK---KGFGGNRFR------DAPWDYNWTPYSDLMDALEADPCGKYSQSLLKKLVGGDF  197

Query  183   TRYVDNNFCGPDGYPLECIKDLLARAG--KASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             T  +D   CG +G P+     L+A  G  K +   +E     D+ R +   +   + I W
Sbjct  198   TP-IDQYMCGKNGKPIAEFAALMASEGITKLADVEAEVKSRTDSDRYI-VFKNKLYRIVW  255

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
               +R + +Y  Q+ F +    + DT   + P   F + S I+ I P    +       + 
Sbjct  256   NVQRKDVAYSKQSAFTMNSIVQLDTME-DVPRHSFTIGSEIQVIAPSTAVQANGHLNLKQ  314

Query  301   RSVYPV---ASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKE-GATT  356
             R +Y      + +E N +  S  + C  CG+ SW TG+ V+     CG      +    +
Sbjct  315   RLLYAFYGKQAVSEPNYIYHSAYVDCTSCGKGSWLTGNAVQGFACDCGAHYCANDVDLQS  374

Query  357   CGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRT--IAFGGCVFSYV  414
              G + +NAV+   CP   + E   +H+L +  +    K  +   G+T  + +GG +++Y+
Sbjct  375   SGLVRKNAVLLTTCPCNKDGEC--KHTLPQLVSMMTDKCDVEVVGKTFILTYGGVIYAYM  432

Query  415   GCHNKCAYWVPRASANIG----CNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLN  470
             GC     +++PRA + +        TG  G  S+      L  L++ +  IN V +F L 
Sbjct  433   GCSGGTMHFIPRAKSCVSKIGDAIFTGCTGTWSKVCETANL-FLERAQHAINFVNEFVLT  491

Query  471   EEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSIL  530
             E +  +L+  ++S     +  +   ++  +  +   G + VT G   +G  N+G      
Sbjct  492   ETVVALLSGTTSSIEELRDLCRNATFEKVRDYLTPRG-WIVTMGSYIEGVINVGAAGVCN  550

Query  531   SPLYA-----------FASEAARVVR--SIFSRTLETAQNSV--RVLQKAAITILDGISQ  575
             + L A           F   AA   +  S    TL+   +S+  RV       I   ++ 
Sbjct  551   AALNAPFIVLSGLGESFKKVAATPWKLCSSLRETLDHYADSITYRVF---PYDIPCDVTD  607

Query  576   YSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKF  635
             Y+  L+D  + T   A     V  Y+   V QLT+     +F +    +   +      +
Sbjct  608   YTALLLDCAVLTGASA---YFVARYVDEKVEQLTNL----VFSSCQSAVAAFVQACMSTY  660

Query  636   KEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIII  695
             K   +F+ D + ++K +S           V       + ++ F  +++K + L   ++  
Sbjct  661   KATAKFISDMFTLIKVVSERLYVYTSVGFVVVGDYSSQLLKQFMHILSKAMQLLHTTVSW  720

Query  696   GGAKLKAL--NLGETFVTHSKGLYRKCVKSR---EETGLLMPLK-APKEIIFLE----GE  745
              G+KL ++  N  ++ V  S   Y    + R   ++  L++P   + K+I  LE      
Sbjct  721   AGSKLPSVVYNGRDSLVFPSGTYYCVSTQGRSLQDQFDLVIPGDLSKKQIGILEPTPNST  780

Query  746   TLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCI-NGLMLLEIKDTEK-YCALA  803
             T+  ++ T  V +  G L+P ++ + E V    VG  V I N + +  ++D+E  +  L 
Sbjct  781   TVDKKINTNVVEVVVGQLEPTKEHSPELV----VGDYVIISNKIFVRSVEDSETVFYPLC  836

Query  804   PNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSVNITFELDERIDKVL-NEKCSAYT  861
              +  +    F LKGGAP K V FG +   E+   +SV++ +++   +D +L   + + +T
Sbjct  837   TDGKIVPTLFRLKGGAPPKGVKFGGEQTKEITAVRSVSVDYDVHPVLDALLAGSELATFT  896

Query  862   VELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMY  921
             VE    V +F  VV D VI+ L  +       G DL++++    Y+++  G+   +S M 
Sbjct  897   VEKDLPVKDFVDVVKDEVIELLSKLLRGYNVDGFDLEDFADTPCYVYNAEGDLAWSSTMT  956

Query  922   CSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLD  981
              S  P +E EEE D +  E E  ++     ED+       + A   A+ P E+ + D L 
Sbjct  957   FSVNPVEEVEEECDDDYVEDEYLSEEMLVEEDEN-----SWAAAVEAVIPMEDVQLDTLV  1011

Query  982   DDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNS  1027
              +   +    D +E   T      VEV     +E + V    EV S
Sbjct  1012  AEIDVSEPADDVAEQASTEE----VEVPSACVLEASQVANAAEVES  1053


 Score =  138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 0/158 (0%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             ++ L ++V +   D +  A+  +  ++VNAAN +LKHGGG+A A+++A+   +Q ESDDY
Sbjct  1192  HIVLNNDVTLVFGDAIAVARATEDCILVNAANTHLKHGGGIAAAIDRASGGLVQAESDDY  1251

Query  1091  IATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLS  1150
             +   GPL VG S +L GH LA   LHVVGP+    +DIQLLK  Y+ FN++ ++++PL+S
Sbjct  1252  VNFYGPLNVGDSTLLKGHGLATGILHVVGPDARANQDIQLLKRCYKAFNKYPLVVSPLIS  1311

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVS  1188
             AGIF  +P  SL   +  V T  Y+ V  + +Y+ L +
Sbjct  1312  AGIFCVEPRVSLEYLLSVVHTKTYVVVNSEKVYNDLAA  1349


> sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=1a PE=3 SV=1
Length=4383

 Score = 1883 bits (4877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1076/2890 (37%), Positives = 1633/2890 (57%), Gaps = 125/2890 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +   +G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGENFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   I   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTI--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVD  2101
              D K       E+  I    L    K  +V   +I+    + +K  + +   D+   ++ 
Sbjct  2028  SDAK-------ESKEINIIKLSGVKKPFKVEDSVIVNDDTSEIKYVKSLSIVDVYDMWLT  2080

Query  2102  NSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNIV  2157
                  ++  N+LS  + + T+      G+  V S+P D +     KP  N VV    N +
Sbjct  2081  GCRYVVRTANDLSMAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNKI  2138

Query  2158  TRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNY  2217
             + C N     ++ + F LL      +       K    T +A      +     + +F  
Sbjct  2139  SACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFLT  2189

Query  2218  LKSPNFSKLINII--IWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTN  2275
              K    ++   II  I+ L  +    ++I+S   L      +G      G    ++ ST 
Sbjct  2190  FKWSVVARGACIIATIFLLWFNFIYANVIFSDFYL----PKIGFLPTFVGKIAQWIKSTF  2245

Query  2276  --VTIA------------TYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAF  2321
               VTI              YC GSI C  CL+G D LD Y +++ +Q     ++ D  AF
Sbjct  2246  SLVTICDLYSIQDVGFKNQYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRAF  2300

Query  2322  -------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLV  2372
                     +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L 
Sbjct  2301  VDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSLA  2360

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P    +R YI  ASF  ++  + HV  GC+   C+ CYKRNR+ RV+C+TIV G+ R
Sbjct  2361  NMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIR  2420

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V 
Sbjct  2421  YYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVT  2480

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              V      + L++++ GQ+TY+  + S FV+  NL  +  KG   ++V+V +  +  +++
Sbjct  2481  DVKQVGCYMRLFYERDGQRTYDDVNASLFVDYSNLLHSKVKGVPNMHVVVVENDA--DKA  2538

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  L
Sbjct  2539  NFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNAL  2598

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             +ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SCN
Sbjct  2599  IATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESCN  2658

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++ 
Sbjct  2659  NLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKK  2718

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + + 
Sbjct  2719  ACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFLLSLV-CFIG--LWCLM  2775

Query  2792  PVHVMSKHTDFSSEI-IGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTND  2848
             P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N 
Sbjct  2776  PTYTVHK-SDFQLPVYTSYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSNS  2834

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
              ACP++ AV+ +++G  V  +P  +LR      LHF+    SA G  CYTP   I Y++F
Sbjct  2835  MACPIVVAVVDQDLGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSNF  2893

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPNT  2967
               S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP  
Sbjct  2894  YASGCVLSSACTMFAMADGSPQPYCYTEGLMQNASLYSSLVPHVRYNLANAKGFIRFPEV  2953

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L+
Sbjct  2954  LREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDLI  3013

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
               +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ +
Sbjct  3014  YQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWCV  3073

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI  
Sbjct  3074  NFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYISV  3133

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             + + H +W F+    RR+  +  S  TFEE AL TF++ K+ Y KL++   L    +NRY
Sbjct  3134  VVSNHAFWVFA--YCRRLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNRY  3189

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG 
Sbjct  3190  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSGI  3249

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R ++
Sbjct  3250  VKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVTS  3309

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3310  SDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKPQ  3369

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  DCV F YMH +EL TG H GTD  G+FYG
Sbjct  3370  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGDFYG  3429

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  + 
Sbjct  3430  PYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQVK  3489

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G+
Sbjct  3490  SDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAGI  3546

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + AM
Sbjct  3547  KLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLAM  3605

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+Y
Sbjct  3606  LLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVIY  3664

Query  3686  ASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   Y
Sbjct  3665  GMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGTY  3722

Query  3745  SGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
             +      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  F
Sbjct  3723  TWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSLF  3781

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++D
Sbjct  3782  RMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLTD  3841

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   A
Sbjct  3842  VKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPAA  3901

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVL  3977
             VD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  L
Sbjct  3902  VDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARSSGSANQQQL  3961

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  3962  KQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4021

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W+
Sbjct  4022  RKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVWQ  4081

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCA  4155
             IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+     
Sbjct  4082  IQTIQDSDGTNKQLNEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVVN  4137

Query  4156  AGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRF  4215
             +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+F
Sbjct  4138  SGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCKF  4194

Query  4216  VTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVD  4275
                  KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+VD
Sbjct  4195  TVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSVD  4254

Query  4276  AAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHID  4335
               K Y D++  GG PI NCVKMLC H GTG AITV P+A  +Q+S+GGAS C+YCR  ++
Sbjct  4255  PKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTNQDSYGGASVCIYCRARVE  4314

Query  4336  HPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSAD  4395
             HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS D
Sbjct  4315  HPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSKD  4372

Query  4396  AQSFLNGFAV  4405
               +FLNGF V
Sbjct  4373  T-NFLNGFGV  4381


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T    V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAEKQVVLVSNNQEDFD  1425


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 208/935 (22%), Positives = 356/935 (38%), Gaps = 168/935 (18%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFCG-----PDGYPLECIKDLLARAGKASCTL-SEQLDFIDTK  225
             L+R   G     YVD   C       DG  LE   D   +  KA   + S++L F    
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADG--LEAYADKTLQEMKALFPIWSQELPF----  292

Query  226  RGVYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVF  275
                     +  +AW+  R  +    LQ+   I+          D  +G      P  V+
Sbjct  293  ---------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVY  343

Query  276  PLNSIIKTIQPRVEKKKLDGFM--------GRIRSVYPVASPNECNQMCLSTLMKC--DH  325
              +SII      + +  L   M          + + Y V    +C  +     + C  D 
Sbjct  344  ADDSII------LRQHNLVDIMSCFYMEADAVVNAFYGV-DLKDCGFVMQFGYIDCEQDL  396

Query  326  CGETSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHS  383
            C    W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S
Sbjct  397  CDFKGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDS  455

Query  384  LAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVV  439
               Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVV
Sbjct  456  FTLY------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVV  499

Query  440  GEGSEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKA  498
            G  +     NL+ + L  + V  +  G+    E + +         S        L+   
Sbjct  500  GCKAIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGV  549

Query  499  FKQIVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVV  544
            +K ++E+   F + + K     + +   G    +L  L            AF   A ++ 
Sbjct  550  YKPLLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYADKIC  609

Query  545  RSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGG  604
             ++ S++ E    S+  L  AAI  L+       +++D     SD  T+           
Sbjct  610  HAVVSKSKELLDVSLDSLS-AAIHYLNS------KIVDLAQHFSDFGTS-------FVSK  655

Query  605  VVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQI  664
            +V     + T+        L  VL       +  + F+++   I ++ S      V    
Sbjct  656  IVHFFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAF  707

Query  665  VTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSR  724
             + AK + +S++  F        +    I + G+K+  +  G   + HS  L        
Sbjct  708  RSVAKVVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PL  758

Query  725  EETGLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGT  781
            +   L MP    KA ++ I+L+G      +    V + T  L P         E P V  
Sbjct  759  DVYDLTMPSQVQKAKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVAD  813

Query  782  PVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSV  839
             +CI   + +     + Y  +    +   +       A  +VTF +  TV E+    K++
Sbjct  814  KICIVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRRVTFKEQPTVNEIASTPKTI  873

Query  840  NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGID  896
             + +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   
Sbjct  874  KVFYELDKDFNTILNTACGVFEVDDTVDMEEFYAVVVDAIEEKLSPCKELEGVGAKVSAF  933

Query  897  LDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
            L +    + +LFDE+GE  LAS +YC+F  P++D+
Sbjct  934  LQKLEDNSLFLFDEAGEEVLASKLYCAFTAPEDDD  968


> sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=1a PE=3 SV=1
Length=4383

 Score = 1882 bits (4874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1076/2890 (37%), Positives = 1634/2890 (57%), Gaps = 125/2890 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E +P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYNPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   I   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTI--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVD  2101
              D K       E+  I    L    K  +V   +I+    + +K  + +   D+   ++ 
Sbjct  2028  SDAK-------ESKEINIIKLSGVKKPFKVEDSVIVNDDTSEIKYVKSLSIVDVYDMWLT  2080

Query  2102  NSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNIV  2157
                  ++  N LS  + + T+      G+  V S+P D +     KP  N VV    N +
Sbjct  2081  GCRYVVRTANALSMAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNKI  2138

Query  2158  TRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNY  2217
             + C N     ++ + F LL      +       K    T +A      +     + +F  
Sbjct  2139  SACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFLT  2189

Query  2218  LKSPNFSKLINII--IWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTN  2275
              K    ++   II  I+ L  +    ++I+S   L      +G      G    ++ ST 
Sbjct  2190  FKWSVVARGACIIATIFLLWFNFIYANVIFSDFYL----PKIGFLPTFVGKIAQWIKSTF  2245

Query  2276  --VTIA------------TYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAF  2321
               VTI              YC GSI C  CL+G D LD Y +++ +Q     ++ D  AF
Sbjct  2246  SLVTICDLYSIQDVGFKNQYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRAF  2300

Query  2322  -------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLV  2372
                     +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L 
Sbjct  2301  VDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSLA  2360

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P    +R YI  ASF  ++  + HV  GC+   C+ CYKRNR+ RV+C+TIV G+ R
Sbjct  2361  NMLPAHVFMRFYIIIASFIKLFILFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIR  2420

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V 
Sbjct  2421  YYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVT  2480

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              V      + L++++ GQ+TY+  + S FV+  NL  +  KG   ++V+V +  +  +++
Sbjct  2481  DVKQVGCYMRLFYERDGQRTYDDVNASLFVDYSNLLHSKVKGVPNMHVVVVENDA--DKA  2538

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  L
Sbjct  2539  NFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNAL  2598

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             +ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SCN
Sbjct  2599  IATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESCN  2658

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++ 
Sbjct  2659  NLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKK  2718

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + + 
Sbjct  2719  ACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFLLSLV-CFIG--LWCLM  2775

Query  2792  PVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTND  2848
             P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N 
Sbjct  2776  PTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSNS  2834

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
              ACP++ AV+ +++G  V  +P  +LR      LHF+    SA G  CYTP   I Y++F
Sbjct  2835  MACPIVVAVVDQDLGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSNF  2893

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPNT  2967
               S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP  
Sbjct  2894  YASGCVLSSACTMFAMADGSPQPYCYTEGLMQNASLYSSLVPHVRYNLANAKGFIRFPEV  2953

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L+
Sbjct  2954  LREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDLI  3013

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
               +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ +
Sbjct  3014  YQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWCV  3073

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI  
Sbjct  3074  NFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYISV  3133

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             + + H +W F+    RR+  +  S  TFEE AL TF++ K+ Y KL++   L    +NRY
Sbjct  3134  VVSNHAFWVFA--YCRRLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNRY  3189

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG 
Sbjct  3190  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSGI  3249

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R ++
Sbjct  3250  VKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVTS  3309

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3310  SDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKPQ  3369

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  DCV F YMH +EL TG H GTD  G+FYG
Sbjct  3370  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGDFYG  3429

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  + 
Sbjct  3430  PYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQVK  3489

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G+
Sbjct  3490  SDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAGI  3546

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + AM
Sbjct  3547  KLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLAM  3605

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+Y
Sbjct  3606  LLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVIY  3664

Query  3686  ASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   Y
Sbjct  3665  GMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGTY  3722

Query  3745  SGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
             +      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  F
Sbjct  3723  TWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSLF  3781

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++D
Sbjct  3782  RMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLTD  3841

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   A
Sbjct  3842  VKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPAA  3901

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVL  3977
             VD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  L
Sbjct  3902  VDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARSSGSANQQQL  3961

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  3962  KQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4021

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W+
Sbjct  4022  RKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVWQ  4081

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCA  4155
             IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+     
Sbjct  4082  IQTIQDSDGTNKQLNEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVVN  4137

Query  4156  AGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRF  4215
             +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+F
Sbjct  4138  SGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCKF  4194

Query  4216  VTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVD  4275
                  KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+VD
Sbjct  4195  TVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSVD  4254

Query  4276  AAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHID  4335
               K Y D++  GG PI NCVKMLC H GTG AITV P+A  +Q+S+GGAS C+YCR  ++
Sbjct  4255  PKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTNQDSYGGASVCIYCRARVE  4314

Query  4336  HPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSAD  4395
             HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS D
Sbjct  4315  HPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSKD  4372

Query  4396  AQSFLNGFAV  4405
               +FLNGF V
Sbjct  4373  T-NFLNGFGV  4381


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T    V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAEKQVVLVSNNQEDFD  1425


 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 207/933 (22%), Positives = 355/933 (38%), Gaps = 164/933 (18%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFC---GPDGYPLECIKDLLARAGKASCTL-SEQLDFIDTKRG  227
             L+R   G     YVD   C   G     LE   D   +  KA   + S++L F      
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPF------  292

Query  228  VYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVFPL  277
                   +  +AW+  R  +    LQ+   I+          D  +G      P  V+  
Sbjct  293  -------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVYAD  345

Query  278  NSIIKTIQPRVEKKKLDGFM--------GRIRSVYPVASPNECNQMCLSTLMKC--DHCG  327
            +SII      + +  L   M          + + Y V    +C  +     + C  D C 
Sbjct  346  DSII------LRQHNLVDIMSCFYMEADAVVNAFYGV-DLKDCGFVMQFGYIDCEQDLCD  398

Query  328  ETSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLA  385
               W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S  
Sbjct  399  FKGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFT  457

Query  386  EYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGE  441
             Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVVG 
Sbjct  458  LY------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGC  501

Query  442  GSEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFK  500
             +     NL+ + L  + V  +  G+    E + +         S        L+   +K
Sbjct  502  KAIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYK  551

Query  501  QIVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRS  546
             ++E+   F + + K     + +   G    +L  L            AF   A ++  +
Sbjct  552  PLLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYADKICHA  611

Query  547  IFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVV  606
            + S++ E    S+  L  AAI  L+       +++D     SD  T+           +V
Sbjct  612  VVSKSKELLDVSLDSLS-AAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIV  657

Query  607  QLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVT  666
                 + T+        L  VL       +  + F+++   I ++ S      V     +
Sbjct  658  HFFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAFRS  709

Query  667  CAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREE  726
             AK + +S++  F        +    I + G+K+  +  G   + HS  L        + 
Sbjct  710  VAKVVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDV  760

Query  727  TGLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPV  783
              L MP    KA ++ I+L+G      +    V + T  L P         E P V   +
Sbjct  761  YDLTMPSQVQKAKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKI  815

Query  784  CINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNI  841
            CI   + +     + Y  +    +   +       A  +VTF +  TV E+    K++ +
Sbjct  816  CIVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRRVTFKEQPTVNEIASTPKTIKV  875

Query  842  TFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLD  898
             +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L 
Sbjct  876  FYELDKDFNTILNTACGVFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQ  935

Query  899  EWSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
            +    + +LFDE+GE  LAS +YC+F  P++D+
Sbjct  936  KLEDNSLFLFDEAGEEVLASKLYCAFTAPEDDD  968


> sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavirus 
OC43 OX=31631 GN=1a PE=3 SV=1
Length=4383

 Score = 1872 bits (4849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1079/2894 (37%), Positives = 1629/2894 (56%), Gaps = 133/2894 (5%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCFKWQVVVNGKYFTFKQANNNCFVNVSCLMLQSLH  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             L F     Q+A+   R+G  A F AL+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LTFKIVQWQEAWLEFRSGRPARFVALVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    G++AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGLDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+   GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFIGD-NVGHYVHVKCEQSYQLYDASNVKKVTDVTGKLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E K+T +P   GDVV  +   Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDSLNSKLGFDSSKEFVEYKITEWPTATGDVVLANDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     + + 
Sbjct  1978  ITFGKPVIWLSHEKASLNSLTY----------FNRPLLVDDNKFDVLKVDDVDDSGDSSE  2027

Query  2042  EDLKPVSE-EVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
                K   E  +++   ++K          +V   +I+    +  K  + +   D+   ++
Sbjct  2028  SGAKETKEINIIKLSGVKKPF--------KVEDSVIVNDDTSETKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP +N VV    N 
Sbjct  2080  TGCKYVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPAVN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
              + C N     ++ + F LL      +       K    T IA      +     + +F 
Sbjct  2138  TSACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEIASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAAL---GVLMSNLG-----------MP  2260
               K    ++   II  I+ L  +    ++I+S   L   G L + +G           + 
Sbjct  2189  TFKWSMVARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLV  2248

Query  2261  SYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
             + C  Y    +   N     YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2249  TICDLYSIQDVGFKN----QYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W   L++ L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSFRLLVAL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFKHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V     S+ L++D+ GQ+ Y+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCSMRLFYDRDGQRIYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQIYKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F   S   + +++
Sbjct  2658  NNLVPTYLKSDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQFSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AVI ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVIDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP 
Sbjct  2893  FYASGCVLSSACTMFTMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRFPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VRVV T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRVVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ VV  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSVVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIA  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRKLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + M+ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSVG+ I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN LAWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R  KGT  W++ +      ++    +W++F ++  N F       + + + A
Sbjct  3546  IKLQSKRTRLFKGTVCWIMASTFLFSCIITAFVKWTMFMYVTTNMF-SITFCALCVISLA  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L +++ P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYITPVLFTLLYNNYLVVYKHTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDD---GARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISV  3740
             Y   +++ ++ +T R++  D       V  L++V +L YK   G+ L++ I +  ++ S+
Sbjct  3664  YGMLLLVGMVFVTLRSINHDLFSFIMFVGRLISVFSLWYK---GSNLEEEILL--MLASL  3718

Query  3741  TSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLL  3800
                Y+      M +A+ ++   V    ++F     ++ ++L Y F+GY  +CY+GLF L+
Sbjct  3719  FGTYTWTTVLSMAVAK-VIAKWVAVNVLYFTDIPQIKIVLLCYLFIGYIISCYWGLFSLM  3777

Query  3801  NRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQS  3860
             N  FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QS
Sbjct  3778  NSLFRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQS  3837

Query  3861  KMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLS  3920
             K++DVKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AFEK+  LL VL +
Sbjct  3838  KLTDVKCANVVLLNCLQHLHVASNSKLWHYCSTLHNEILATSDLSVAFEKLAQLLIVLFA  3897

Query  3921  MQGAVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-  3973
                AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A  +G + 
Sbjct  3898  NPAAVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARFSGSAN  3957

Query  3974  EVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTML  4033
             +  LK+L+K+ N+AKS ++RD A+ +KLE+MAD A+T MYK+AR  DK++KV SA+QTML
Sbjct  3958  QQQLKQLEKACNIAKSAYERDRAVAKKLERMADLALTNMYKEARINDKKSKVVSALQTML  4017

Query  4034  FTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYAS  4093
             F+M+RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA 
Sbjct  4018  FSMVRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLNIIVPDKSVYDQIVDNIYVTYAG  4077

Query  4094  ALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQ  4151
              +W+IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+ 
Sbjct  4078  NVWQIQTIQDSDGTNKQLNEISDDCN----WPLVIIANRYNEVSATVLQNNELMPAKLKI  4133

Query  4152  MSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEP  4211
                 +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+P
Sbjct  4134  QVVNSGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDP  4190

Query  4212  PCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCA  4271
             PC+F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CA
Sbjct  4191  PCKFTVQDAKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCA  4250

Query  4272  FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR  4331
             F+VD  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR
Sbjct  4251  FSVDPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCR  4310

Query  4332  CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPML  4391
               ++HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +
Sbjct  4311  ARVEHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCRVCGFWRDGSCSCVS-TDTTV  4368

Query  4392  QSADAQSFLNGFAV  4405
             QS D  +FLNGF V
Sbjct  4369  QSKDT-NFLNGFGV  4381


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K VK  VVVN AN ++ HGGGVA A+  A       E+ + + +
Sbjct  1273  ITPNVCFVKGDIIKVSKLVKAEVVVNPANGHMVHGGGVAKAIAVAAGQQFVKETTNMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++FN ++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYVLLERVYKHFNNYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (43%), Gaps = 30/242 (12%)

Query  715  GLYRKCVKSRE----ETGLL----MPL------------KAPKEIIFLEGETLPTEVLTE  754
            G  R C+  R+    E GLL    +PL            KA ++ I+L+G      +   
Sbjct  732  GRRRICLSGRKIYEVERGLLHSSQLPLDVYDLTMPSQVQKAKQKPIYLKGSGSDFSLADS  791

Query  755  EVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFT  814
             V + T  L P         E P V   +CI   + +     + Y  +  + +   +   
Sbjct  792  VVEVVTTSLTPCGYS-----EPPKVADKICIVDNVYMAKAGDKYYPVVVDDHVGLLDQAW  846

Query  815  LKGGAPTKVTFGDD-TVIEVQGY-KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFA  872
                A  +VTF +  TV E+    K + + +ELD   + +LN  C  + V+   ++ EF 
Sbjct  847  RVPCAGRRVTFKEQPTVKEIISMPKIIKVFYELDNDFNTILNTACGVFEVDDTVDMEEFY  906

Query  873  CVVADAVIKTLQPVSELL---TPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDE  929
             VV DA+ + L P  EL      +   L +      +LFDE+GE   A  +YC+F  P++
Sbjct  907  AVVIDAIEEKLSPCKELEGVGAKVSAFLQKLEDNPLFLFDEAGEEVFAPKLYCAFTAPED  966

Query  930  DE  931
            D+
Sbjct  967  DD  968


> sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1
Length=7094

 Score = 1871 bits (4847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/2886 (37%), Positives = 1631/2886 (57%), Gaps = 125/2886 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E +P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYNPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   I   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTI--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVD  2101
              D K       E+  I    L    K  +V   +I+    + +K  + +   D+   ++ 
Sbjct  2028  SDAK-------ESKEINIIKLSGVKKPFKVEDSVIVNDDTSEIKYVKSLSIVDVYDMWLT  2080

Query  2102  NSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNIV  2157
                  ++  N LS  + + T+      G+  V S+P D +     KP  N VV    N +
Sbjct  2081  GCRYVVRTANALSMAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNKI  2138

Query  2158  TRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNY  2217
             + C N     ++ + F LL      +       K    T +A      +     + +F  
Sbjct  2139  SACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFLT  2189

Query  2218  LKSPNFSKLINII--IWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTN  2275
              K    ++   II  I+ L  +    ++I+S   L      +G      G    ++ ST 
Sbjct  2190  FKWSVVARGACIIATIFLLWFNFIYANVIFSDFYL----PKIGFLPTFVGKIAQWIKSTF  2245

Query  2276  --VTIA------------TYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAF  2321
               VTI              YC GSI C  CL+G D LD Y +++ +Q     ++ D  AF
Sbjct  2246  SLVTICDLYSIQDVGFKNQYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRAF  2300

Query  2322  -------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLV  2372
                     +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L 
Sbjct  2301  VDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSLA  2360

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P    +R YI  ASF  ++  + HV  GC+   C+ CYKRNR+ RV+C+TIV G+ R
Sbjct  2361  NMLPAHVFMRFYIIIASFIKLFILFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIR  2420

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V 
Sbjct  2421  YYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVT  2480

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              V      + L++++ GQ+TY+  + S FV+  NL  +  KG   ++V+V +  +  +++
Sbjct  2481  DVKQVGCYMRLFYERDGQRTYDDVNASLFVDYSNLLHSKVKGVPNMHVVVVENDA--DKA  2538

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  L
Sbjct  2539  NFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNAL  2598

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             +ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SCN
Sbjct  2599  IATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESCN  2658

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++ 
Sbjct  2659  NLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKK  2718

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + + 
Sbjct  2719  ACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFLLSLV-CFIG--LWCLM  2775

Query  2792  PVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTND  2848
             P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N 
Sbjct  2776  PTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSNS  2834

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
              ACP++ AV+ +++G  V  +P  +LR      LHF+    SA G  CYTP   I Y++F
Sbjct  2835  MACPIVVAVVDQDLGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSNF  2893

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPNT  2967
               S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP  
Sbjct  2894  YASGCVLSSACTMFAMADGSPQPYCYTEGLMQNASLYSSLVPHVRYNLANAKGFIRFPEV  2953

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L+
Sbjct  2954  LREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDLI  3013

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
               +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ +
Sbjct  3014  YQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWCV  3073

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI  
Sbjct  3074  NFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYISV  3133

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             + + H +W F+    RR+  +  S  TFEE AL TF++ K+ Y KL++   L    +NRY
Sbjct  3134  VVSNHAFWVFA--YCRRLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNRY  3189

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG 
Sbjct  3190  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSGI  3249

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R ++
Sbjct  3250  VKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVTS  3309

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3310  SDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKPQ  3369

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  DCV F YMH +EL TG H GTD  G+FYG
Sbjct  3370  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGDFYG  3429

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  + 
Sbjct  3430  PYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQVK  3489

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G+
Sbjct  3490  SDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAGI  3546

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + AM
Sbjct  3547  KLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLAM  3605

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+Y
Sbjct  3606  LLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVIY  3664

Query  3686  ASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   Y
Sbjct  3665  GMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGTY  3722

Query  3745  SGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
             +      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  F
Sbjct  3723  TWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSLF  3781

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++D
Sbjct  3782  RMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLTD  3841

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   A
Sbjct  3842  VKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPAA  3901

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVL  3977
             VD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  L
Sbjct  3902  VDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARSSGSANQQQL  3961

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  3962  KQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4021

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W+
Sbjct  4022  RKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVWQ  4081

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCA  4155
             IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+     
Sbjct  4082  IQTIQDSDGTNKQLNEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVVN  4137

Query  4156  AGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRF  4215
             +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+F
Sbjct  4138  SGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCKF  4194

Query  4216  VTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVD  4275
                  KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+VD
Sbjct  4195  TVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSVD  4254

Query  4276  AAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHID  4335
               K Y D++  GG PI NCVKMLC H GTG AITV P+A  +Q+S+GGAS C+YCR  ++
Sbjct  4255  PKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTNQDSYGGASVCIYCRARVE  4314

Query  4336  HPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSAD  4395
             HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS D
Sbjct  4315  HPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSKD  4372

Query  4396  AQSFLN  4401
               +FLN
Sbjct  4373  T-NFLN  4377


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T    V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAEKQVVLVSNNQEDFD  1425


 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 207/932 (22%), Positives = 354/932 (38%), Gaps = 162/932 (17%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFCG-----PDGYPLECIKDLLARAGKASCTL-SEQLDFIDTK  225
             L+R   G     YVD   C       DG  LE   D   +  KA   + S++L F    
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADG--LEAYADKTLQEMKALFPIWSQELPF----  292

Query  226  RGVYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVF  275
                     +  +AW+  R  +    LQ+   I+          D  +G      P  V+
Sbjct  293  ---------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVY  343

Query  276  PLNSIIKTIQPRVE-----KKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKC--DHCGE  328
              +SII      V+       + D  +     V       +C  +     + C  D C  
Sbjct  344  ADDSIILRQHNLVDIMSCFYMEADAVVNAFYGV----DLKDCGFVMQFGYIDCEQDLCDF  399

Query  329  TSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAE  386
              W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S   
Sbjct  400  KGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFTL  458

Query  387  YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGEG  442
            Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVVG  
Sbjct  459  Y------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGCK  502

Query  443  SEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQ  501
            +     NL+ + L  + V  +  G+    E + +         S        L+   +K 
Sbjct  503  AIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYKP  552

Query  502  IVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRSI  547
            ++E+   F + + K     + +   G    +L  L            AF   A ++  ++
Sbjct  553  LLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYADKICHAV  612

Query  548  FSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQ  607
             S++ E    S+  L  AAI  L+       +++D     SD  T+           +V 
Sbjct  613  VSKSKELLDVSLDSLS-AAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIVH  658

Query  608  LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTC  667
                + T+        L  VL       +  + F+++   I ++ S      V     + 
Sbjct  659  FFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAFRSV  710

Query  668  AKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREET  727
            AK + +S++  F        +    I + G+K+  +  G   + HS  L        +  
Sbjct  711  AKVVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDVY  761

Query  728  GLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVC  784
             L MP    KA ++ I+L+G      +    V + T  L P         E P V   +C
Sbjct  762  DLTMPSQVQKAKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKIC  816

Query  785  INGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNIT  842
            I   + +     + Y  +    +   +       A  +VTF +  TV E+    K++ + 
Sbjct  817  IVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRRVTFKEQPTVNEIASTPKTIKVF  876

Query  843  FELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDE  899
            +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +
Sbjct  877  YELDKDFNTILNTACGVFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQK  936

Query  900  WSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
                + +LFDE+GE  LAS +YC+F  P++D+
Sbjct  937  LEDNSLFLFDEAGEEVLASKLYCAFTAPEDDD  968


> sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1
Length=7094

 Score = 1871 bits (4846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/2886 (37%), Positives = 1630/2886 (56%), Gaps = 125/2886 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +   +G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGENFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   I   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTI--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVD  2101
              D K       E+  I    L    K  +V   +I+    + +K  + +   D+   ++ 
Sbjct  2028  SDAK-------ESKEINIIKLSGVKKPFKVEDSVIVNDDTSEIKYVKSLSIVDVYDMWLT  2080

Query  2102  NSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNIV  2157
                  ++  N+LS  + + T+      G+  V S+P D +     KP  N VV    N +
Sbjct  2081  GCRYVVRTANDLSMAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNKI  2138

Query  2158  TRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNY  2217
             + C N     ++ + F LL      +       K    T +A      +     + +F  
Sbjct  2139  SACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFLT  2189

Query  2218  LKSPNFSKLINII--IWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTN  2275
              K    ++   II  I+ L  +    ++I+S   L      +G      G    ++ ST 
Sbjct  2190  FKWSVVARGACIIATIFLLWFNFIYANVIFSDFYL----PKIGFLPTFVGKIAQWIKSTF  2245

Query  2276  --VTIA------------TYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAF  2321
               VTI              YC GSI C  CL+G D LD Y +++ +Q     ++ D  AF
Sbjct  2246  SLVTICDLYSIQDVGFKNQYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRAF  2300

Query  2322  -------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLV  2372
                     +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L 
Sbjct  2301  VDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSLA  2360

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P    +R YI  ASF  ++  + HV  GC+   C+ CYKRNR+ RV+C+TIV G+ R
Sbjct  2361  NMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIR  2420

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V 
Sbjct  2421  YYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVT  2480

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              V      + L++++ GQ+TY+  + S FV+  NL  +  KG   ++V+V +  +  +++
Sbjct  2481  DVKQVGCYMRLFYERDGQRTYDDVNASLFVDYSNLLHSKVKGVPNMHVVVVENDA--DKA  2538

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  L
Sbjct  2539  NFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNAL  2598

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             +ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SCN
Sbjct  2599  IATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESCN  2658

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++ 
Sbjct  2659  NLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKK  2718

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + + 
Sbjct  2719  ACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFLLSLV-CFIG--LWCLM  2775

Query  2792  PVHVMSKHTDFSSEI-IGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTND  2848
             P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N 
Sbjct  2776  PTYTVHK-SDFQLPVYTSYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSNS  2834

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
              ACP++ AV+ +++G  V  +P  +LR      LHF+    SA G  CYTP   I Y++F
Sbjct  2835  MACPIVVAVVDQDLGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSNF  2893

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPNT  2967
               S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP  
Sbjct  2894  YASGCVLSSACTMFAMADGSPQPYCYTEGLMQNASLYSSLVPHVRYNLANAKGFIRFPEV  2953

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L+
Sbjct  2954  LREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDLI  3013

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
               +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ +
Sbjct  3014  YQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWCV  3073

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI  
Sbjct  3074  NFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYISV  3133

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             + + H +W F+    RR+  +  S  TFEE AL TF++ K+ Y KL++   L    +NRY
Sbjct  3134  VVSNHAFWVFA--YCRRLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNRY  3189

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG 
Sbjct  3190  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSGI  3249

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R ++
Sbjct  3250  VKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVTS  3309

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3310  SDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKPQ  3369

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  DCV F YMH +EL TG H GTD  G+FYG
Sbjct  3370  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLMGDCVKFVYMHQLELSTGCHTGTDFNGDFYG  3429

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  + 
Sbjct  3430  PYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQVK  3489

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G+
Sbjct  3490  SDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAGI  3546

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + AM
Sbjct  3547  KLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLAM  3605

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+Y
Sbjct  3606  LLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVIY  3664

Query  3686  ASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   Y
Sbjct  3665  GMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGTY  3722

Query  3745  SGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
             +      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  F
Sbjct  3723  TWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSLF  3781

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++D
Sbjct  3782  RMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLTD  3841

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   A
Sbjct  3842  VKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPAA  3901

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVL  3977
             VD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  L
Sbjct  3902  VDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARSSGSANQQQL  3961

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  3962  KQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4021

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W+
Sbjct  4022  RKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVWQ  4081

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCA  4155
             IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+     
Sbjct  4082  IQTIQDSDGTNKQLNEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVVN  4137

Query  4156  AGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRF  4215
             +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+F
Sbjct  4138  SGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCKF  4194

Query  4216  VTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVD  4275
                  KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+VD
Sbjct  4195  TVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSVD  4254

Query  4276  AAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHID  4335
               K Y D++  GG PI NCVKMLC H GTG AITV P+A  +Q+S+GGAS C+YCR  ++
Sbjct  4255  PKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTNQDSYGGASVCIYCRARVE  4314

Query  4336  HPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSAD  4395
             HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS D
Sbjct  4315  HPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSKD  4372

Query  4396  AQSFLN  4401
               +FLN
Sbjct  4373  T-NFLN  4377


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T    V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAEKQVVLVSNNQEDFD  1425


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 207/932 (22%), Positives = 354/932 (38%), Gaps = 162/932 (17%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFCG-----PDGYPLECIKDLLARAGKASCTL-SEQLDFIDTK  225
             L+R   G     YVD   C       DG  LE   D   +  KA   + S++L F    
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADG--LEAYADKTLQEMKALFPIWSQELPF----  292

Query  226  RGVYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVF  275
                     +  +AW+  R  +    LQ+   I+          D  +G      P  V+
Sbjct  293  ---------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVY  343

Query  276  PLNSIIKTIQPRVE-----KKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKC--DHCGE  328
              +SII      V+       + D  +     V       +C  +     + C  D C  
Sbjct  344  ADDSIILRQHNLVDIMSCFYMEADAVVNAFYGV----DLKDCGFVMQFGYIDCEQDLCDF  399

Query  329  TSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAE  386
              W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S   
Sbjct  400  KGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFTL  458

Query  387  YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGEG  442
            Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVVG  
Sbjct  459  Y------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGCK  502

Query  443  SEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQ  501
            +     NL+ + L  + V  +  G+    E + +         S        L+   +K 
Sbjct  503  AIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYKP  552

Query  502  IVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRSI  547
            ++E+   F + + K     + +   G    +L  L            AF   A ++  ++
Sbjct  553  LLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYADKICHAV  612

Query  548  FSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQ  607
             S++ E    S+  L  AAI  L+       +++D     SD  T+           +V 
Sbjct  613  VSKSKELLDVSLDSLS-AAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIVH  658

Query  608  LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTC  667
                + T+        L  VL       +  + F+++   I ++ S      V     + 
Sbjct  659  FFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAFRSV  710

Query  668  AKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREET  727
            AK + +S++  F        +    I + G+K+  +  G   + HS  L        +  
Sbjct  711  AKVVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDVY  761

Query  728  GLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVC  784
             L MP    KA ++ I+L+G      +    V + T  L P         E P V   +C
Sbjct  762  DLTMPSQVQKAKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKIC  816

Query  785  INGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNIT  842
            I   + +     + Y  +    +   +       A  +VTF +  TV E+    K++ + 
Sbjct  817  IVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRRVTFKEQPTVNEIASTPKTIKVF  876

Query  843  FELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDE  899
            +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +
Sbjct  877  YELDKDFNTILNTACGVFEVDDTVDMEEFYAVVVDAIEEKLSPCKELEGVGAKVSAFLQK  936

Query  900  WSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
                + +LFDE+GE  LAS +YC+F  P++D+
Sbjct  937  LEDNSLFLFDEAGEEVLASKLYCAFTAPEDDD  968


> sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=1a PE=3 SV=1
Length=4383

 Score = 1868 bits (4840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1070/2891 (37%), Positives = 1629/2891 (56%), Gaps = 127/2891 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLK-PVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
              D K P    +++   ++K          +V   +I+    + +K  + +   D+   ++
Sbjct  2028  SDAKEPKEINIIKLSGVKKPF--------KVEDSVIVNDDTSEIKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP  N VV    N 
Sbjct  2080  TGCRCVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
             ++ C N     ++ + F LL      +       K    T +A      +     + +F 
Sbjct  2138  ISACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAAL---GVLMSNLG-----------MP  2260
               K    ++   II  I+ L  +    ++I+S   L   G L + +G           + 
Sbjct  2189  TFKWSVVARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIVQWIKNTFSLV  2248

Query  2261  SYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
             + C  Y    +   N     YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2249  TICDLYSIQDVGFKN----QYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++     + ++  W + L+++L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELLMLSTLHWSVRLLVSL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V      + L++D+ GQ+TY+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCYMRLFYDRDGQRTYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKILITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++
Sbjct  2658  NNLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  +LT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLELTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AV+ ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVVDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+ P 
Sbjct  2893  FYASGCVLSSACTMFAMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRLPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V    YY ++ +RAFG+Y+ +V  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLGFYYLIKLKRAFGDYTSIVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIS  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRQLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSVG+ I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + A
Sbjct  3546  IKLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLA  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSN  3743
             Y   +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   
Sbjct  3664  YGMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGT  3721

Query  3744  YSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             Y+      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  
Sbjct  3722  YTWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSL  3780

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++
Sbjct  3781  FRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLT  3840

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +  LL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   
Sbjct  3841  DVKCANGGLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPA  3900

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  
Sbjct  3901  AVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEACSSGSANQQQ  3960

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             LK+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3961  LKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4020

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W
Sbjct  4021  VRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVW  4080

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
             +IQ + D+D    QL EIS D +    WPL++ A R N  SA  LQNNEL P  L+    
Sbjct  4081  QIQTIQDSDGTNKQLHEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVV  4136

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+
Sbjct  4137  NSGPDQTCNTPTQ--CYYNNSYNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCK  4193

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+V
Sbjct  4194  FTVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSV  4253

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR  +
Sbjct  4254  DPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCRARV  4313

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA  4394
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS 
Sbjct  4314  EHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSK  4371

Query  4395  DAQSFLNGFAV  4405
             D  +FLNGF V
Sbjct  4372  DT-NFLNGFGV  4381


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 115/262 (44%), Gaps = 30/262 (11%)

Query  697  GAKLKALNLGETFV----THSKGLYRKCVKSRE----ETGLLMPLKAPKEIIFLEGETLP  748
            GAK+   +L  TF+        G  R C+   +    E GLL   + P ++  L   T+P
Sbjct  710  GAKVGLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERGLLHSSQLPLDVYDL---TMP  766

Query  749  TEVLTEE---VVLK-TGDLQPLEQPTSEAV----------EAPLVGTPVCINGLMLLEIK  794
            ++V   +   + LK +G    L     E V          E P V   +CI   + +   
Sbjct  767  SQVQKTKQKGIYLKGSGSDFSLADSVVEVVTTSLTPCGYSEPPKVADKICIVDNVYMAKA  826

Query  795  DTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNITFELDERIDKV  852
              + Y  +    +   +       A   VTF +  TV E+    K++ + +ELD+  + +
Sbjct  827  GDKYYPVVVDGHVGLLDQAWRVPCAGRCVTFKEQPTVNEIASTPKTIKVFYELDKDFNTI  886

Query  853  LNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDEWSMATYYLFD  909
            LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +    + +LFD
Sbjct  887  LNTACGEFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQKLEDNSLFLFD  946

Query  910  ESGEFKLASHMYCSFYPPDEDE  931
            E+GE  LA  +YC+F  P++D+
Sbjct  947  EAGEEVLAPKLYCAFTAPEDDD  968


> sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=1a PE=3 SV=1
Length=4383

 Score = 1868 bits (4839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1070/2891 (37%), Positives = 1631/2891 (56%), Gaps = 127/2891 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLK-PVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
              D K P    +++   ++K          +V   +I+    + +K  + +   D+   ++
Sbjct  2028  SDAKEPKEINIIKLSGVKKPF--------KVEDSVIVNDDTSEIKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP  N VV    N 
Sbjct  2080  TGCRCVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
             ++ C N     ++ + F LL      +       K    T +A      +     + +F 
Sbjct  2138  ISACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAALGVLMSNLG-MPSYCTGYREGYLNS  2273
               K    ++   II  I+ L  +    ++I+S   L      +G +P++     +   N+
Sbjct  2189  TFKWSVVARGACIIATIFLLWFNFIYANVIFSDFYL----PKIGFLPTFVGKIAQWIKNT  2244

Query  2274  TN-VTIA------------TYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
              + VTI              YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2245  FSLVTICDLYSIQDVGFKNQYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R +   ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDAMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V      + L++D+ GQ+TY+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCYMRLFYDRDGQRTYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++
Sbjct  2658  NNLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AV+ ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVVDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP 
Sbjct  2893  FYASGCVLSSACTMFAMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRFPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRIVRTRSMPYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIS  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRQLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSV + I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R +KG   W++ +      ++    +W++F ++  N  L      + + +  
Sbjct  3546  IKLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLT  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSN  3743
             Y   +++ ++ +T R++       +  +  V+++V   Y G+ L++ I +  ++ S+   
Sbjct  3664  YGMLLLIGMVFVTLRSINQYLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGT  3721

Query  3744  YSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             Y+      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  
Sbjct  3722  YTWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSL  3780

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++
Sbjct  3781  FRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLT  3840

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   
Sbjct  3841  DVKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPA  3900

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  
Sbjct  3901  AVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEACSSGSANQQQ  3960

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             LK+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3961  LKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4020

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W
Sbjct  4021  VRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVW  4080

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
             +IQ + D+D    QL EIS D +    WPL++ A R N  SA  LQNNEL P  L+    
Sbjct  4081  QIQTIQDSDGTNKQLHEISDDCN----WPLVIIANRHNEVSATALQNNELMPAKLKTQVV  4136

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+
Sbjct  4137  NSGPDQTCNTPTQ--CYYNNSYNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCK  4193

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+V
Sbjct  4194  FTVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSV  4253

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR  +
Sbjct  4254  DPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCRARV  4313

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA  4394
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS 
Sbjct  4314  EHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSK  4371

Query  4395  DAQSFLNGFAV  4405
             D  +FLNGF V
Sbjct  4372  DT-NFLNGFGV  4381


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 204/930 (22%), Positives = 350/930 (38%), Gaps = 158/930 (17%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFC---GPDGYPLECIKDLLARAGKASCTL-SEQLDFIDTKRG  227
             L+R   G     YVD   C   G     LE   D   +  KA   + S++L F      
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADGLEAYADKTLQEMKALFPIWSQELPF------  292

Query  228  VYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVFPL  277
                   +  +AW+  R  +    LQ+   I+          D  +G      P  V+  
Sbjct  293  -------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVYAD  345

Query  278  NSIIKTIQPRVE-----KKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKC--DHCGETS  330
            +SII      V+       + D  +     V       +C  +     + C  D C    
Sbjct  346  DSIILRQHNLVDIMSCFYMEADAVVNAFYGV----DLKDCGFVMQFGYIDCEQDLCDFKG  401

Query  331  WQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYH  388
            W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S   Y 
Sbjct  402  WVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFTLY-  459

Query  389  NESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGEGSE  444
                       G   + FGGCV+ +    N    W+P   +++    G  +TGVVG  + 
Sbjct  460  -----------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGCKAI  504

Query  445  GLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIV  503
                NL+ + L  + V  +  G+    E + +         S        L+   +K ++
Sbjct  505  VKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYKPLL  554

Query  504  ESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRSIFS  549
            E+   F + + K     + +   G    +L  L            AF   A ++  ++ S
Sbjct  555  ENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYAGKICHAVVS  614

Query  550  RTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLT  609
            ++ E    S+  L  AAI  L+       +++D     SD  T+           +V   
Sbjct  615  KSKELLDVSLDSL-GAAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIVHFF  660

Query  610  SQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAK  669
              + T+        L  VL       +  + F+++   I ++ S      V     + AK
Sbjct  661  KTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAFRSVAK  712

Query  670  EIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGL  729
             + +S++  F        +    I + G+K+  +  G   + HS  L        +   L
Sbjct  713  VVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDVYDL  763

Query  730  LMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCIN  786
             MP    K  ++ I+L+G      +    V + T  L P         E P V   +CI 
Sbjct  764  TMPSQVQKTKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKICIV  818

Query  787  GLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNITFE  844
              + +     + Y  +    +   +       A   VTF +  TV E+    K++ + +E
Sbjct  819  DNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRCVTFKEQPTVNEIASTPKTIKVFYE  878

Query  845  LDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDEWS  901
            LD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +  
Sbjct  879  LDKDFNTILNTACGVFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQKLE  938

Query  902  MATYYLFDESGEFKLASHMYCSFYPPDEDE  931
              + +LFDE+GE  LA  +YC+F  P++D+
Sbjct  939  DNSLFLFDEAGEEVLAPKLYCAFTAPEDDD  968


> sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus 
OC43 OX=31631 GN=rep PE=3 SV=1
Length=7095

 Score = 1861 bits (4821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1076/2890 (37%), Positives = 1626/2890 (56%), Gaps = 133/2890 (5%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCFKWQVVVNGKYFTFKQANNNCFVNVSCLMLQSLH  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             L F     Q+A+   R+G  A F AL+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LTFKIVQWQEAWLEFRSGRPARFVALVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    G++AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGLDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+   GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFIGD-NVGHYVHVKCEQSYQLYDASNVKKVTDVTGKLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E K+T +P   GDVV  +   Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDSLNSKLGFDSSKEFVEYKITEWPTATGDVVLANDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     + + 
Sbjct  1978  ITFGKPVIWLSHEKASLNSLTY----------FNRPLLVDDNKFDVLKVDDVDDSGDSSE  2027

Query  2042  EDLKPVSE-EVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
                K   E  +++   ++K          +V   +I+    +  K  + +   D+   ++
Sbjct  2028  SGAKETKEINIIKLSGVKKPF--------KVEDSVIVNDDTSETKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP +N VV    N 
Sbjct  2080  TGCKYVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPAVN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
              + C N     ++ + F LL      +       K    T IA      +     + +F 
Sbjct  2138  TSACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEIASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAAL---GVLMSNLG-----------MP  2260
               K    ++   II  I+ L  +    ++I+S   L   G L + +G           + 
Sbjct  2189  TFKWSMVARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLV  2248

Query  2261  SYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
             + C  Y    +   N     YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2249  TICDLYSIQDVGFKN----QYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W   L++ L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSFRLLVAL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFKHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V     S+ L++D+ GQ+ Y+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCSMRLFYDRDGQRIYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQIYKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F   S   + +++
Sbjct  2658  NNLVPTYLKSDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQFSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AVI ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVIDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP 
Sbjct  2893  FYASGCVLSSACTMFTMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRFPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VRVV T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRVVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ VV  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSVVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIA  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRKLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + M+ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMRGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSVG+ I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN LAWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPIQDYIQSVNFLAWLYAAILNNCNWFIQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R  KGT  W++ +      ++    +W++F ++  N F       + + + A
Sbjct  3546  IKLQSKRTRLFKGTVCWIMASTFLFSCIITAFVKWTMFMYVTTNMF-SITFCALCVISLA  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L +++ P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYITPVLFTLLYNNYLVVYKHTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDD---GARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISV  3740
             Y   +++ ++ +T R++  D       V  L++V +L YK   G+ L++ I +  ++ S+
Sbjct  3664  YGMLLLVGMVFVTLRSINHDLFSFIMFVGRLISVFSLWYK---GSNLEEEILL--MLASL  3718

Query  3741  TSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLL  3800
                Y+      M +A+ ++   V    ++F     ++ ++L Y F+GY  +CY+GLF L+
Sbjct  3719  FGTYTWTTVLSMAVAK-VIAKWVAVNVLYFTDIPQIKIVLLCYLFIGYIISCYWGLFSLM  3777

Query  3801  NRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQS  3860
             N  FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QS
Sbjct  3778  NSLFRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQS  3837

Query  3861  KMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLS  3920
             K++DVKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AFEK+  LL VL +
Sbjct  3838  KLTDVKCANVVLLNCLQHLHVASNSKLWHYCSTLHNEILATSDLSVAFEKLAQLLIVLFA  3897

Query  3921  MQGAVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-  3973
                AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A  +G + 
Sbjct  3898  NPAAVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEARFSGSAN  3957

Query  3974  EVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTML  4033
             +  LK+L+K+ N+AKS ++RD A+ +KLE+MAD A+T MYK+AR  DK++KV SA+QTML
Sbjct  3958  QQQLKQLEKACNIAKSAYERDRAVAKKLERMADLALTNMYKEARINDKKSKVVSALQTML  4017

Query  4034  FTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYAS  4093
             F+M+RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA 
Sbjct  4018  FSMVRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLNIIVPDKSVYDQIVDNIYVTYAG  4077

Query  4094  ALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQ  4151
              +W+IQ + D+D    QL+EIS D +    WPL++ A R N  SA  LQNNEL P  L+ 
Sbjct  4078  NVWQIQTIQDSDGTNKQLNEISDDCN----WPLVIIANRYNEVSATVLQNNELMPAKLKI  4133

Query  4152  MSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEP  4211
                 +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+P
Sbjct  4134  QVVNSGPDQTCNTPTQ--CYYNNSNNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDP  4190

Query  4212  PCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCA  4271
             PC+F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CA
Sbjct  4191  PCKFTVQDAKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCA  4250

Query  4272  FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR  4331
             F+VD  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR
Sbjct  4251  FSVDPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCR  4310

Query  4332  CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPML  4391
               ++HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +
Sbjct  4311  ARVEHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCRVCGFWRDGSCSCVS-TDTTV  4368

Query  4392  QSADAQSFLN  4401
             QS D  +FLN
Sbjct  4369  QSKDT-NFLN  4377


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K VK  VVVN AN ++ HGGGVA A+  A       E+ + + +
Sbjct  1273  ITPNVCFVKGDIIKVSKLVKAEVVVNPANGHMVHGGGVAKAIAVAAGQQFVKETTNMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++FN ++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYVLLERVYKHFNNYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 102/242 (42%), Gaps = 30/242 (12%)

Query  715  GLYRKCVKSRE----ETGLL----MPL------------KAPKEIIFLEGETLPTEVLTE  754
            G  R C+  R+    E GLL    +PL            KA ++ I+L+G      +   
Sbjct  732  GRRRICLSGRKIYEVERGLLHSSQLPLDVYDLTMPSQVQKAKQKPIYLKGSGSDFSLADS  791

Query  755  EVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFT  814
             V + T  L P         E P V   +CI   + +     + Y  +  + +   +   
Sbjct  792  VVEVVTTSLTPCGYS-----EPPKVADKICIVDNVYMAKAGDKYYPVVVDDHVGLLDQAW  846

Query  815  LKGGAPTKVTFGDDTVIE--VQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFA  872
                A  +VTF +   ++  +   K + + +ELD   + +LN  C  + V+   ++ EF 
Sbjct  847  RVPCAGRRVTFKEQPTVKEIISMPKIIKVFYELDNDFNTILNTACGVFEVDDTVDMEEFY  906

Query  873  CVVADAVIKTLQPVSELL---TPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDE  929
             VV DA+ + L P  EL      +   L +      +LFDE+GE   A  +YC+F  P++
Sbjct  907  AVVIDAIEEKLSPCKELEGVGAKVSAFLQKLEDNPLFLFDEAGEEVFAPKLYCAFTAPED  966

Query  930  DE  931
            D+
Sbjct  967  DD  968


> sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=rep PE=3 SV=1
Length=7094

 Score = 1861 bits (4821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1067/2887 (37%), Positives = 1626/2887 (56%), Gaps = 127/2887 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLK-PVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
              D K P    +++   ++K          +V   +I+    + +K  + +   D+   ++
Sbjct  2028  SDAKEPKEINIIKLSGVKKPF--------KVEDSVIVNDDTSEIKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP  N VV    N 
Sbjct  2080  TGCRCVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
             ++ C N     ++ + F LL      +       K    T +A      +     + +F 
Sbjct  2138  ISACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAAL---GVLMSNLG-----------MP  2260
               K    ++   II  I+ L  +    ++I+S   L   G L + +G           + 
Sbjct  2189  TFKWSVVARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLV  2248

Query  2261  SYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
             + C  Y    +   N     YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2249  TICDLYSIQDVGFKN----QYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++    F+ ++  W + L+++L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVRLLVSL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R +   ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDAMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V      + L++D+ GQ+TY+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCYMRLFYDRDGQRTYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++
Sbjct  2658  NNLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLKLTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AV+ ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVVDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+FP 
Sbjct  2893  FYASGCVLSSACTMFAMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRFPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRIVRTRSMPYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V  + YY ++ +RAFG+Y+ +V  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLVFYYLIKLKRAFGDYTSIVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIS  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRQLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWL D VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCIVSVTYGNMTLNGLWLGDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSV + I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVVYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKH-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R +KG   W++ +      ++    +W++F ++  N  L      + + +  
Sbjct  3546  IKLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLT  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSN  3743
             Y   +++ ++ +T R++       +  +  V+++V   Y G+ L++ I +  ++ S+   
Sbjct  3664  YGMLLLIGMVFVTLRSINQYLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGT  3721

Query  3744  YSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             Y+      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  
Sbjct  3722  YTWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSL  3780

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++
Sbjct  3781  FRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLT  3840

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   
Sbjct  3841  DVKCANVVLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPA  3900

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  
Sbjct  3901  AVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEACSSGSANQQQ  3960

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             LK+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3961  LKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4020

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W
Sbjct  4021  VRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVW  4080

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
             +IQ + D+D    QL EIS D +    WPL++ A R N  SA  LQNNEL P  L+    
Sbjct  4081  QIQTIQDSDGTNKQLHEISDDCN----WPLVIIANRHNEVSATALQNNELMPAKLKTQVV  4136

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+
Sbjct  4137  NSGPDQTCNTPTQ--CYYNNSYNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCK  4193

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+V
Sbjct  4194  FTVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSV  4253

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR  +
Sbjct  4254  DPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCRARV  4313

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA  4394
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS 
Sbjct  4314  EHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSK  4371

Query  4395  DAQSFLN  4401
             D  +FLN
Sbjct  4372  DT-NFLN  4377


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 205/932 (22%), Positives = 351/932 (38%), Gaps = 162/932 (17%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIVP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYNKDHKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFCG-----PDGYPLECIKDLLARAGKASCTL-SEQLDFIDTK  225
             L+R   G     YVD   C       DG  LE   D   +  KA   + S++L F    
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADG--LEAYADKTLQEMKALFPIWSQELPF----  292

Query  226  RGVYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVF  275
                     +  +AW+  R  +    LQ+   I+          D  +G      P  V+
Sbjct  293  ---------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVY  343

Query  276  PLNSIIKTIQPRVE-----KKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKC--DHCGE  328
              +SII      V+       + D  +     V       +C  +     + C  D C  
Sbjct  344  ADDSIILRQHNLVDIMSCFYMEADAVVNAFYGV----DLKDCGFVMQFGYIDCEQDLCDF  399

Query  329  TSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAE  386
              W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S   
Sbjct  400  KGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFTL  458

Query  387  YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGEG  442
            Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVVG  
Sbjct  459  Y------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGCK  502

Query  443  SEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQ  501
            +     NL+ + L  + V  +  G+    E + +         S        L+   +K 
Sbjct  503  AIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYKP  552

Query  502  IVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRSI  547
            ++E+   F + + K     + +   G    +L  L            AF   A ++  ++
Sbjct  553  LLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYAGKICHAV  612

Query  548  FSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQ  607
             S++ E    S+  L  AAI  L+       +++D     SD  T+           +V 
Sbjct  613  VSKSKELLDVSLDSL-GAAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIVH  658

Query  608  LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTC  667
                + T+        L  VL       +  + F+++   I ++ S      V     + 
Sbjct  659  FFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYFVKN---IPRYASA-----VAQAFRSV  710

Query  668  AKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREET  727
            AK + +S++  F        +    I + G+K+  +  G   + HS  L        +  
Sbjct  711  AKVVLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDVY  761

Query  728  GLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVC  784
             L MP    K  ++ I+L+G      +    V + T  L P         E P V   +C
Sbjct  762  DLTMPSQVQKTKQKPIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKIC  816

Query  785  INGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNIT  842
            I   + +     + Y  +    +   +       A   VTF +  TV E+    K++ + 
Sbjct  817  IVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRCVTFKEQPTVNEIASTPKTIKVF  876

Query  843  FELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDE  899
            +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +
Sbjct  877  YELDKDFNTILNTACGVFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQK  936

Query  900  WSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
                + +LFDE+GE  LA  +YC+F  P++D+
Sbjct  937  LEDNSLFLFDEAGEEVLAPKLYCAFTAPEDDD  968


> sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=rep PE=3 SV=1
Length=7059

 Score = 1860 bits (4819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1067/2887 (37%), Positives = 1626/2887 (56%), Gaps = 127/2887 (4%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + +  TVD +N   + V +  ++G+  G  + DG +VTK K   +++GK F+   N  + 
Sbjct  1565  VDILLTVDGVNFTNRFVPVGESFGKSLGNVFCDGVNVTKHKCDINYKGKVFFQFDNLSSE  1624

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              ++A       D   L  Y + L +  KW+        + K A+NNC++  + L LQ + 
Sbjct  1625  DLKAVRSSFNFDQKELLAYYNMLVNCSKWQVVFNGKYFTFKQANNNCFVNVSCLMLQSLN  1684

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G  A F +L+LA      G+  D R+ +  +F   +L      
Sbjct  1685  LKFKIVQWQEAWLEFRSGRPARFVSLVLAKGGFKFGDPADSRDFLRVVFSQVDLTGAICD  1744

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               + CK CG +Q    GV+AVM+ GTLS E  + G  + C+CGK+   + V+ + PF++ 
Sbjct  1745  FEIACK-CGVKQEQRTGVDAVMHFGTLSREDLEIGYTVDCSCGKKLI-HCVRFDVPFLIC  1802

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  PA  +L  G  + A+ + G+ + GHY H+  +++    D + + K ++  G ++D  
Sbjct  1803  SNTPASVKLPKGVGS-ANIFKGD-KVGHYVHVKCEQSYQLYDASNVKKVTDVTGNLSDCL  1860

Query  1868  YKENSYTTTIKPV--TYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDL-VPNQPYPNAS  1924
             Y +N    T K V  TY LD V   E  P L  YY     Y+T++ I          +  
Sbjct  1861  YLKN-LKQTFKSVLTTYYLDDVKKIEYKPDLSQYYCDGGKYYTQRIIKAQFKTFEKVDGV  1919

Query  1925  FDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK +   +   D LN   G+       E KVT +P   GDVV      Y   +++G 
Sbjct  1920  YTNFKLIGHTV--CDILNAKLGFDSSKEFVEYKVTEWPTATGDVVLATDDLYVKRYERGC  1977

Query  1984  KLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLAC  2041
                 KP++W  H   + N  TY          ++   +   N FDVLK +D     +++ 
Sbjct  1978  ITFGKPVIWLSHEQASLNSLTY----------FNRPLLVDENKFDVLKVDDVDDGGDISE  2027

Query  2042  EDLK-PVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
              D K P    +++   ++K          +V   +I+    + +K  + +   D+   ++
Sbjct  2028  SDAKEPKEINIIKLSGVKKPF--------KVEDSVIVNDDTSEIKYVKSLSIVDVYDMWL  2079

Query  2101  DNSSLTIKKPNELSRVLGLKTLATH---GLAAVNSVPWDTI-ANYAKPFLNKVVSTTTNI  2156
                   ++  N LSR + + T+      G+  V S+P D +     KP  N VV    N 
Sbjct  2080  TGCRCVVRTANALSRAVNVPTIRKFIKFGMTLV-SIPIDLLNLREIKPVFN-VVKAVRNK  2137

Query  2157  VTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFN  2216
             ++ C N     ++ + F LL      +       K    T +A      +     + +F 
Sbjct  2138  ISACFN-----FIKWLFVLLFGWIKISADN----KVIYTTEVASKLTCKLVALAFKNAFL  2188

Query  2217  YLKSPNFSKLINII--IWFLLLSVCLGSLIYSTAAL---GVLMSNLG-----------MP  2260
               K    ++   II  I+ L  +    ++I+S   L   G L + +G           + 
Sbjct  2189  TFKWSVVARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIVQWIKNTFSLV  2248

Query  2261  SYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTA  2320
             + C  Y    +   N     YC GSI C  CL+G D LD Y +++ +Q     ++ D  A
Sbjct  2249  TICDLYSIQDVGFKN----QYCNGSIACQFCLAGFDMLDNYKAIDVVQ-----YEADRRA  2299

Query  2321  F-------GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINL  2371
             F        +V E  ++Y L+T +FY L     +Q+  ++     + ++  W + L+++L
Sbjct  2300  FVDYTGVLKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELLMLSTLHWSVRLLVSL  2359

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P    +R YI  ASF  ++  + HV  GC+ S C+ CYKRNR+ RV+C+TIV G+ 
Sbjct  2360  ANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMI  2419

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + V ANGG GFC  H WNC++CD++  G+TFI+ E A DLS + KRPI PTD + + V
Sbjct  2420  RYYDVMANGGTGFCSKHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTV  2479

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               V      + L++D+ GQ+TY+  + S FV+  NL  +  K    ++V+V +  +  ++
Sbjct  2480  TDVKQVGCYMRLFYDRDGQRTYDDVNASLFVDYSNLLHSKVKSVPNMHVVVVENDA--DK  2537

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A+V+Y+Q + +PIL++D+ L++       V   MFD YV+TF S F+V  + L  
Sbjct  2538  ANFLNAAVFYAQSLFRPILMVDKILITTANTGTSVTETMFDVYVDTFLSMFDVDKKSLNA  2597

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
             L+ATA + + +   +  VL TF+S AR+   +DSDV+TK + + +  +  + +E+T +SC
Sbjct  2598  LIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMSAVSAGLELTDESC  2657

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I  SA+H+   VAK   ++ IW+V  F  LS   + +++
Sbjct  2658  NNLVPTYLKGDNIVAADLGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLK  2717

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  +LT       V+V+TT  +LKGG + + ++     ++LV  F+    + +
Sbjct  2718  KACCKTGLKLELTYNKQMANVSVLTTPFSLKGGAVFSYFVYVCFVLSLV-CFIG--LWCL  2774

Query  2791  TPVHVMSKHTDFSSEIIG-YKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTN  2847
              P + + K +DF   +   YK +D GV RD++  D CFANK   FD W+    G   Y+N
Sbjct  2775  MPTYTVHK-SDFQLPVYASYKVLDNGVIRDVSVEDVCFANKFEQFDQWYESTFGLSYYSN  2833

Query  2848  DKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTD  2907
               ACP++ AV+ ++ G  V  +P  +LR      LHF+    SA G  CYTP   I Y++
Sbjct  2834  SMACPIVVAVVDQDFGSTVFNVPTKVLRY-GYHVLHFITHALSADGVQCYTPHSQISYSN  2892

Query  2908  FATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDG-SIIQFPN  2966
             F  S CVL++ CT+F  A G P PYCY   +++ +  Y SL P  RY L +    I+ P 
Sbjct  2893  FYASGCVLSSACTMFAMADGSPQPYCYTDGLMQNASLYSSLVPHVRYNLANAKGFIRLPE  2952

Query  2967  TYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNL  3026
                EG VR+V T    YCR G CE ++ G+C + +G WVLNNDYYRSLPG FCG D  +L
Sbjct  2953  VLREGLVRIVRTRSMSYCRVGLCEEADEGICFNFNGSWVLNNDYYRSLPGTFCGRDVFDL  3012

Query  3027  LTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL  3086
             +  +F  L QP+  L ++AS +AG I+A++V    YY ++ +RAFG+Y+ +V  N +++ 
Sbjct  3013  IYQLFKGLAQPVDFLALTASSIAGAILAVIVVLGFYYLIKLKRAFGDYTSIVFVNVIVWC  3072

Query  3087  MSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYII  3146
             ++F +L +  VY  L  VY++ Y Y T Y  +++S + H+QW+VM+  ++P W  + YI 
Sbjct  3073  VNFMMLFVFQVYPTLSCVYAICYFYATLYFPSEISVIMHLQWLVMYGTIMPLWFCLLYIS  3132

Query  3147  CISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNR  3206
              + + H +W FS    R++  +  S  TFEE AL TF++ K+ Y KL++   L    +NR
Sbjct  3133  VVVSNHAFWVFS--YCRQLGTSVRSDGTFEEMALTTFMITKDSYCKLKNS--LSDVAFNR  3188

Query  3207  YLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNS-GSDVLYQPPQTSITSAVLQSG  3265
             YL+LYNKY+Y+SG MDT +YREAAC  LAKA++ F+N+ GSDVLYQPP  S++++ LQSG
Sbjct  3189  YLSLYNKYRYYSGKMDTAAYREAACSQLAKAMDTFTNNNGSDVLYQPPTASVSTSFLQSG  3248

Query  3266  FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKS  3325
               KM  P+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC++ DM NP+Y +LL R +
Sbjct  3249  IVKMVNPTSKVEPCIVSVTYGNMTLNGLWLDDKVYCPRHVICSASDMTNPDYTNLLCRVT  3308

Query  3326  NHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSP  3385
             + +F V    + L V+ + MQ C+L L V   N +TPKY F  ++PG+TF+VLA YNG P
Sbjct  3309  SSDFTVLFDRLSLTVMSYQMQGCMLVLTVTLQNSRTPKYTFGVVKPGETFTVLAAYNGKP  3368

Query  3386  SGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFY  3445
              G +   MR ++TIKGSFL GSCGSVG+ I  DCV F YMH +EL TG H GTD  G+FY
Sbjct  3369  QGAFHVTMRSSYTIKGSFLCGSCGSVGYVIMGDCVKFVYMHQLELSTGCHTGTDFNGDFY  3428

Query  3446  GPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPL  3505
             GP+ D Q  Q    D   +VN +AWLYAA++N   WF+     ++ DFN+ A+   +  +
Sbjct  3429  GPYKDAQVVQLPVQDYIQSVNFVAWLYAAILNNCNWFVQSDKCSVEDFNVWALSNGFSQV  3488

Query  3506  TQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG  3565
               D V  +  L++ TG+++  + A++K  L+NG  GR I+GS   EDE TP DV +Q +G
Sbjct  3489  KSDLV--IDALASMTGVSLETLLAAIKR-LKNGFQGRQIMGSCSFEDELTPSDVYQQLAG  3545

Query  3566  VTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFA  3625
             +  QS   R +KG   W++ +      ++    +W++F ++  N  L      + + + A
Sbjct  3546  IKLQSKRTRLVKGIVCWIMASTFLFSCIITAFVKWTMFMYVTTN-MLSITFCALCVISLA  3604

Query  3626  MMFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVM  3684
             M+ VKHKH +L ++++P L T+ Y N +V    ++   +  WL     S+  +   D V+
Sbjct  3605  MLLVKHKHLYLTMYIIPVLFTLLYNNYLVVYKQTFRGYVYAWLSYYVPSVE-YTYTDEVI  3663

Query  3685  YASAVVL-LILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSN  3743
             Y   +++ ++ +T R++  D    +  +  V+++V   Y G+ L++ I +  ++ S+   
Sbjct  3664  YGMLLLIGMVFVTLRSINHDLFSFIMFVGRVISVVSLWYMGSNLEEEILL--MLASLFGT  3721

Query  3744  YSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             Y+      M  A+ ++   V    ++F     ++ +++ Y F+GY  +CY+GLF L+N  
Sbjct  3722  YTWTTALSMAAAK-VIAKWVAVNVLYFTDIPQIKIVLVCYLFIGYIISCYWGLFSLMNSL  3780

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PPKNS +A  LN KLLG+GG P I+V+  QSK++
Sbjct  3781  FRMPLGVYNYKISVQELRYMNANGLRPPKNSFEALMLNFKLLGIGGVPIIEVSQFQSKLT  3840

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +  LL+ LQ L V S+SKLW  C  LHN+IL   D   AFEK+  LL VL +   
Sbjct  3841  DVKCANGGLLNCLQHLHVASNSKLWQYCSTLHNEILATSDLGVAFEKLAQLLIVLFANPA  3900

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++C++   +   LQA+ SEF ++ S+  +  A++  ++A ++G + +  
Sbjct  3901  AVDSKCLTSIEEVCDDYAKDNTVLQALQSEFVNMASFVEYEVAKKNLDEACSSGSANQQQ  3960

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             LK+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3961  LKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4020

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP   A  L +++PD + Y    D    TYA  +W
Sbjct  4021  VRKLDNQALNSILDNAVKGCVPLNAIPSLAANTLTIIVPDKSVYDQVVDNVYVTYAGNVW  4080

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
             +IQ + D+D    QL EIS D +    WPL++ A R N  SA  LQNNEL P  L+    
Sbjct  4081  QIQTIQDSDGTNKQLHEISDDCN----WPLVIIANRHNEVSATVLQNNELMPAKLKTQVV  4136

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G  QT  T      YYN +  G+ V A+LSD+  LK+ +  K DG   +  EL+PPC+
Sbjct  4137  NSGPDQTCNTPTQ--CYYNNSYNGKIVYAILSDVDGLKYTKILKDDGNFVV-LELDPPCK  4193

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G++++TVRLQAG ATE  +NS++LS CAF+V
Sbjct  4194  FTVQDVKGLKIKYLYFVKGCNTLARGWVVGTISSTVRLQAGTATEYASNSSILSLCAFSV  4253

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y D++  GG PI NCVKMLC H GTG AITV P+A   Q+S+GGAS C+YCR  +
Sbjct  4254  DPKKTYLDFIQQGGTPIANCVKMLCDHAGTGMAITVKPDATTSQDSYGGASVCIYCRARV  4313

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA  4394
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC    +  +QS 
Sbjct  4314  EHPDVDGLCKLRGKFVQVPVG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVS-TDTTVQSK  4371

Query  4395  DAQSFLN  4401
             D  +FLN
Sbjct  4372  DT-NFLN  4377


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     DI++ +K+VK  VVVN AN ++ HGGGVA A+  A       E+ D + +
Sbjct  1273  ITPNVCFVKGDIIKVSKRVKAEVVVNPANGHMAHGGGVAKAIAVAAGQQFVKETTDMVKS  1332

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK--GEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G    G   V +G  L K  L+VVGP+      +   LL+  Y++ N+++ ++  L+SA
Sbjct  1333  KGVCATGDCYVSTGGKLCKTVLNVVGPDARTQGKQSYALLERVYKHLNKYDCVVTTLISA  1392

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   + T +  V L   ++  +D
Sbjct  1393  GIFSVPSDVSLTYLLGTAKKQVVLVSNNQEDFD  1425


 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 208/932 (22%), Positives = 348/932 (37%), Gaps = 162/932 (17%)

Query  69   VFIKRS---DARTAPHGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL--  122
            +F +RS     R A + HV  +L + +  G+ +G +G+ +G ++P +  +PV  RK +  
Sbjct  130  LFRRRSVCNTGRCAVNKHVAYQLYMIDPAGVCFG-AGQFVGWVIP-LAFMPVQSRKFIAP  187

Query  123  ----LRKNGNKGA-------GGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTR  171
                LRK G KGA       GG  +  + K  D  D +  +P   F +            
Sbjct  188  WVMYLRKCGEKGAYIKDYKRGGFEHVYNFKVEDAYDLVHDEPKGKFSKK---------AY  238

Query  172  ELMRELNGGAYTRYVDNNFCG-----PDGYPLECIKDLLARAGKASCTL-SEQLDFIDTK  225
             L+R   G     YVD   C       DG  LE   D   +  KA   + S++L F    
Sbjct  239  ALIRGYRGVKPLLYVDQYGCDYTGGLADG--LEAYADKTLQEMKALFPIWSQELPF----  292

Query  226  RGVYCCREHEHEIAWYTERSEK-SYELQTPFEIKLAKKF-----DTFNGEC----PNFVF  275
                     +  +AW+  R  +    LQ+   I+          D  +G      P  V+
Sbjct  293  ---------DVTVAWHVVRDPRYVMRLQSASTIRSVAYVANPTEDLCDGSVVIKEPVHVY  343

Query  276  PLNSIIKTIQPRVE-----KKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKC--DHCGE  328
              +SII      V+       + D  +     V       +C  +     + C  D C  
Sbjct  344  ADDSIILRQHNLVDIMSCFYMEADAVVNAFYGV----DLKDCGFVMQFGYIDCEQDLCDF  399

Query  329  TSWQTGDFVKA-TCEFCGTENLTKEG-ATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAE  386
              W  G+ +    C  CG    T +  A + G LP N V+     A +    G + S   
Sbjct  400  KGWVPGNMIDGFACTTCGHVYETGDLLAQSSGVLPVNPVLHTKSAAGYGG-FGCKDSFTL  458

Query  387  YHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANI----GCNHTGVVGEG  442
            Y            G   + FGGCV+ +    N    W+P   +++    G  +TGVVG  
Sbjct  459  Y------------GQTVVYFGGCVY-WSPARN---IWIPILKSSVKSYDGLVYTGVVGCK  502

Query  443  SEGLNDNLL-EILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQ  501
            +     NL+ + L  + V  +  G+    E + +         S        L+   +K 
Sbjct  503  AIVKETNLICKALYLDYVQ-HKCGNLHQRELLGV---------SDVWHKQLLLNRGVYKP  552

Query  502  IVESCGNFKVTKGKAKKGAWNI---GEQKSILSPLY-----------AFASEAARVVRSI  547
            ++E+   F + + K     + +   G    +L  L            AF   A ++  ++
Sbjct  553  LLENIDYFNMRRAKFSLETFTVCADGFMPFLLDDLVPRAYYLAVSGQAFCDYAGKICHAV  612

Query  548  FSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQ  607
             S++ E    SV  L  AAI  L+       +++D     SD  T+           +V 
Sbjct  613  VSKSKELLDVSVDSL-GAAIHYLNS------KIVDLAQHFSDFGTS-------FVSKIVH  658

Query  608  LTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTC  667
                + T+        L  VL       +  + F   G  I ++ S  A     G     
Sbjct  659  FFKTFTTSTALAFAWVLFHVLHGAYIVVESDIYF---GKNIPRYASAVAQAFRSG-----  710

Query  668  AKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREET  727
            AK   +S++  F        +    I + G+K+  +  G   + HS  L        +  
Sbjct  711  AKVGLDSLRVTFIDGLSCFKIGRRRICLSGSKIYEVERG---LLHSSQL------PLDVY  761

Query  728  GLLMP---LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVC  784
             L MP    K  ++ I+L+G      +    V + T  L P         E P V   +C
Sbjct  762  DLTMPSQVQKTKQKGIYLKGSGSDFSLADSVVEVVTTSLTPCGYS-----EPPKVADKIC  816

Query  785  INGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGY-KSVNIT  842
            I   + +     + Y  +    +   +       A   VTF +  TV E+    K++ + 
Sbjct  817  IVDNVYMAKAGDKYYPVVVDGHVGLLDQAWRVPCAGRCVTFKEQPTVNEIASTPKTIKVF  876

Query  843  FELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELL---TPLGIDLDE  899
            +ELD+  + +LN  C  + V+   ++ EF  VV DA+ + L P  EL      +   L +
Sbjct  877  YELDKDFNTILNTACGEFEVDDTVDMEEFYAVVIDAIEEKLSPCKELEGVGAKVSAFLQK  936

Query  900  WSMATYYLFDESGEFKLASHMYCSFYPPDEDE  931
                + +LFDE+GE  LA  +YC+F  P++D+
Sbjct  937  LEDNSLFLFDEAGEEVLAPKLYCAFTAPEDDD  968


> sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavirus 
(strain 2) OX=76344 GN=1a PE=3 SV=1
Length=4416

 Score = 1845 bits (4780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1097/2951 (37%), Positives = 1627/2951 (55%), Gaps = 173/2951 (6%)

Query  1549  EVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIK  1608
             +V +   ++ LL+      + V  TVD +N  +  V     +G+  G  + DG +VTK++
Sbjct  1543  KVASVSQIRALLA----NKVDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVR  1598

Query  1609  PHNSHEGKTFYV---LPNDDTLRV-EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL  1664
                 H+GK F+    L   D + V +AF +    +P  L +Y + L   K W        
Sbjct  1599  CSAIHKGKVFFQYSGLSAADLVAVTDAFGF---DEPQLL-KYYNMLGMCK-WPVVVCGNY  1653

Query  1665  TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGE  1724
              + K ++NNCY+  A L LQ + LKF+    Q+A+   R+G+   F +L+LA  +    E
Sbjct  1654  FAFKQSNNNCYINVACLMLQHLSLKFHKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNE  1713

Query  1725  LGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ  1784
               D  + M  + + A+L         VCK CG +Q   KGV+AVM+ GTL      KG  
Sbjct  1714  PSDSTDFMRVVLREADLSGATCDFEFVCK-CGVKQEQRKGVDAVMHFGTLDKGDLAKGYT  1772

Query  1785  IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKET  1844
             I CTCG +   +  Q   PF++ S  P   +L       A+ +TG    GHY H+  K  
Sbjct  1773  IACTCGNKLV-HCTQLNVPFLICSNKPEGKKLPDDVVA-ANIFTGG-SLGHYTHVKCKPK  1829

Query  1845  LYCIDGALLTKSSEYKGPITDVFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKD  1903
                 D   ++K SE KG  TD  Y +N   T + K  T+ LD V C E +P L  YY + 
Sbjct  1830  YQLYDACNVSKVSEAKGNFTDCLYLKNLKQTFSSKLTTFYLDDVKCVEYNPDLSQYYCES  1889

Query  1904  NSYFTEQPIDLVPNQPYPNAS--FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFF  1960
               Y+T +PI     + +      + NFK V  +I  A+  N   G+       E K+T +
Sbjct  1890  GKYYT-KPIIKAQFRTFEKVEGVYTNFKLVGHSI--AEKFNAKLGFDCNSPFTEYKITEW  1946

Query  1961  PDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWST  2016
             P   GDVV      Y   +  G     KP++W  H   +    TY  +P+  C    ++ 
Sbjct  1947  PTATGDVVLASDDLYVSRYSGGCVTFGKPVIWLGHEEASLKSLTYFNRPSVVC-ENKFNV  2005

Query  2017  KPVETSNSFD-------VLKSEDAQG---MDNLACEDLKPVSEEVVENPT---------I  2057
              PV+ S   D       VL +    G       A E     S+ VV+             
Sbjct  2006  LPVDVSEPTDKGPVPAAVLVTGALSGAATAPGTAKEQKVCASDSVVDQVVSGFLSDLSGA  2065

Query  2058  QKDVLECNV----KTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNEL  2113
               DV E  +    K  +V   +++    +  K+ + +   D+   ++      +   NEL
Sbjct  2066  TVDVKEVKLNGVKKPIKVEDSVVVNDPTSETKVVKSLSIVDVYDMFLTGCRYVVWMANEL  2125

Query  2114  SRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNR----------  2163
             SR+             VNS    T+  Y K  + K+V     ++ R   +          
Sbjct  2126  SRL-------------VNS---PTVREYVKWGMTKIVIPAKLVLLRDEKQEFVAPKVVKA  2169

Query  2164  ---VCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220
                 C + + +FF        F    N+  K    T +A    K     C  A  N L++
Sbjct  2170  KVIACYSAVKWFFLYCFSWIKF----NTDNKVIYTTEVAS---KLTFNLCCLAFKNALQT  2222

Query  2221  PNFSKLIN--------IIIWF-------LLLSVCLGSLIYSTAALGVLMS----NLGMPS  2261
              N++ +           ++WF       +L    L ++ +    +G +++      G+ +
Sbjct  2223  FNWNVVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGFFPTFVGQIVAWVKTTFGIFT  2282

Query  2262  YCTGYR---EGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITIS---SFK  2315
              C  Y+    GY +S       +C GS+ C +C SG D LD Y ++  +Q  +    SF 
Sbjct  2283  LCDLYQVSDVGYRSS-------FCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRVSFD  2335

Query  2316  WDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLVQ  2373
             + ++ F LV E  + Y L+T  FY L     MQL  ++    F+  +  W     + +  
Sbjct  2336  Y-ISLFKLVVELVIGYSLYTVCFYPLFGLIGMQLLTTWLPEFFMLETMHWSARFFVFVAN  2394

Query  2374  MAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRS  2433
             M P   ++R YI   + Y ++    HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R 
Sbjct  2395  MLPAFTLLRFYIVVTAMYKIFCLCRHVMYGCSRPGCLFCYKRNRSVRVKCSTVVGGTLRY  2454

Query  2434  FYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDS  2493
             + V ANGG GFC  H WNC+NC  F  G+TFI+ E A DLS + KRP+NPTD + Y+V  
Sbjct  2455  YDVMANGGTGFCAKHQWNCLNCSAFGPGNTFITHEAAADLSKELKRPVNPTDSAYYLVTE  2514

Query  2494  VTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESS  2553
             V     S+ L++++ GQ+ Y+  S S FV+++ L  +  KG    +V+V + ++  +++ 
Sbjct  2515  VKQVGCSMRLFYERDGQRVYDDVSASLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAG  2572

Query  2554  AKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLV  2613
               +A+V+Y+Q + +P+LL+++ L++       V+  MFD YV++     +V  + L + V
Sbjct  2573  FLNAAVFYAQSLYRPMLLVEKKLITTANTGLSVSQTMFDLYVDSLLGVLDVDRKSLTSFV  2632

Query  2614  ATAEAELAKNVSLDNVLSTFISAARQG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNN  2672
               A   L + V L+ V+ TFI  AR+   +DSDVETK + + +  +  + ++ T +SCNN
Sbjct  2633  NAAHNSLKEGVQLEQVMDTFIGCARRKCAIDSDVETKSITKSIMSAVNAGVDFTDESCNN  2692

Query  2673  YMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSA  2732
              + TY K + +   DLG  I  +A+H+ A VAK+ N+A IW+V  F  LS  L+ ++R A
Sbjct  2693  LVPTYVKSDTIVAADLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKA  2752

Query  2733  AKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITP  2792
               K  L  KLT       V ++TT  +LKGG + +  L+ L  V L+   V    + + P
Sbjct  2753  CSKTGLKIKLTYNKQEANVPILTTPFSLKGGAVFSKVLQWLFVVNLICFIV---LWALMP  2809

Query  2793  VHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTNDKA  2850
              + + K          +K ID GV RD+  TD CFANK   FD W+    G   Y N +A
Sbjct  2810  TYAVHKSDMQLPLYASFKVIDNGVLRDVTVTDACFANKFIQFDQWYESTFGLVYYRNSRA  2869

Query  2851  CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFAT  2910
             CP++ AVI +++G+ +  +P  +LR      LHF+   F+     CYTP   I Y +F  
Sbjct  2870  CPVVVAVIDQDIGYTLFNVPTKVLR-YGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYA  2928

Query  2911  SACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYL  2969
             S CVL++ CT+   A G P PYCY   ++  +  Y+SL P  RY L + +  I+FP    
Sbjct  2929  SGCVLSSLCTMLAHADGTPHPYCYTEGIMHNASLYDSLAPHVRYNLANSNGYIRFPEVVS  2988

Query  2970  EGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTN  3029
             EG VR+V T    YCR G CE +E GVC + +  WVLNN YYR++PG FCG +A +L+  
Sbjct  2989  EGIVRIVRTRSMTYCRVGLCEDAEEGVCFNFNSSWVLNNPYYRAMPGTFCGRNAFDLIHQ  3048

Query  3030  MFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSF  3089
             +   L++PI    ++AS VAG I+AI+V    YY ++ +RAFG+Y+ VV  N +++ ++F
Sbjct  3049  VLGGLVRPIDFFALTASSVAGAILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINF  3108

Query  3090  TVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIS  3149
              +L +  VY  L  +Y+  Y Y T Y  +++S + H+QW+VM+  ++P W  I Y+  + 
Sbjct  3109  LMLFVFQVYPTLSCLYACFYFYTTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVV  3168

Query  3150  TKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLA  3209
             + H  W FS    R++     S  TFEE +L TF++ KE Y KL++ V      +NRYL+
Sbjct  3169  SNHALWLFS--YCRKLGTEVRSDGTFEEMSLTTFMITKESYCKLKNSV--SDVAFNRYLS  3224

Query  3210  LYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRK  3268
             LYNKY+YFSG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S+T++ LQSG  K
Sbjct  3225  LYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVK  3284

Query  3269  MAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHN  3328
             M FP+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R  + +
Sbjct  3285  MVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCRVISSD  3344

Query  3329  FLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGV  3388
             F V +G + L V+ + MQ  +L L V   NP TPKY F  ++PG+TF+VLA YNG   G 
Sbjct  3345  FCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGKSQGA  3404

Query  3389  YQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPF  3448
             +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP+
Sbjct  3405  FHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPY  3464

Query  3449  VDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQD  3508
              D Q  Q    D T TVNV+AWLYAA++N   WF+   + +L +FN+ AM   +  +  D
Sbjct  3465  RDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKAD  3524

Query  3509  HVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTF  3568
              V  L  L++ TG+ V  + A++K L  +G  G+ ILGS +LEDE TP DV +Q +GV  
Sbjct  3525  LV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQLAGVKL  3581

Query  3569  QSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMF  3628
             QS   R +KGT  W+L + L    ++    +W++F ++  +  L   +  +   +FAM+ 
Sbjct  3582  QSKRTRVVKGTCCWILASTLLFCSIISAFVKWTMFMYVTTH-MLGVTLCALCFVSFAMLL  3640

Query  3629  VKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYAS  3687
             VKHKH +L +F++P L T+ Y N +V    S+      WL     ++  +   D V+Y  
Sbjct  3641  VKHKHLYLTMFIMPVLCTLFYTNYLVVYKQSFRGLAYAWLSHFVPAVD-YTYMDEVLY--  3697

Query  3688  AVVLLILM---TARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
              VVLL+ M   T R++  D    ++ +  +++LV   Y+G  L++ + ++  + S+   Y
Sbjct  3698  GVVLLVAMVFVTMRSINHDVFSVMFLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTY  3755

Query  3745  SGVVTTVMFLARG-IVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             +   TT++ LA   ++   +    ++F     ++ ++L Y  +GY C CY+G+  LLN  
Sbjct  3756  TW--TTMLSLATAKVIAKWLAVNVLYFTDVPQVKLVLLSYLCIGYVCCCYWGVLSLLNSI  3813

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PP+NS +A  LN KLLG+GG P I+V+ +QS+++
Sbjct  3814  FRMPLGVYNYKISVQELRYMNANGLRPPRNSFEALVLNFKLLGIGGVPVIEVSQIQSRLT  3873

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +VVLL+ LQ L + SSSKLW  C  LHN+IL   D + AF+K+  LL VL +   
Sbjct  3874  DVKCVNVVLLNCLQHLHIASSSKLWQYCSTLHNEILATSDLSVAFDKLAQLLVVLFANPA  3933

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++ ++ + +   LQA+ SEF ++ S+  +  A++  ++A A+G + +  
Sbjct  3934  AVDSKCLASIEEVSDDYVRDSTVLQALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQ  3993

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             +K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3994  IKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4053

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP  T+  L +++PD   +    D    TYA  +W
Sbjct  4054  IRKLDNQALNSILDNAVKGCVPLNAIPSLTSNTLTIIVPDKQVFDQVVDNVYVTYAGNVW  4113

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
              IQ + DAD  + QL+EI +    N+ WPL++ A R N  S+V LQNNEL P  LR    
Sbjct  4114  HIQSIQDADGAVKQLNEIDV----NITWPLVIAANRHNEVSSVVLQNNELMPQKLRTQVV  4169

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G+     T      YYNTT  G+ V A+LSD   LK+ +  K DG   +  EL+PPC+
Sbjct  4170  NSGSDMNCNTPTQ--CYYNTTGMGKIVYAILSDCDGLKYTKIVKEDGNCVV-LELDPPCK  4226

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G+L++TVRLQAG ATE  +NS + S CAF+V
Sbjct  4227  FSVQDVKGLKIKYLYFVKGCNTLARGWVVGTLSSTVRLQAGTATEYASNSAIRSLCAFSV  4286

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y DY+  GG P+TNCVKMLC H GTG AIT+ PEA  +Q+S+GGAS C+YCR  +
Sbjct  4287  DPKKTYLDYIQQGGAPVTNCVKMLCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRV  4346

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA  4394
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC        QS 
Sbjct  4347  EHPDVDGLCKLRGKFVQVPLG-IKDPVSYVLTHDVCQVCGFWRDGSCSCVGTGS-QFQSK  4404

Query  4395  DAQSFLNGFAV  4405
             D  +FLNGF V
Sbjct  4405  DT-NFLNGFGV  4414


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 83/183 (45%), Gaps = 21/183 (11%)

Query  819  APTKVTFGDD-TVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVAD  877
            A  KV F D   V E+   + + I F LD   D VL++ CS + V+    ++E   VV D
Sbjct  832  AGKKVEFNDKPKVKEIPSTRKIKINFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLD  891

Query  878  AVIKTLQPVSE---LLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEG  934
            AV  TL P  E   + T +   L+  +    YLFDE GE  +A  MYCSF  PD++    
Sbjct  892  AVESTLSPCKEHDVIGTKVCALLNRLAEDYVYLFDEGGEEVIAPKMYCSFSAPDDE----  947

Query  935  DCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGS  994
            DC   +   + + +    DD           SAAL   + QEED +    Q  V + D  
Sbjct  948  DCVAADVVDADENQGDDADD-----------SAALV-TDTQEEDGV-AKGQVGVAESDAR  994

Query  995  EDN  997
             D 
Sbjct  995  LDQ  997


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 82/154 (53%), Gaps = 4/154 (3%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  ++V   V+VN AN  + HG GVAGA+ KA   +   E+ D +  
Sbjct  1267  ITPNVCFVKGDVIKVLRRVGAEVIVNPANGRMAHGAGVAGAIAKAAGKSFIKETADMVKN  1326

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQ---LLKSAYENFNQHEVLLAPLLS  1150
              G  +VG     +G NL K  L++VGP+  +G   Q    L+ AY++ N+ + ++  L+S
Sbjct  1327  QGVCQVGECYESTGGNLCKTVLNIVGPDA-RGHGKQCYSFLERAYQHINKCDDVVTTLIS  1385

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             AGIF      SL   +  V  NV L   +K+ +D
Sbjct  1386  AGIFSVPTDVSLTYLIGVVTKNVILVSNNKDDFD  1419


 Score = 41.6 bits (96),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 131/343 (38%), Gaps = 70/343 (20%)

Query  59   GVLPQLEQPYVFIKRSDARTAP---HGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEI  114
            GVLP+     +F +     T       HV  +L   + +G+  G +G  +G  VP V  I
Sbjct  120  GVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCLG-NGRFIGWFVP-VTAI  177

Query  115  PVAYRK-------VLLRKNGNKG---AGGHSYGADLKSFDLGDELGTDPYEDFQENWNTK  164
            P AY K       +LLRK GNKG   +G       +  +D   E   D  E+   N   K
Sbjct  178  P-AYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVE---DACEEVHLNPKGK  233

Query  165  HSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDT  224
            +S      L++   G     ++D   C   G   + ++D         CTL E  +    
Sbjct  234  YSRK-AYALLKGYRGVKSILFLDQYGCDYTGRLAKGLEDY------GDCTLEEMKELFP-  285

Query  225  KRGVYC-CREHEHEIAWYTERSEKS-YELQTPFEIKLAKKF-----DTFNGEC----PNF  273
               V+C   ++E  +AW+ +R  ++   LQT   I+          D  +G+     P  
Sbjct  286  ---VWCDSLDNEVVVAWHVDRDPRAVMRLQTLATIRSIGYVGQPTEDLVDGDVVVREPAH  342

Query  274  VFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQT  333
            +   N+I+K + PR+ +  L          Y  +S  E    C  T + CD    T +  
Sbjct  343  LLAANAIVKRL-PRLVETML----------YTDSSVTE---FCYKTKL-CDCGFITQFGY  387

Query  334  GDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNS  376
             D     C+F              G++P N +    CP C  S
Sbjct  388  VDCCGDACDF-------------RGWVPGNMMDGFLCPGCSKS  417


> sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavirus 
(strain JHM) OX=11144 GN=1a PE=1 SV=1
Length=4474

 Score = 1839 bits (4764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1080/2927 (37%), Positives = 1607/2927 (55%), Gaps = 153/2927 (5%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + V  TVD +N  +  V     +G+  G  + DG +VTK++    H+GK F+        
Sbjct  1610  VDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIHKGKVFFQYSGLSAA  1669

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              + A +     D   L +Y S L   K W         + K ++NNCY+  A L LQ + 
Sbjct  1670  DLAAVKDAFGFDEPQLLQYYSMLGMCK-WPVVVCGNYFAFKQSNNNCYINVACLMLQHLS  1728

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     +      R+G+   F +L+LA  +    E  D  + +    + A+L      
Sbjct  1729  LKFPKWQWRRPGNEFRSGKPLRFVSLVLAKGSFKFNEPSDSTDFIRVELREADLSGATCD  1788

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
             L  +CK CG +Q   KGV+AVM+ GTL      KG  I CTCG +   +  Q   PF++ 
Sbjct  1789  LEFICK-CGVKQEQRKGVDAVMHFGTLDKSGLVKGYNIACTCGDKLV-HCTQFNVPFLIC  1846

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  P   +L       A+ +TG    GHY H+  K      D   ++K SE KG  TD  
Sbjct  1847  SNTPEGKKLPDDVVA-ANIFTGG-SVGHYTHVKCKPKYQLYDACNVSKVSEAKGNFTDCL  1904

Query  1868  YKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNAS--  1924
             Y +N   T +    TY LD V C    P L  YY +   Y+T +PI     + +      
Sbjct  1905  YLKNLKQTFSSVLTTYYLDDVKCVAYKPDLSQYYCESGKYYT-KPIIKAQFRTFEKVEGV  1963

Query  1925  FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK V  +I  A+ LN   G+       E K+T +P   GDVV      Y   +  G 
Sbjct  1964  YTNFKLVGHDI--AEKLNAKLGFDCNSPFMEYKITEWPTATGDVVLASDDLYVSRYSGGC  2021

Query  1984  KLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWSTKPVETSNSFD-------------  2026
                 KP++W  H   +    TY  +P+  C    ++  PV+ S   D             
Sbjct  2022  VTFGKPVIWRGHEEASLKSLTYFNRPSVVC-ENKFNVLPVDVSEPTDRRPVPSAVLVTGA  2080

Query  2027  -------VLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVG------  2073
                     + +E     +  AC     V +++V     +  V    VK  ++ G      
Sbjct  2081  ASGADASAISTEPGTAKEQKACAS-DSVEDQIVMEAQKKSSVTTVAVKEVKLNGVKKPVK  2139

Query  2074  ---DIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATH---GL  2127
                 +++    +  K+ + +   D+   ++      +   NELSR++   T+  +   G+
Sbjct  2140  WNCSVVVNDPTSETKVVKSLSIVDVYDMFLTGCRYVVWTANELSRLINSPTVREYVKWGM  2199

Query  2128  AAVNSVPWDTI--ANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRS  2185
             + +  +P + +   +  + F+   V     I        C   + +F         F   
Sbjct  2200  SKL-IIPANLLLLRDEKQEFVAPKVVKAKAIA-------CYGAVKWFLLYCFSWIKF---  2248

Query  2186  TNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLIN--------IIIWF--LL  2235
              N+  K    T +A    K   K C  A  N L++ N+S +           ++WF  L 
Sbjct  2249  -NTDNKVIYTTEVAS---KLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFNFLY  2304

Query  2236  LSVCLGSL---------IYSTAALGVLMSNLGMPSYCTGYRE---GYLNSTNVTIATYCT  2283
              +V L            ++    +  + +  G+ + C  Y+    GY +S       +C 
Sbjct  2305  ANVILSDFYLPNIGPLPMFVGQIVAWVKTTFGVLTICDFYQVTDLGYRSS-------FCN  2357

Query  2284  GSIPCSVCLSGLDSLDTYPSLETIQITIS---SFKWDLTAFGLVAEWFLAYILFTRFFYV  2340
             GS+ C +C SG D LD Y S+  +Q  +    SF + ++ F LV E  + Y L+T  FY 
Sbjct  2358  GSMVCELCFSGFDMLDNYESINVVQHVVDRRVSFDY-ISLFKLVVELVIGYSLYTVCFYP  2416

Query  2341  LGLAAIMQLFFSYFAVHFISNS--WLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYV  2398
             L +   MQL  ++    F+  +  W   L + +  M P   ++R YI   + Y V+    
Sbjct  2417  LFVLVGMQLLTTWLPEFFMLGTMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYCLCR  2476

Query  2399  HVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTF  2458
             HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R + V ANGG GFC  H WNC+NC+++
Sbjct  2477  HVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNCNSW  2536

Query  2459  CAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSL  2518
               G+TFI+ E A DLS + KRP+NPTD + Y V  V     S+ L++++ GQ+ Y+  S 
Sbjct  2537  KPGNTFITHEAAADLSKELKRPVNPTDSAYYSVIEVKQVGCSMRLFYERDGQRVYDDVSA  2596

Query  2519  SHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVS  2578
             S FV+++ L  +  KG    +V+V + ++  +++   +A+V+Y+Q + +P+L++++ L++
Sbjct  2597  SLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAGFLNAAVFYAQSLYRPMLMVEKKLIT  2654

Query  2579  DVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAAR  2638
                    V+  MFD YV +     +V  + L + V  A   L + V L+ V+ TF+  AR
Sbjct  2655  TANTGLSVSRTMFDLYVYSLLRHLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFVGCAR  2714

Query  2639  QG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSAR  2697
             +   +DSDVETK + + +  +  + +EVT +SCNN + TY K + +   DLG  I  +A+
Sbjct  2715  RKCAIDSDVETKSITKSVMAAVNAGVEVTDESCNNLVPTYVKSDTIVAADLGVLIQNNAK  2774

Query  2698  HINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTK  2757
             H+ + VAK+ N+A IW+V  F  LS  L+ ++R A  K  L  KLT       V ++TT 
Sbjct  2775  HVQSNVAKAANVACIWSVDAFNQLSADLQHRLRKACVKTGLKIKLTYNKQEANVPILTTP  2834

Query  2758  IALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVT  2817
              +LKGG + +  L+ L    L+   V    + + P + + K          +K ID GV 
Sbjct  2835  FSLKGGAVFSRVLQWLFVANLICFIV---LWALMPTYAVHKSDMQLPLYASFKVIDNGVL  2891

Query  2818  RDIASTDTCFANKHADFDTWFSQRGG--SYTNDKACPLIAAVITREVGFVVPGLPGTILR  2875
             RD++ TD CFANK   FD W+    G   Y N KACP++ AVI +++G  +  +P  +LR
Sbjct  2892  RDVSVTDACFANKFNQFDQWYESTFGLVYYRNSKACPVVVAVIDQDIGHTLFNVPTKVLR  2951

Query  2876  TTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYD  2935
                   LHF+   F+     CYTP   I Y +F  S CVL++ CT+   A G P PYCY 
Sbjct  2952  Y-GFHVLHFITHAFATDRVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGTPHPYCYT  3010

Query  2936  TNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEA  2994
               V+  +  Y SL P  RY L   +  I+FP    EG VRVV T    YCR G CE +E 
Sbjct  3011  EGVMHNASLYSSLVPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVGLCEEAEE  3070

Query  2995  GVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVA  3054
             G+C + +  WVLNN YYR++PG FCG +A +L+  +   L+QPI    ++AS VAG I+A
Sbjct  3071  GICFNFNSSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVQPIDFFALTASSVAGAILA  3130

Query  3055  IVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTF  3114
             I+V    YY ++ +RAFG+Y+ VV  N +++ ++F +L +  VY  L  +Y+  Y Y T 
Sbjct  3131  IIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYACFYFYTTL  3190

Query  3115  YLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFST  3174
             Y  +++S + H+QW+VM+  ++P W  I Y+  + + H  W FS    R++  +  S  T
Sbjct  3191  YFPSEISVVMHLQWLVMYGAIMPLWFCITYVAVVVSNHALWLFS--YCRKIGTDVRSDGT  3248

Query  3175  FEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL  3234
             FEE AL TF++ KE Y KL++ V      +NRYL+LYNKY+YFSG MDT +YREAAC  L
Sbjct  3249  FEEMALTTFMITKESYCKLKNSV--SDVAFNRYLSLYNKYRYFSGKMDTATYREAACSQL  3306

Query  3235  AKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3293
             AKA+  F+ N+G+DVLYQPP  S+T++ LQSG  KM  P+ KVE C+V VT G  TLNGL
Sbjct  3307  AKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCVVSVTYGNMTLNGL  3366

Query  3294  WLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLK  3353
             WLDD VYCPRHVIC+S DM +P+Y +LL R ++ +F V +  + L V+ + MQ  +L L 
Sbjct  3367  WLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSDRMSLTVMSYQMQGSLLVLT  3426

Query  3354  VDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGF  3413
             V   NP TPKY F  ++PG+TF+VLA YNG P G +   MR + TIKGSFL GSCGSVG+
Sbjct  3427  VTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVVMRSSHTIKGSFLCGSCGSVGY  3486

Query  3414  NIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYA  3473
              +  D V F YMH +EL TG H GTD  GNFYGP+ D Q  Q    D T TVNV+AWLYA
Sbjct  3487  VLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAWLYA  3546

Query  3474  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKE  3533
             A++N   WF+   + +L +FN+ AM   +  +  D V  L  L++ TG+ V  + A++K 
Sbjct  3547  AILNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV--LDALASMTGVTVEQVLAAIKR  3604

Query  3534  LLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLV  3593
              L +G  G+ ILGS +LEDE TP DV +Q +GV  QS   R IKGT  W+L +      +
Sbjct  3605  -LHSGFQGKQILGSCVLEDELTPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLFCSI  3663

Query  3594  LVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMV  3653
             +    +W++F ++  +  L   +  +    FAM+ +KHKH +L ++++P L T+ Y N +
Sbjct  3664  ISAFVKWTMFMYVTTH-MLGVTLCALCFVIFAMLLIKHKHLYLTMYIMPVLCTLFYTNYL  3722

Query  3654  YMPASWVMRIM--TWLDMVDTSLSGFKLKDCVMYASAVVLLILM---TARTVYDDGARRV  3708
              +      R +   WL     ++  +   D V+Y   VVLL+ M   T R++  D    +
Sbjct  3723  VVGYKQSFRGLAYAWLSYFVPAVD-YTYMDEVLY--GVVLLVAMVFVTMRSINHDVFSTM  3779

Query  3709  WTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARG-IVFMCVEYCP  3767
             + +  +++LV   Y+G  L++ + ++  + S+   Y+   TT++ LA   ++   +    
Sbjct  3780  FLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTYTW--TTMLSLATAKVIAKWLAVNV  3835

Query  3768  IFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQG  3827
             ++F     ++ ++L Y  +GY C CY+G+  LLN  FR+ LGVY+Y +S QE RYMN+ G
Sbjct  3836  LYFTDIPQIKLVLLSYLCIGYVCCCYWGVLSLLNSIFRMPLGVYNYKISVQELRYMNANG  3895

Query  3828  LLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKL  3887
             L PP+NS +A  LN KLLG+GG P I+V+ +QS+++DVKC +VVLL+ LQ L + S+SKL
Sbjct  3896  LRPPRNSFEALMLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSKL  3955

Query  3888  WAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVD------INKLCEEMLDNRATL  3941
             W  C  LHN+IL   D + AF+K+  LL VL +   AVD      I ++ ++ + +   L
Sbjct  3956  WQYCSTLHNEILATSDLSVAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTVL  4015

Query  3942  QAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVLKKLKKSLNVAKSEFDRDAAMQRK  4000
             QA+ SEF ++ S+  +  A++  ++A A+G + +  +K+L+K+ N+AKS ++RD A+ RK
Sbjct  4016  QALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVARK  4075

Query  4001  LEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLN  4060
             LE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+RKLDN ALN+I++NA  GCVPLN
Sbjct  4076  LERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPLN  4135

Query  4061  IIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSP  4120
              IP  T+  L +++PD   +    D    TYA  +W IQ + DAD  + QL+EI ++++ 
Sbjct  4136  AIPPLTSNTLTIIVPDKQVFDQVVDNVYVTYAPNVWHIQSIQDADGAVKQLNEIDVNST-  4194

Query  4121  NLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGG  4178
                WPL+++A R N  S V LQNNEL P  LR     +G+      +     YYNTT  G
Sbjct  4195  ---WPLVISANRHNEVSTVVLQNNELMPQKLRTQVVNSGSDMNC--NIPTQCYYNTTGTG  4249

Query  4179  RFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLN  4238
             + V A+LSD   LK+ +  K DG   +  EL+PPC+F     KG K+KYLYF+KG N L 
Sbjct  4250  KIVYAILSDCDGLKYTKIVKEDGN-CVVLELDPPCKFSVQDVKGLKIKYLYFVKGCNTLA  4308

Query  4239  RGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKML  4298
             RG V+G+L++TVRLQAG ATE  +NS +LS CAF+VD  K Y DY+  GG P+TNCVKML
Sbjct  4309  RGWVVGTLSSTVRLQAGTATEYASNSAILSLCAFSVDPKKTYLDYIQQGGVPVTNCVKML  4368

Query  4299  CTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCAN  4358
             C H GTG AIT+ PEA  +Q+S+GGAS C+YCR  ++HP+  G C L+GK+VQ+P     
Sbjct  4369  CDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLG-IK  4427

Query  4359  DPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
             DPV + L + VC VCG W+   CSC        QS D  +FLNGF V
Sbjct  4428  DPVSYVLTHDVCQVCGFWRDGSCSCVGTGS-QFQSKDT-NFLNGFGV  4472


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 239/1025 (23%), Positives = 394/1025 (38%), Gaps = 219/1025 (21%)

Query  2    ESLVPGFNEKTHVQLS---LPVLQ-------VRDVLVRGFGDSVEEVLSEARQHLKDGTC  51
            E  V G     HV++    LP L+       +RD+ V    +  ++V +     L+ G+ 
Sbjct  46   EPKVKGKTLVNHVRVDCSRLPALECCVQSAIIRDIFV---DEDPQKVEASTMMALQFGSA  102

Query  52   GLVEVEK----------GVLPQLEQPYVFIKRSDARTAP---HGHVMVEL-VAELEGIQY  97
             LV+  K          GVLP+     +F +     T       HV  +L   + +G+  
Sbjct  103  VLVKPSKRLSVQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCL  162

Query  98   GRSGETLGVLVPHVGEIPVAYRK------VLLRKNGNKGA---GGHSYGADLKSFDLGDE  148
            G +G  +G  VP V  IP   ++      +LLRK GNKG+   G       +  +D   E
Sbjct  163  G-NGRFIGWFVP-VTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVE  220

Query  149  LGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARA  208
               D  E+   N   K+S      L+R   G     +VD   C   G    C+   L   
Sbjct  221  ---DACEEVHLNPRGKYSCK-AYALLRGYRGVKPILFVDQYGCDYTG----CLAKGLEDY  272

Query  209  GKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKS-YELQTPFEIKLAKKF----  263
            G    TLSE  +     R      ++E  +AW+ +R  ++   LQT   ++  +      
Sbjct  273  GDL--TLSEMKELSPVWRDSL---DNEVVVAWHVDRDPRAVMRLQTLATVRSIEYVGQPI  327

Query  264  -DTFNGEC----PNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLS  318
             D  +G+     P  +   N+I+K + PR+ +  L          Y  +S  E    C  
Sbjct  328  EDMVDGDVVMREPAHLLAPNAIVKRL-PRLVETML----------YTDSSVTE---FCYK  373

Query  319  TLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPAC-----  373
            T + CD CG  + Q G +V    + CG            G++P N +    CP C     
Sbjct  374  TKL-CD-CGFIT-QFG-YVDCCGDTCGFR----------GWVPGNMMDGFPCPGCCKSYM  419

Query  374  ------HNSEVGPEHSL--AEYHNESGLKTILRKGGRTIAFGGCVF--SYVGCHNKCAYW  423
                   +S V PE  +   +  +    ++    G   + FGG  +   Y G       W
Sbjct  420  PWELEAQSSGVIPEGGVLFTQSTDTVNRESFKLYGHAVVPFGGAAYWSPYPG------MW  473

Query  424  VPRASANIGC----NHTGVVG-EGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILA  478
            +P   +++       +TGVVG +      D +   L  + V  +  G+    E+ AI+  
Sbjct  474  LPVIWSSVKSYSYLTYTGVVGCKAIVQETDAICRFLYMDYVQ-HKCGNL---EQRAIL--  527

Query  479  SFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFAS  538
                          GLD    +Q++ + G++ +                 +L  +  F  
Sbjct  528  --------------GLDDVYHRQLLVNRGDYSL-----------------LLENVDLFVK  556

Query  539  EAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDA-MMFTSDLATNNLVV  597
                  R+ F+    T  + +  L      +LDG+   S  LI +   FTS +   +  V
Sbjct  557  R-----RAEFACKFATCGDGLVPL------LLDGLVPRSYYLIKSGQAFTSLMVNFSREV  605

Query  598  ------MAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRD------G  645
                  MA +    V++ ++++  + G V  + K +   +  K  E  +   D      G
Sbjct  606  VDMCMDMALLFMHDVKVATKYVKKVTGKVAVRFKALGIAVVRKITEWFDLAVDTAASAAG  665

Query  646  WEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNL  705
            W   + ++      V   ++T  +E+ E V+ F      F  +  DS+ +      ++  
Sbjct  666  WLCYQLVN--GLFAVANGVITFIQEVPELVKNFVDKFKTFFKVLIDSMSV------SILS  717

Query  706  GETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVL---TEEVVLKTGD  762
            G T V  +    R C+             A  ++  +  ++LP  ++     E     G+
Sbjct  718  GLTVVKTASN--RVCL-------------AGSKVYEVVQKSLPAYIMPVGCSEATCLVGE  762

Query  763  LQP--LEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK-YCALAPN----MMVTNNTFTL  815
            ++P   E    + V+APL     C       +I   +K Y A   +    ++V N+T  +
Sbjct  763  IEPAVFEDDVVDVVKAPLTYQGCCKPPSSFEKICIVDKLYMAKCGDQFYPVVVDNDTVGV  822

Query  816  KGG------APTKVTFGDD-TVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEV  868
                     A  KV F D   V EV   + + I F LD   D VL++ CS + V+    +
Sbjct  823  LDQCWRFPCAGKKVVFNDKPKVKEVPSTRKIKIIFALDATFDSVLSKACSEFEVDKDVTL  882

Query  869  NEFACVVADAVIKTLQPVSE---LLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFY  925
            +E   VV DAV  TL P  E   + T +   L+       YLFDE GE  +AS MYCSF 
Sbjct  883  DELLDVVLDAVESTLSPCKEHGVIGTKVCALLERLVDDYVYLFDEGGEEVIASRMYCSFS  942

Query  926  PPDED  930
             PDED
Sbjct  943  APDED  947


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 82/153 (54%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  ++V   V+VN AN  + HG GVAGA+ KA   A   E+ D +  
Sbjct  1319  ITPNVCFVKGDVIKVLRRVGAEVIVNPANGRMAHGAGVAGAIAKAAGKAFINETADMVKA  1378

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNV--NKGEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G  +VGG    +G  L K  L++VGP+   +  E   LL+ AY++ N+ + ++  L+SA
Sbjct  1379  QGVCQVGGCYESTGGKLCKKVLNIVGPDARGHGNECYSLLERAYQHINKCDNVVTTLISA  1438

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   +  V  NV L   +++ +D
Sbjct  1439  GIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFD  1471


 Score = 39.7 bits (91),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 86/217 (40%), Gaps = 33/217 (15%)

Query  1596  PTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLR-VEAFEYYHTTDPSFLGRYMSALNHTK  1654
             P  ++  D+ K++     E +T    P D T   V AF+  ++   S      S   H K
Sbjct  1047  PDQVEAFDIEKVEDSILSELQTELNAPADKTYEDVLAFDAIYSETLSAFYAVPSDETHFK  1106

Query  1655  KWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALI  1714
                   V G  S      NC+L + L+ +Q + L+F    +Q  +   +AG    F   +
Sbjct  1107  ------VCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDLGMQKLWLSYKAGYDQCFVDKL  1160

Query  1715  LAYCNKTV-----GELGDVRETMSYLFQHANLDSC--KRVLNVVCKTCGQQQTTLKGVEA  1767
             +    K++     G + D     +Y F    L  C  K   N  C  CG  +  L+G++A
Sbjct  1161  VKSAPKSIILPQGGYVAD----FAYFF----LSQCSFKVHANWRCLKCG-MELKLQGLDA  1211

Query  1768  VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF  1804
             V + G +        V   C CG   T  L+  + P+
Sbjct  1212  VFFYGDV--------VSHMCKCGNSMT--LLSADIPY  1238


> sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavirus 
(strain A59) OX=11142 GN=1a PE=1 SV=1
Length=4468

 Score = 1838 bits (4760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/2928 (37%), Positives = 1609/2928 (55%), Gaps = 162/2928 (6%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + V  TVD +N  +  V     +G+  G  + DG +VTK++    ++GK F+   +    
Sbjct  1611  VDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEA  1670

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              + A +     D   L +Y + L   K W         + K ++NNCY+  A L LQ + 
Sbjct  1671  DLVAVKDAFGFDEPQLLKYYTMLGMCK-WPVVVCGNYFAFKQSNNNCYINVACLMLQHLS  1729

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G+   F +L+LA  +    E  D  + M  + + A+L      
Sbjct  1730  LKFPKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCN  1789

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
             L  VCK CG +Q   KGV+AVM+ GTL      +G  I CTCG +   +  Q   PF++ 
Sbjct  1790  LEFVCK-CGVKQEQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLV-HCTQFNVPFLIC  1847

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  P   +L       A+ +TG    GHY H+  K      D   + K SE KG  TD  
Sbjct  1848  SNTPEGRKLPDDVVA-ANIFTGG-SVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCL  1905

Query  1868  YKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--NAS  1924
             Y +N   T +    T+ LD V C E  P L  YY +   Y+T +PI     + +   +  
Sbjct  1906  YLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQYYCESGKYYT-KPIIKAQFRTFEKVDGV  1964

Query  1925  FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK V  +I  A+ LN   G+       E K+T +P   GDVV      Y   +  G 
Sbjct  1965  YTNFKLVGHSI--AEKLNAKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGC  2022

Query  1984  KLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWSTKPVETSNSFDV-----------L  2028
                 KP+VW  H   +    TY  +P+  C    ++  PV+ S   D            +
Sbjct  2023  ITFGKPVVWLGHEEASLKSLTYFNRPSVVC-ENKFNVLPVDVSEPTDKGPVPAAVLVTGV  2081

Query  2029  KSEDAQGMDNLACEDLKPVSE--------EVVENPTIQ-KDVLECNV----KTTEVVGDI  2075
                DA     +A E     S         EV + P++   DV E  +    K  +V G +
Sbjct  2082  PGADASAGAGIAKEQKACASASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSV  2141

Query  2076  ILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPW  2135
             ++    +  K+ + +   D+   ++      +   NELSR+             VNS   
Sbjct  2142  VVNDPTSETKVVKSLSIVDVYDMFLTGCKYVVWTANELSRL-------------VNS---  2185

Query  2136  DTIANYAKPFLNKVVSTTTNIVTRCLNR-------------VCTNYMPYFFTLLLQLCTF  2182
              T+  Y K  + K+V+    ++ R   +              C   + +F         F
Sbjct  2186  PTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKVVKAKAIACYCAVKWFLLYCFSWIKF  2245

Query  2183  TRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLIN--------IIIW--  2232
                 N+  K    T +A    K   K C  A  N L++ N+S +           ++W  
Sbjct  2246  ----NTDNKVIYTTEVAS---KLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFN  2298

Query  2233  FLLLSVCLGSL---------IYSTAALGVLMSNLGMPSYCTGYRE---GYLNSTNVTIAT  2280
             FL  +V L             +    +    +  G+ + C  Y+    GY +S       
Sbjct  2299  FLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDFYQVTDLGYRSS-------  2351

Query  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITIS---SFKWDLTAFGLVAEWFLAYILFTRF  2337
             +C GS+ C +C SG D LD Y ++  +Q  +    SF + ++ F LV E  + Y L+T  
Sbjct  2352  FCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDY-ISLFKLVVELVIGYSLYTVC  2410

Query  2338  FYVLGLAAIMQLFFSYFAVHFISNS--WLMWLIINLVQMAPISAMVRMYIFFASFYYVWK  2395
             FY L +   MQL  ++    F+  +  W   L + +  M P   ++R YI   + Y V+ 
Sbjct  2411  FYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYC  2470

Query  2396  SYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNC  2455
                HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R + V ANGG GFC  H WNC+NC
Sbjct  2471  LCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNC  2530

Query  2456  DTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYER  2515
             +++  G+TFI+ E A DLS + KRP+NPTD + Y V  V     S+ L++++ GQ+ Y+ 
Sbjct  2531  NSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFYERDGQRVYDD  2590

Query  2516  HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQA  2575
              + S FV+++ L  +  KG    +V+V + ++  +++    A+V+Y+Q + +P+L++++ 
Sbjct  2591  VNASLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAGFLGAAVFYAQSLYRPMLMVEKK  2648

Query  2576  LVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFIS  2635
             L++       V+  MFD YV++  +  +V  + L + V  A   L + V L+ V+ TFI 
Sbjct  2649  LITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFIG  2708

Query  2636  AARQG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
              AR+   +DSDVETK + + +  +  + ++ T +SCNN + TY K + +   DLG  I  
Sbjct  2709  CARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAADLGVLIQN  2768

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +A+H+ A VAK+ N+A IW+V  F  LS  L+ ++R A  K  L  KLT       V ++
Sbjct  2769  NAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNKQEANVPIL  2828

Query  2755  TTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDG  2814
             TT  +LKGG + +  L+ L    L+   V    + + P + + K          +K ID 
Sbjct  2829  TTPFSLKGGAVFSRMLQWLFVANLICFIV---LWALMPTYAVHKSDMQLPLYASFKVIDN  2885

Query  2815  GVTRDIASTDTCFANKHADFDTWFSQRGG--SYTNDKACPLIAAVITREVGFVVPGLPGT  2872
             GV RD++ TD CFANK   FD W+    G   Y N KACP++ AVI +++G  +  +P T
Sbjct  2886  GVLRDVSVTDACFANKFNQFDQWYESTFGLAYYRNSKACPVVVAVIDQDIGHTLFNVPTT  2945

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +LR      LHF+   F+     CYTP   I Y +F  S CVL++ CT+   A G P PY
Sbjct  2946  VLR-YGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGTPHPY  3004

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCER  2991
             CY   V+  +  Y SL P  RY L   +  I+FP    EG VRVV T    YCR G CE 
Sbjct  3005  CYTGGVMHNASLYSSLAPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVGLCEE  3064

Query  2992  SEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGG  3051
             +E G+C + +  WVLNN YYR++PG FCG +A +L+  +   L++PI    ++AS VAG 
Sbjct  3065  AEEGICFNFNRSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVRPIDFFALTASSVAGA  3124

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLY  3111
             I+AI+V    YY ++ +RAFG+Y+ VV  N +++ ++F +L +  VY  L  +Y+  Y Y
Sbjct  3125  ILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYACFYFY  3184

Query  3112  LTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVS  3171
              T Y  +++S + H+QW+VM+  ++P W  I Y+  + + H  W FS    R++     S
Sbjct  3185  TTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVVSNHALWLFS--YCRKIGTEVRS  3242

Query  3172  FSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAAC  3231
               TFEE AL TF++ KE Y KL++ V      +NRYL+LYNKY+YFSG MDT +YREAAC
Sbjct  3243  DGTFEEMALTTFMITKESYCKLKNSV--SDVAFNRYLSLYNKYRYFSGKMDTAAYREAAC  3300

Query  3232  CHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTL  3290
               LAKA+  F+ N+G+DVLYQPP  S+T++ LQSG  KM  P+ KVE C+V VT G  TL
Sbjct  3301  SQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCIVSVTYGNMTL  3360

Query  3291  NGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL  3350
             NGLWLDD VYCPRHVIC+S DM +P+Y +LL R ++ +F V +G + L V+ + MQ C L
Sbjct  3361  NGLWLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSGRMSLTVMSYQMQGCQL  3420

Query  3351  KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGS  3410
              L V   NP TPKY F  ++PG+TF+VLA YNG P G +   +R + TIKGSFL GSCGS
Sbjct  3421  VLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGS  3480

Query  3411  VGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAW  3470
             VG+ +  D V F YMH +EL TG H GTD  GNFYGP+ D Q  Q    D T TVNV+AW
Sbjct  3481  VGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAW  3540

Query  3471  LYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAS  3530
             LYAA+ N   WF+   + +L +FN+ AM   +  +  D V  L  L++ TG+ V  + A+
Sbjct  3541  LYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV--LDALASMTGVTVEQVLAA  3598

Query  3531  LKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTS  3590
             +K  L +G  G+ ILGS +LEDE TP DV +Q +GV  QS   R IKGT  W+L +    
Sbjct  3599  IKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLF  3656

Query  3591  LLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYF  3650
               ++    +W++F ++  +  L   +  +   +FAM+ +KHKH +L ++++P L T    
Sbjct  3657  CSIISAFVKWTMFMYVTTH-MLGVTLCALCFVSFAMLLIKHKHLYLTMYIMPVLCTFYTN  3715

Query  3651  NMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILM---TARTVYDDGARR  3707
              +V    S+      WL     ++  +   D V+Y   VVLL+ M   T R++  D    
Sbjct  3716  YLVVYKQSFRGLAYAWLSHFVPAVD-YTYMDEVLY--GVVLLVAMVFVTMRSINHDVFSI  3772

Query  3708  VWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARG-IVFMCVEYC  3766
             ++ +  +++LV   Y+G  L++ + ++  + S+   Y+   TT++ LA   ++   +   
Sbjct  3773  MFLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTYTW--TTMLSLATAKVIAKWLAVN  3828

Query  3767  PIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQ  3826
              ++F     ++ ++L Y  +GY C CY+G+  LLN  FR+ LGVY+Y +S QE RYMN+ 
Sbjct  3829  VLYFTDVPQIKLVLLSYLCIGYVCCCYWGILSLLNSIFRMPLGVYNYKISVQELRYMNAN  3888

Query  3827  GLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSK  3886
             GL PP+NS +A  LN KLLG+GG P I+V+ +QS+++DVKC +VVLL+ LQ L + S+SK
Sbjct  3889  GLRPPRNSFEALMLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSK  3948

Query  3887  LWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVD------INKLCEEMLDNRAT  3940
             LW  C  LHN+IL   D + AF+K+  LL VL +   AVD      I ++ ++ + +   
Sbjct  3949  LWQYCSTLHNEILATSDLSMAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTV  4008

Query  3941  LQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVLKKLKKSLNVAKSEFDRDAAMQR  3999
             LQA+ SEF ++ S+  +  A++  ++A A+G + +  +K+L+K+ N+AKS ++RD A+ R
Sbjct  4009  LQALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVAR  4068

Query  4000  KLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPL  4059
             KLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+RKLDN ALN+I++NA  GCVPL
Sbjct  4069  KLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPL  4128

Query  4060  NIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNS  4119
             N IP  T+  L +++PD   +    D    TYA  +W IQ + DAD  + QL+EI ++++
Sbjct  4129  NAIPSLTSNTLTIIVPDKQVFDQVVDNVYVTYAGNVWHIQFIQDADGAVKQLNEIDVNST  4188

Query  4120  PNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKG  4177
                 WPL++ A R N  S V LQNNEL P  LR     +G+     T      YYNTT  
Sbjct  4189  ----WPLVIAANRHNEVSTVVLQNNELMPQKLRTQVVNSGSDMNCNTPTQ--CYYNTTGT  4242

Query  4178  GRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNL  4237
             G+ V A+LSD   LK+ +  K DG   +  EL+PPC+F     KG K+KYLYF+KG N L
Sbjct  4243  GKIVYAILSDCDGLKYTKIVKEDGN-CVVLELDPPCKFSVQDVKGLKIKYLYFVKGCNTL  4301

Query  4238  NRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKM  4297
              RG V+G+L++TVRLQAG ATE  +NS +LS CAF+VD  K Y DY+  GG P+TNCVKM
Sbjct  4302  ARGWVVGTLSSTVRLQAGTATEYASNSAILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKM  4361

Query  4298  LCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCA  4357
             LC H GTG AIT+ PEA  +Q+S+GGAS C+YCR  ++HP+  G C L+GK+VQ+P    
Sbjct  4362  LCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLG-I  4420

Query  4358  NDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAV  4405
              DPV + L + VC VCG W+   CSC        QS D  +FLNGF V
Sbjct  4421  KDPVSYVLTHDVCQVCGFWRDGSCSCVGTGS-QFQSKDT-NFLNGFGV  4466


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 118/252 (47%), Gaps = 20/252 (8%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  + V   V+VN AN  + HG GVAGA+ +   +A   E+ D +  
Sbjct  1320  ITPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKA  1379

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQ---LLKSAYENFNQHEVLLAPLLS  1150
              G  +VG     +G  L K  L++VGP+  +G   Q   LL+ AY++ N+ + ++  L+S
Sbjct  1380  QGVCQVGECYESAGGKLCKKVLNIVGPDA-RGHGKQCYSLLERAYQHINKCDNVVTTLIS  1438

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVS-SFLEMKSEKQVEQKIAEIPKE  1209
             AGIF      SL   +  V  NV L   +++ +D +       +   K +  ++A+    
Sbjct  1439  AGIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCR  1498

Query  1210  EVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLL------YIDINGNL  1263
             +VK F+T +  S+          ++C       L+E + L  ++ L      ++  N + 
Sbjct  1499  DVK-FVTNACSSLFS--------ESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDC  1549

Query  1264  HPDSATLVSDID  1275
              P    LV+  D
Sbjct  1550  LPTDWRLVNKFD  1561


 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 108/457 (24%), Positives = 188/457 (41%), Gaps = 59/457 (13%)

Query  569   ILDGISQYSLRLIDA-MMFTSDLA------TNNLVVMAYITGGVVQLTSQWLTNIFGTVY  621
             +LDG+   S  LI +   FTS +       T+  + MA +    V++ ++++  + G + 
Sbjct  576   LLDGLVPRSYYLIKSGQAFTSMMVNFSHEVTDMCMDMALLFMHDVKVATKYVKKVTGKLA  635

Query  622   EKLKPVLDWLEEKFKEGVEFLRD------GWEIVKFISTCACEIVGGQIVTCAKEIKESV  675
              + K +   +  K  E  +   D      GW   + ++      V   ++T  +E+ E V
Sbjct  636   VRFKALGVAVVRKITEWFDLAVDIAASAAGWLCYQLVN--GLFAVANGVITFVQEVPELV  693

Query  676   QTFFKLVNKFLALCADSI---IIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMP  732
             + F      F  +  DS+   I+ G  +         +  SK +Y   V  +  +  +MP
Sbjct  694   KNFVDKFKAFFKVLIDSMSVSILSGLTVVKTASNRVCLAGSK-VYE--VVQKSLSAYVMP  750

Query  733   LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTPVCINGLML  790
             +    E   L GE  P        V +   +  ++ P +     + P     +CI   + 
Sbjct  751   VGC-SEATCLVGEIEPA-------VFEDDVVDVVKAPLTYQGCCKPPTSFEKICIVDKLY  802

Query  791   LEIKDTEKYCALAPN--MMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGYKSVNITFELDE  847
             +     + Y  +  N  + V +  +     A  KV F D   V ++   + + ITF LD 
Sbjct  803   MAKCGDQFYPVVVDNDTVGVLDQCWRFPC-AGKKVEFNDKPKVRKIPSTRKIKITFALDA  861

Query  848   RIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPLGIDLDEWSMAT  904
               D VL++ CS + V+    ++E   VV DAV  TL P  E   + T +   LD  +   
Sbjct  862   TFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDY  921

Query  905   YYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGA  964
              YLFDE G+  +A  MYCSF  PD++    DC   +   + + +   +DD         A
Sbjct  922   VYLFDEGGDEVIAPRMYCSFSAPDDE----DCVAADVVDADENQ---DDD---------A  965

Query  965   TSAALQPEEEQEED-----WLDDDSQQTVGQQDGSED  996
               +A+   + QEED      ++ DS+  V      E+
Sbjct  966   EDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEE  1002


> sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus 
133/2005 OX=389230 GN=1a PE=3 SV=1
Length=4441

 Score = 1837 bits (4757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 955/2182 (44%), Positives = 1372/2182 (63%), Gaps = 55/2182 (3%)

Query  2255  SNLGMPSYCTGYREGYLNSTNVTIATYCTG-SIPCSVCLSGLDSLDTYPSLETIQITISS  2313
             S LG+ + C G    Y N T+  +  +C+  S+ C  CL G DSL  Y +L+ +Q  I+S
Sbjct  2274  SYLGIRTLCDGLAVEYRN-TSFDVVDFCSNRSVLCQWCLIGQDSLTRYSALQMLQTHITS  2332

Query  2314  FKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFA--VHFISNSWLMWLIINL  2371
             +  ++       E+FLAY+L+T  F VL L    Q FF+Y +  V++ + ++++  +  L
Sbjct  2333  YVLNIDWIWFALEFFLAYVLYTSSFNVLLLVVTAQYFFAYTSAFVNWRAYNYIVSGLFFL  2392

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
             V   P+  +VR+Y F A  +++ K Y HV++GC  + C++CYKRNR TRVE +TIV G +
Sbjct  2393  VTHIPLHGLVRVYNFLACLWFLRKFYSHVINGCKDTACLLCYKRNRLTRVEASTIVCGTK  2452

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R+FY+ ANGG  +C  HNWNCV CDT   G+TFI  EVA DL+   +R I PTDQS Y V
Sbjct  2453  RTFYIAANGGTSYCCKHNWNCVECDTAGVGNTFICTEVANDLTTTLRRLIKPTDQSHYYV  2512

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRAN---NTKGSLP-INVIVFDGKS  2547
             DSV VK+  + L++++ G   YER+ L +F NL+ L+      T   +P  N +++D   
Sbjct  2513  DSVVVKDAVVELHYNRDGSSCYERYPLCYFTNLEKLKFKEVCKTPTGIPEHNFLIYDTND  2572

Query  2548  KCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPME  2607
             + +E+ A+SA VYYSQ++C+P+LL+D  LV+ VGDS E+A+KM D+++N+F S F+V  +
Sbjct  2573  RGQENLARSACVYYSQVLCKPMLLVDVNLVTTVGDSREIAIKMLDSFINSFISLFSVSRD  2632

Query  2608  KLKTLVATAEAELAKNVSLDNVLSTFISAAR-QGFVDSDVETKDVVECLKLSHQSDIEVT  2666
             KL+ L+ TA   + +      VL TF  AAR    V+SDVET  VV+ L+ +H++DI++T
Sbjct  2633  KLEKLINTARDCVRRGDDFQTVLKTFTDAARGHAGVESDVETTMVVDALQYAHKNDIQLT  2692

Query  2667  GDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLR  2726
              +  NNY+  Y K +++   DLG  ID  A  +N    ++ N A +WN  D+M LS+  +
Sbjct  2693  TECYNNYVPGYIKPDSINTLDLGCLIDLKAASVNQTSMRNANGACVWNSGDYMKLSDSFK  2752

Query  2727  KQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVN---NWLKQLIKVTL-----  2778
             +QIR A +K N+PF+LT +  R   N+++ K +    KIV    +WL ++  +T+     
Sbjct  2753  RQIRIACRKCNIPFRLTTSKLRAADNILSVKFS--ATKIVGGAPSWLLRVRDLTVKGYCI  2810

Query  2779  --VFLF-VAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFD  2835
               +F+F VA + +   P + ++        I+ YK I+ G+ RDIA  D CFANK+  F 
Sbjct  2811  LTLFVFTVAVLSWFCLPSYSIATVNFNDDRILTYKVIENGIVRDIAPNDACFANKYGHFS  2870

Query  2836  TWFSQ-RGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGN  2894
              WF++  GG Y N   CP+  AVI    G  V  +P T L       + F+ RVF A  N
Sbjct  2871  KWFNENHGGVYRNSVDCPITIAVIAGVAGARVANVPAT-LAWVGRQIVLFVSRVF-ANTN  2928

Query  2895  ICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRY  2954
             +C+TP+  I Y  F+ S CVL++ECT+F+DA G   P+CYD  VL G+ +Y  ++P  RY
Sbjct  2929  VCFTPTNEIPYDTFSDSGCVLSSECTLFRDAEGNLNPFCYDPTVLPGASSYADMKPHVRY  2988

Query  2955  VLMDGSI-IQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRS  3013
              + D  + I+FP    E ++R+  T  ++YCR G+CE S AGVC+ST+G W L N  Y +
Sbjct  2989  DMYDSDMYIKFPEVIFESTLRITKTLATQYCRFGSCEESAAGVCISTNGSWALYNQNYST  3048

Query  3014  LPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGE  3073
              PG++CG D  +++  +   L QP+    +S S+  G ++ + +T   YY  + +RA  +
Sbjct  3049  RPGIYCGDDYFDIVRRLAVSLFQPVTYFQLSTSLAMGLVLCVFLTAAFYYINKVKRALAD  3108

Query  3074  YSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFT  3133
             Y+       +  L++   LC       L   Y+ +Y Y TFYLT + +F+ HI W VMF 
Sbjct  3109  YTQCAVVAVVAALLNSLCLCFIVANPLLVAPYTAMYYYATFYLTGEPAFIMHISWYVMFG  3168

Query  3134  PLVPFWITIAYIICISTKHFYWFFSNYLKRRV-VF-NGVSFSTFEEAALCTFLLNKEMYL  3191
              +VP W+  +Y + +  +H +W  + + K+ V VF +G    +F++AA   F++ K+ Y+
Sbjct  3169  TVVPIWMLASYTVGVMLRHLFWVLAYFSKKHVDVFTDGKLNCSFQDAASNIFVIGKDTYV  3228

Query  3192  KLRSDVLLPLTQ--YNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVL  3249
              LR+     +TQ  + RYL+L+NKYKY+SGAMDT SYREA   HL KAL  +S +GSD+L
Sbjct  3229  ALRN----AITQDSFVRYLSLFNKYKYYSGAMDTASYREACAAHLCKALQTYSETGSDIL  3284

Query  3250  YQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTS  3309
             YQPP  S+TS+VLQSG  KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C +
Sbjct  3285  YQPPNCSVTSSVLQSGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPA  3344

Query  3310  EDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF  3366
             + + +PNY+ LLI K+NH+F+VQ        LRV+ HSM   +LKL VD ANP TP Y F
Sbjct  3345  DQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTF  3404

Query  3367  VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMH  3426
               ++PG +FSVLACYNG P+GV+   +R N TIKGSFL GSCGSVG+  +   ++F YMH
Sbjct  3405  STVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMH  3464

Query  3427  HMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRF  3486
              MEL  G H G+  +G  YG F D+QT Q   TD   T+NV+AWLYAAV+NG +WF+   
Sbjct  3465  QMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPT  3524

Query  3487  TTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTIL  3545
                +  +N  A+   + E +    +D+L   + +TG++V  M A+++ L   G  G+TIL
Sbjct  3525  RVGIVTYNEWALSNQFTEFVGTQSIDML---AHRTGVSVEQMLAAIQSL-HAGFQGKTIL  3580

Query  3546  GSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFF  3605
             G + LEDEFTP DV  Q  GV  QS VKR   G  HWL+ T++ + + ++Q T+++++ +
Sbjct  3581  GQSTLEDEFTPDDVNMQVMGVVMQSGVKRISYGFMHWLMSTLVLAYVSVMQLTKFTMWTY  3640

Query  3606  LYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMP----ASWVM  3661
             L+E         +    A  M  VKHKH FL LFLLP    + Y N+VY P    +S ++
Sbjct  3641  LFETIPTQMTPLLFGFMACVMFTVKHKHTFLSLFLLPVALCLTYANIVYEPQTLVSSTLI  3700

Query  3662  RIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKV  3721
              +  WL      +    L D  +Y S   +L ++  R      +     L + +   Y  
Sbjct  3701  AVANWLTPTSVYMRTTHL-DFGLYISLSFVLAIIVRRLYRPSMSNLALALCSGVMWFYTY  3759

Query  3722  YYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIML  3781
               G+     I+    I ++TS+Y+  V   + LA+ I  +   Y P        ++ ++L
Sbjct  3760  VIGDH-SSPITYLMFITTLTSDYTITVFATVNLAKFISGLVFLYAPHLGFILPEVKLVLL  3818

Query  3782  VYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLN  3841
             +Y  LGY CT YFG+F LLN   R+ LGVYDY VSTQEFR++   GL  P+NS +A  LN
Sbjct  3819  IYLCLGYMCTMYFGVFSLLNLKLRVPLGVYDYSVSTQEFRFLTGNGLHAPRNSWEALILN  3878

Query  3842  IKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLA  3901
              KLLG+GG PCIKVATVQSK++D+KCTSVVLL+VLQQL +ES+SK W+ CV+LHN+IL A
Sbjct  3879  FKLLGIGGTPCIKVATVQSKLTDLKCTSVVLLTVLQQLHLESNSKAWSYCVKLHNEILAA  3938

Query  3902  KDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQ  3961
              D TEAFE+ V L + L+S    VD++ L  ++ +N + LQA  +EFS L +YA   TAQ
Sbjct  3939  VDPTEAFERFVCLFATLMSFSANVDLDALANDLFENSSVLQATLTEFSHLATYAELETAQ  3998

Query  3962  EAYEQAVANGD-SEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020
              +Y++A+ +GD S  VLK L+K++NVAK+ +++D A+ RKLE+MA+QAMT MYKQAR+ED
Sbjct  3999  SSYQKALNSGDASPQVLKALQKAVNVAKNAYEKDKAVARKLERMAEQAMTSMYKQARAED  4058

Query  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080
             K+AK+ SAMQTMLF M++KLDND LN +I NAR+GCVPL+I+PL  + KL VVIPD + +
Sbjct  4059  KKAKIVSAMQTMLFGMIKKLDNDVLNGVIANARNGCVPLSIVPLCASNKLRVVIPDISVW  4118

Query  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA-NSAVKL  4139
                 +  + +YA +LW++  + + D+++V+ +++ ++ + +L WPL++   RA +SAVKL
Sbjct  4119  NKVVNWPSVSYAGSLWDVTVINNVDNEVVKPTDV-VETNESLTWPLVIECSRASSSAVKL  4177

Query  4140  QNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKS  4199
             QNNE+ P  L+ M   AG  Q  C+  +A+AYY   +G R V+ LLS+   LKWA+    
Sbjct  4178  QNNEIHPKGLKTMVVTAGIDQVNCS-SSAVAYYEPVQGHRMVMGLLSENAHLKWAKVEGK  4236

Query  4200  DGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATE  4259
             D  G I  EL+PPC+F+   PKGP+++YLYF+K LNNL+RG +LG +AATVRLQAG  TE
Sbjct  4237  D--GFINIELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQLLGHIAATVRLQAGANTE  4294

Query  4260  VPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQE  4319
               +NSTVL+  AFAVD AKAY DY+ SGG P++N VKML   TGTG AI+V PEA  DQE
Sbjct  4295  FASNSTVLTLVAFAVDPAKAYLDYVGSGGTPLSNYVKMLAPKTGTGVAISVKPEATADQE  4354

Query  4320  SFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGY  4379
             ++GGAS CLYCR HI+HP+  G C  K ++VQIP     DPVGF LKN  C VC  W GY
Sbjct  4355  TYGGASVCLYCRAHIEHPDVSGVCKYKTRFVQIPAH-VRDPVGFLLKNVPCNVCQYWVGY  4413

Query  4380  GCSCDQLREPMLQSADAQSFLN  4401
             GC+CD LR   +  +   +FLN
Sbjct  4414  GCNCDALRNNTVPQSKDTNFLN  4435


 Score =  303 bits (777),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 225/771 (29%), Positives = 367/771 (48%), Gaps = 46/771 (6%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C E  A V  ++ K      +   VD G  +Y Y+++  +  +I   N     +  MP 
Sbjct  1352  ICTEYSANVKFLRTKGVDTTKKIQTVD-GVSYYLYSARDALTDVIAAANGC-PGICAMPF  1409

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L ++  Y+R +KVP    ++S + +   N  +  + +TPE  FI  ++  G 
Sbjct  1410  GYVTHGLDLAQSGNYVRQVKVPYVCLLASKEQIPIMNSDV--AIQTPETAFINNVTSNGG  1467

Query  1511  YKDWSY-SGQSTQLGI---EFLKRGDKSVYYTSNPTTFHLDGEVITFDNL---KTLLSLR  1563
             Y  W   SG      +   + L    +++ Y  N      +   + F +L   +  L+ R
Sbjct  1468  YHSWHLVSGDLIVKDVCYKKLLHWSGQTICYADNKFYVVKNDVALPFSDLEACRAYLTSR  1527

Query  1564  EVR--TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL  1621
               +   I+V  T+D +N  T +++ + T+ +Q G T+  G D++   P     G++ +V 
Sbjct  1528  AAQQVNIEVLVTIDGVNFRTVILNDATTFRKQLGATFYKGVDISDALPTVKMGGESLFVA  1587

Query  1622  PN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
              N  ++  V   EYY T+D +FL RY S     ++WK+   +G+ S+K ++ NCY+   +
Sbjct  1588  DNLSESEEVVLKEYYGTSDVTFLQRYYSLQPLVQQWKFVVHDGVKSLKLSNYNCYINATI  1647

Query  1681  LTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
             + +  + ++KF  PALQ+AY R + G+  +F ALI+AY + T     D  + +  L   A
Sbjct  1648  MMIDMLHDIKFVVPALQNAYLRYKGGDPYDFLALIMAYGDCTFDNPDDEAKLLHTLLAKA  1707

Query  1740  NLD-SCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV  1798
              L  S K V    C  CG +     G+ A +Y G  S E+ +      C CG    + LV
Sbjct  1708  ELTVSAKMVWREWCTVCGIRDIEYTGMRACVYAGVNSMEELQSVFNETCVCGSVKHRQLV  1767

Query  1799  QQESPFVMMSAPPAQYELKHGTFTCASEYTGNY------QCGHYKHITSKETL-YCIDGA  1851
             +  +P++++S      E+K  T T       N         GHY H+  K+ L Y  D  
Sbjct  1768  EHSTPWLLVSG---LNEVKVSTSTDPVYRAFNVFQGVETSVGHYVHVRVKDGLFYKYDSG  1824

Query  1852  LLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQP  1911
              LTK+S+ K  +T V+Y +  YT     V Y LDGV   E++P L NYY KD  Y+T +P
Sbjct  1825  SLTKTSDMKCKMTSVWYPKVRYTADCNVVVYDLDGVTKVEVNPDLSNYYMKDGKYYTSKP  1884

Query  1912  -IDLVPNQPYPNASFDNFKFV-CDNIKFADDL----NQLTGYK--KPASRELKVTFFPDL  1963
              I   P    P + + N   V  D    +D +    N L G+   KP S++L  +  P+ 
Sbjct  1885  TIKYSPATILPGSVYSNSCLVGVDGTPGSDTISKFFNDLLGFDETKPISKKLTYSLLPNE  1944

Query  1964  NGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSN  2023
             +GDV+  ++ +Y P +KKG  L  KPI+W  N   + A  KPN   +R L+   P+   N
Sbjct  1945  DGDVLLSEFNNYNPVYKKGVMLKGKPILWVNNGVCDSALNKPNRASLRQLYDVAPIVLDN  2004

Query  2024  SFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTE---VVGDIILKPA  2080
              + VL+   +Q +     E   PV E+V       + ++E   K      V G+      
Sbjct  2005  KYTVLQDNTSQLI-----EPNVPVVEDV---SITTRKLIEVKCKGLNKPFVKGNFSFVND  2056

Query  2081  NNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAV  2130
              N + + + +G T+L A YVD N+   + + N  S +  L T+ +  L  V
Sbjct  2057  PNGVTVVDTLGLTELRALYVDINTRYIVLRDNNWSSLFKLHTVESGDLQIV  2107


 Score =  171 bits (432),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 229/978 (23%), Positives = 411/978 (42%), Gaps = 100/978 (10%)

Query  8    FNEKT--HVQLSLPVLQVRDV---LVRGFGDSVEEVLSEARQHLKD-GTCGLVEVE-KGV  60
            +NEK   HV  ++P+    D+   L   F D  E   ++    LK+ G    V +  +  
Sbjct  21   YNEKRSDHVACTVPLCDTEDMASKLTPWFEDG-ETAFNQVSSILKEKGKILFVPMHMQRA  79

Query  61   LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETL-----GVLVPHVGEIP  115
            +  L  P V++           H +V  +A  + +       TL     G+  P+   + 
Sbjct  80   MKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDHVGAAMMRTTLNVKPLGMFFPYDSSLE  139

Query  116  VAYRKVLLRKNGNKGAGGHSYGADLKS---FDLGDELGTDPYEDFQENWNTKHSSGVTRE  172
                  LLRKNG  G        D K     ++ D+L  DP   + +N            
Sbjct  140  TGEHTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQN------------  187

Query  173  LMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSE-QLDF---IDTKRGV  228
            L+++L GG     VD   CG +G P+     ++A+ G    TL++ ++D    +D+ R +
Sbjct  188  LLKKLIGGDCIP-VDQYMCGKNGKPIADYAKIVAKEGLT--TLADIEVDVKSRMDSDRFI  244

Query  229  YCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQP--  286
                +  + + W   R    Y  QT F +    + D      P   F + S I  + P  
Sbjct  245  -VLNKKLYRVVWNVTRRNVPYSKQTAFTVVSVIQCDD-KESVPEHTFTIGSQILMVSPLK  302

Query  287  RVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGT  346
                K  +     + + Y   +  +   +  S  + C+ CG  +W TG+ ++     CG 
Sbjct  303  ATNNKNFNLKQRLLHTFYGKEAVQQPGYIYHSAYVDCNACGRGTWCTGNAIQGFACDCGA  362

Query  347  ENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGR--T  403
                 +    + G +P+NA+    CP  +N      H+ A+ ++    K  +  GG+  T
Sbjct  363  NYSANDVDLQSSGLVPKNALFLANCPCANNGAC--SHNAAQVYSILDGKACVEVGGKSFT  420

Query  404  IAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLE----ILQKEKV  459
            + FGG V++Y+GC +   Y+VPRA + +       +  G  G  D ++E     L+K + 
Sbjct  421  LTFGGVVYAYMGCCDGTMYFVPRAKSCVS-RIGDAIFTGCTGTWDKVVETANLFLEKAQH  479

Query  460  NINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN--FKVTKGKAK  517
            ++N    F L E   ++LA  S +TS F E        +++++ +   N  F VT G   
Sbjct  480  SLNFCQQFALTE---VVLAILSGTTSTFEELRDLCHNASYEKVRDHLVNHGFVVTIGDYI  536

Query  518  KGAWNIGE----QKSILSPLYAFA--SEAARVVRSI---FSRTLETAQN---SVRVLQKA  565
            + A NIG       +I +P  AF    E+ + V +I       L++A +   S  + +  
Sbjct  537  RDAINIGANGVCNATINAPFIAFTGLGESFKKVAAIPWKICSNLKSALDYYCSNIMFRVF  596

Query  566  AITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYE---  622
               I   ++ +   L+D    T        V  +Y    V++   +    + GTV     
Sbjct  597  PYDIPCDVNDFVELLLDCGKLT--------VATSYF---VLRYLDEKFDTVLGTVSNACQ  645

Query  623  -KLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKL  681
              L   L+      +    F+ D +++ K +            V  A+   + VQ    +
Sbjct  646  TALSSFLNACVAASRATAGFISDMFKLFKVLMHKLYVYTSCGYVAVAEHSSKIVQQVLDI  705

Query  682  VNKFLALCADSIIIGGAKLKALNL-GETFVTHSKGLYRKCVKSREET-----GLLMPLKA  735
            ++K + L   ++   G KL A+   G   +  + G Y  C+ ++ +T      L++P   
Sbjct  706  MSKAMKLLHTNVSWAGTKLSAIIYEGREALLFNSGTYF-CLSTKAKTLQDQMNLVLPGDY  764

Query  736  PKEIIFL-----EGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLML  790
             K+ + +       +T+     +  V +  G L    +PT+E   + +VG  V ++  + 
Sbjct  765  NKKTLGILDPVPNADTIDVTANSTVVDVVHGQL----EPTNEHGPSMIVGNYVLVSDKLF  820

Query  791  LEIKDTEKYCALAPNMMVTNNTFTLKGGAPT-KVTFGDDTVIEVQGYKSVNITFELDERI  849
            +   D E Y  L  N  V +  F LKGG P+ KVTFGD   +EV  Y+SV+IT+++   +
Sbjct  821  VRTDDEEFY-PLCINGKVVSTLFRLKGGMPSKKVTFGDVNTVEVTAYRSVSITYDIHPVL  879

Query  850  DKVL-NEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLF  908
            D +L + K + +TVE    V +F  V+ D V+  L P+       G D++++     Y++
Sbjct  880  DALLSSSKLATFTVEKDLLVEDFVDVIKDEVLTLLTPLLRGYDIDGFDVEDFIDVPCYVY  939

Query  909  DESGEFKLASHMYCSFYP  926
            ++ G+   +S+M  S  P
Sbjct  940  NQDGDCAWSSNMTFSINP  957


 Score =  128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 8/176 (5%)

Query  991   QDGSEDNQT-------TTIQTIVE-VQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKN  1042
             QD + +NQ         T +T VE VQP+ ++    + ++    S   +  + ++V +  
Sbjct  1117  QDEASENQVHQVPDLQCTSETKVEIVQPRQDLRPRRLRKSKVDLSKYKHTVINNSVTLVL  1176

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
              D ++ A  +   V+VNAAN +LKHGGG+AGA+NKA+   +Q ESD+YI+ +GPL VG S
Sbjct  1177  GDAIQIASLLPKCVLVNAANRHLKHGGGIAGAINKASGGDVQEESDEYISNSGPLHVGDS  1236

Query  1103  CVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADP  1158
              +L G+ LA   L VVGP+    ED  LLK  Y+ FN+H +++ PL+S+GIF  DP
Sbjct  1237  VLLKGYGLADAILRVVGPDARNNEDAALLKRCYKTFNKHTIVVTPLISSGIFSVDP  1292


> sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain 2) OX=76344 GN=rep PE=3 SV=1
Length=7124

 Score = 1837 bits (4757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1088/2929 (37%), Positives = 1617/2929 (55%), Gaps = 171/2929 (6%)

Query  1549  EVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIK  1608
             +V +   ++ LL+      + V  TVD +N  +  V     +G+  G  + DG +VTK++
Sbjct  1543  KVASVSQIRALLA----NKVDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVR  1598

Query  1609  PHNSHEGKTFYV---LPNDDTLRV-EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL  1664
                 H+GK F+    L   D + V +AF +    +P  L +Y + L   K W        
Sbjct  1599  CSAIHKGKVFFQYSGLSAADLVAVTDAFGF---DEPQLL-KYYNMLGMCK-WPVVVCGNY  1653

Query  1665  TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGE  1724
              + K ++NNCY+  A L LQ + LKF+    Q+A+   R+G+   F +L+LA  +    E
Sbjct  1654  FAFKQSNNNCYINVACLMLQHLSLKFHKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNE  1713

Query  1725  LGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ  1784
               D  + M  + + A+L         VCK CG +Q   KGV+AVM+ GTL      KG  
Sbjct  1714  PSDSTDFMRVVLREADLSGATCDFEFVCK-CGVKQEQRKGVDAVMHFGTLDKGDLAKGYT  1772

Query  1785  IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKET  1844
             I CTCG +   +  Q   PF++ S  P   +L       A+ +TG    GHY H+  K  
Sbjct  1773  IACTCGNKLV-HCTQLNVPFLICSNKPEGKKLPDDV-VAANIFTGG-SLGHYTHVKCKPK  1829

Query  1845  LYCIDGALLTKSSEYKGPITDVFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKD  1903
                 D   ++K SE KG  TD  Y +N   T + K  T+ LD V C E +P L  YY + 
Sbjct  1830  YQLYDACNVSKVSEAKGNFTDCLYLKNLKQTFSSKLTTFYLDDVKCVEYNPDLSQYYCES  1889

Query  1904  NSYFTEQPIDLVPNQPYPNAS--FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFF  1960
               Y+T +PI     + +      + NFK V  +I  A+  N   G+       E K+T +
Sbjct  1890  GKYYT-KPIIKAQFRTFEKVEGVYTNFKLVGHSI--AEKFNAKLGFDCNSPFTEYKITEW  1946

Query  1961  PDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWST  2016
             P   GDVV      Y   +  G     KP++W  H   +    TY  +P+  C    ++ 
Sbjct  1947  PTATGDVVLASDDLYVSRYSGGCVTFGKPVIWLGHEEASLKSLTYFNRPSVVC-ENKFNV  2005

Query  2017  KPVETSNSFD-------VLKSEDAQG---MDNLACEDLKPVSEEVVEN---------PTI  2057
              PV+ S   D       VL +    G       A E     S+ VV+             
Sbjct  2006  LPVDVSEPTDKGPVPAAVLVTGALSGAATAPGTAKEQKVCASDSVVDQVVSGFLSDLSGA  2065

Query  2058  QKDVLECNV----KTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNEL  2113
               DV E  +    K  +V   +++    +  K+ + +   D+   ++      +   NEL
Sbjct  2066  TVDVKEVKLNGVKKPIKVEDSVVVNDPTSETKVVKSLSIVDVYDMFLTGCRYVVWMANEL  2125

Query  2114  SRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNR----------  2163
             SR+             VNS    T+  Y K  + K+V     ++ R   +          
Sbjct  2126  SRL-------------VNS---PTVREYVKWGMTKIVIPAKLVLLRDEKQEFVAPKVVKA  2169

Query  2164  ---VCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220
                 C + + +FF        F    N+  K    T +A    K     C  A  N L++
Sbjct  2170  KVIACYSAVKWFFLYCFSWIKF----NTDNKVIYTTEVAS---KLTFNLCCLAFKNALQT  2222

Query  2221  PNFSKLIN--------IIIWF-------LLLSVCLGSLIYSTAALGVLMS----NLGMPS  2261
              N++ +           ++WF       +L    L ++ +    +G +++      G+ +
Sbjct  2223  FNWNVVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGFFPTFVGQIVAWVKTTFGIFT  2282

Query  2262  YCTGYR---EGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITIS---SFK  2315
              C  Y+    GY +S       +C GS+ C +C SG D LD Y ++  +Q  +    SF 
Sbjct  2283  LCDLYQVSDVGYRSS-------FCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRVSFD  2335

Query  2316  WDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLVQ  2373
             + ++ F LV E  + Y L+T  FY L     MQL  ++    F+  +  W     + +  
Sbjct  2336  Y-ISLFKLVVELVIGYSLYTVCFYPLFGLIGMQLLTTWLPEFFMLETMHWSARFFVFVAN  2394

Query  2374  MAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRS  2433
             M P   ++R YI   + Y ++    HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R 
Sbjct  2395  MLPAFTLLRFYIVVTAMYKIFCLCRHVMYGCSRPGCLFCYKRNRSVRVKCSTVVGGTLRY  2454

Query  2434  FYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDS  2493
             + V ANGG GFC  H WNC+NC  F  G+TFI+ E A DLS + KRP+NPTD + Y+V  
Sbjct  2455  YDVMANGGTGFCAKHQWNCLNCSAFGPGNTFITHEAAADLSKELKRPVNPTDSAYYLVTE  2514

Query  2494  VTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESS  2553
             V     S+ L++++ GQ+ Y+  S S FV+++ L  +  KG    +V+V + ++  +++ 
Sbjct  2515  VKQVGCSMRLFYERDGQRVYDDVSASLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAG  2572

Query  2554  AKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLV  2613
               +A+V+Y+Q + +P+LL+++ L++       V+  MFD YV++     +V  + L + V
Sbjct  2573  FLNAAVFYAQSLYRPMLLVEKKLITTANTGLSVSQTMFDLYVDSLLGVLDVDRKSLTSFV  2632

Query  2614  ATAEAELAKNVSLDNVLSTFISAARQG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNN  2672
               A   L + V L+ V+ TFI  AR+   +DSDVETK + + +  +  + ++ T +SCNN
Sbjct  2633  NAAHNSLKEGVQLEQVMDTFIGCARRKCAIDSDVETKSITKSIMSAVNAGVDFTDESCNN  2692

Query  2673  YMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSA  2732
              + TY K + +   DLG  I  +A+H+ A VAK+ N+A IW+V  F  LS  L+ ++R A
Sbjct  2693  LVPTYVKSDTIVAADLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKA  2752

Query  2733  AKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITP  2792
               K  L  KLT       V ++TT  +LKGG + +  L+ L  V L+   V    + + P
Sbjct  2753  CSKTGLKIKLTYNKQEANVPILTTPFSLKGGAVFSKVLQWLFVVNLICFIV---LWALMP  2809

Query  2793  VHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGG--SYTNDKA  2850
              + + K          +K ID GV RD+  TD CFANK   FD W+    G   Y N +A
Sbjct  2810  TYAVHKSDMQLPLYASFKVIDNGVLRDVTVTDACFANKFIQFDQWYESTFGLVYYRNSRA  2869

Query  2851  CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFAT  2910
             CP++ AVI +++G+ +  +P  +LR      LHF+   F+     CYTP   I Y +F  
Sbjct  2870  CPVVVAVIDQDIGYTLFNVPTKVLR-YGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYA  2928

Query  2911  SACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYL  2969
             S CVL++ CT+   A G P PYCY   ++  +  Y+SL P  RY L + +  I+FP    
Sbjct  2929  SGCVLSSLCTMLAHADGTPHPYCYTEGIMHNASLYDSLAPHVRYNLANSNGYIRFPEVVS  2988

Query  2970  EGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTN  3029
             EG VR+V T    YCR G CE +E GVC + +  WVLNN YYR++PG FCG +A +L+  
Sbjct  2989  EGIVRIVRTRSMTYCRVGLCEDAEEGVCFNFNSSWVLNNPYYRAMPGTFCGRNAFDLIHQ  3048

Query  3030  MFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSF  3089
             +   L++PI    ++AS VAG I+AI+V    YY ++ +RAFG+Y+ VV  N +++ ++F
Sbjct  3049  VLGGLVRPIDFFALTASSVAGAILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINF  3108

Query  3090  TVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIS  3149
              +L +  VY  L  +Y+  Y Y T Y  +++S + H+QW+VM+  ++P W  I Y+  + 
Sbjct  3109  LMLFVFQVYPTLSCLYACFYFYTTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVV  3168

Query  3150  TKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLA  3209
             + H  W FS    R++     S  TFEE +L TF++ KE Y KL++ V      +NRYL+
Sbjct  3169  SNHALWLFS--YCRKLGTEVRSDGTFEEMSLTTFMITKESYCKLKNSV--SDVAFNRYLS  3224

Query  3210  LYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRK  3268
             LYNKY+YFSG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S+T++ LQSG  K
Sbjct  3225  LYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVK  3284

Query  3269  MAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHN  3328
             M FP+ KVE C+V VT G  TLNGLWLDD VYCPRHVIC+S DM +P+Y +LL R  + +
Sbjct  3285  MVFPTSKVEPCVVSVTYGNMTLNGLWLDDKVYCPRHVICSSADMTDPDYSNLLCRVISSD  3344

Query  3329  FLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGV  3388
             F V +G + L V+ + MQ  +L L V   NP TPKY F  ++PG+TF+VLA YNG   G 
Sbjct  3345  FCVMSGRMSLTVMSYQMQGSLLVLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGKSQGA  3404

Query  3389  YQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPF  3448
             +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP+
Sbjct  3405  FHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPY  3464

Query  3449  VDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQD  3508
              D Q  Q    D T TVNV+AWLYAA++N   WF+   + +L +FN+ AM   +  +  D
Sbjct  3465  RDAQVVQLPVQDYTQTVNVVAWLYAAILNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKAD  3524

Query  3509  HVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTF  3568
              V  L  L++ TG+ V  + A++K L  +G  G+ ILGS +LEDE TP DV +Q +GV  
Sbjct  3525  LV--LDALASMTGVTVEQILAAIKRLY-SGFQGKQILGSCVLEDELTPSDVYQQLAGVKL  3581

Query  3569  QSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMF  3628
             QS   R +KGT  W+L + L    ++    +W++F ++  +  L   +  +   +FAM+ 
Sbjct  3582  QSKRTRVVKGTCCWILASTLLFCSIISAFVKWTMFMYVTTH-MLGVTLCALCFVSFAMLL  3640

Query  3629  VKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYAS  3687
             VKHKH +L +F++P L T+ Y N +V    S+      WL     ++  +   D V+Y  
Sbjct  3641  VKHKHLYLTMFIMPVLCTLFYTNYLVVYKQSFRGLAYAWLSHFVPAVD-YTYMDEVLY--  3697

Query  3688  AVVLLILM---TARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
              VVLL+ M   T R++  D    ++ +  +++LV   Y+G  L++ + ++  + S+   Y
Sbjct  3698  GVVLLVAMVFVTMRSINHDVFSVMFLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTY  3755

Query  3745  SGVVTTVMFLARG-IVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
             +   TT++ LA   ++   +    ++F     ++ ++L Y  +GY C CY+G+  LLN  
Sbjct  3756  TW--TTMLSLATAKVIAKWLAVNVLYFTDVPQVKLVLLSYLCIGYVCCCYWGVLSLLNSI  3813

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
             FR+ LGVY+Y +S QE RYMN+ GL PP+NS +A  LN KLLG+GG P I+V+ +QS+++
Sbjct  3814  FRMPLGVYNYKISVQELRYMNANGLRPPRNSFEALVLNFKLLGIGGVPVIEVSQIQSRLT  3873

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             DVKC +VVLL+ LQ L + SSSKLW  C  LHN+IL   D + AF+K+  LL VL +   
Sbjct  3874  DVKCVNVVLLNCLQHLHIASSSKLWQYCSTLHNEILATSDLSVAFDKLAQLLVVLFANPA  3933

Query  3924  AVD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVV  3976
             AVD      I ++ ++ + +   LQA+ SEF ++ S+  +  A++  ++A A+G + +  
Sbjct  3934  AVDSKCLASIEEVSDDYVRDSTVLQALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQ  3993

Query  3977  LKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTM  4036
             +K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M
Sbjct  3994  IKQLEKACNIAKSAYERDRAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSM  4053

Query  4037  LRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALW  4096
             +RKLDN ALN+I++NA  GCVPLN IP  T+  L +++PD   +    D    TYA  +W
Sbjct  4054  IRKLDNQALNSILDNAVKGCVPLNAIPSLTSNTLTIIVPDKQVFDQVVDNVYVTYAGNVW  4113

Query  4097  EIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSC  4154
              IQ + DAD  + QL+EI +    N+ WPL++ A R N  S+V LQNNEL P  LR    
Sbjct  4114  HIQSIQDADGAVKQLNEIDV----NITWPLVIAANRHNEVSSVVLQNNELMPQKLRTQVV  4169

Query  4155  AAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCR  4214
              +G+     T      YYNTT  G+ V A+LSD   LK+ +  K DG   +  EL+PPC+
Sbjct  4170  NSGSDMNCNTPTQ--CYYNTTGMGKIVYAILSDCDGLKYTKIVKEDGNCVV-LELDPPCK  4226

Query  4215  FVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAV  4274
             F     KG K+KYLYF+KG N L RG V+G+L++TVRLQAG ATE  +NS + S CAF+V
Sbjct  4227  FSVQDVKGLKIKYLYFVKGCNTLARGWVVGTLSSTVRLQAGTATEYASNSAIRSLCAFSV  4286

Query  4275  DAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHI  4334
             D  K Y DY+  GG P+TNCVKMLC H GTG AIT+ PEA  +Q+S+GGAS C+YCR  +
Sbjct  4287  DPKKTYLDYIQQGGAPVTNCVKMLCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRV  4346

Query  4335  DHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC  4383
             +HP+  G C L+GK+VQ+P     DPV + L + VC VCG W+   CSC
Sbjct  4347  EHPDVDGLCKLRGKFVQVPLG-IKDPVSYVLTHDVCQVCGFWRDGSCSC  4394


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 83/182 (46%), Gaps = 21/182 (12%)

Query  819  APTKVTFGDD-TVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVAD  877
            A  KV F D   V E+   + + I F LD   D VL++ CS + V+    ++E   VV D
Sbjct  832  AGKKVEFNDKPKVKEIPSTRKIKINFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLD  891

Query  878  AVIKTLQPVSE---LLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEG  934
            AV  TL P  E   + T +   L+  +    YLFDE GE  +A  MYCSF  PD++    
Sbjct  892  AVESTLSPCKEHDVIGTKVCALLNRLAEDYVYLFDEGGEEVIAPKMYCSFSAPDDE----  947

Query  935  DCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGS  994
            DC   +   + + +    DD           SAAL   + QEED +    Q  V + D  
Sbjct  948  DCVAADVVDADENQGDDADD-----------SAALV-TDTQEEDGV-AKGQVGVAESDAR  994

Query  995  ED  996
             D
Sbjct  995  LD  996


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 82/154 (53%), Gaps = 4/154 (3%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  ++V   V+VN AN  + HG GVAGA+ KA   +   E+ D +  
Sbjct  1267  ITPNVCFVKGDVIKVLRRVGAEVIVNPANGRMAHGAGVAGAIAKAAGKSFIKETADMVKN  1326

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQ---LLKSAYENFNQHEVLLAPLLS  1150
              G  +VG     +G NL K  L++VGP+  +G   Q    L+ AY++ N+ + ++  L+S
Sbjct  1327  QGVCQVGECYESTGGNLCKTVLNIVGPDA-RGHGKQCYSFLERAYQHINKCDDVVTTLIS  1385

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             AGIF      SL   +  V  NV L   +K+ +D
Sbjct  1386  AGIFSVPTDVSLTYLIGVVTKNVILVSNNKDDFD  1419


 Score = 40.8 bits (94),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 131/343 (38%), Gaps = 70/343 (20%)

Query  59   GVLPQLEQPYVFIKRSDARTAP---HGHVMVEL-VAELEGIQYGRSGETLGVLVPHVGEI  114
            GVLP+     +F +     T       HV  +L   + +G+  G +G  +G  VP V  I
Sbjct  120  GVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCLG-NGRFIGWFVP-VTAI  177

Query  115  PVAYRK-------VLLRKNGNKG---AGGHSYGADLKSFDLGDELGTDPYEDFQENWNTK  164
            P AY K       +LLRK GNKG   +G       +  +D   E   D  E+   N   K
Sbjct  178  P-AYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVE---DACEEVHLNPKGK  233

Query  165  HSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDT  224
            +S      L++   G     ++D   C   G   + ++D         CTL E  +    
Sbjct  234  YSRK-AYALLKGYRGVKSILFLDQYGCDYTGRLAKGLEDY------GDCTLEEMKELFP-  285

Query  225  KRGVYC-CREHEHEIAWYTERSEKS-YELQTPFEIKLAKKF-----DTFNGEC----PNF  273
               V+C   ++E  +AW+ +R  ++   LQT   I+          D  +G+     P  
Sbjct  286  ---VWCDSLDNEVVVAWHVDRDPRAVMRLQTLATIRSIGYVGQPTEDLVDGDVVVREPAH  342

Query  274  VFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQT  333
            +   N+I+K + PR+ +  L          Y  +S  E    C  T + CD    T +  
Sbjct  343  LLAANAIVKRL-PRLVETML----------YTDSSVTE---FCYKTKL-CDCGFITQFGY  387

Query  334  GDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNS  376
             D     C+F              G++P N +    CP C  S
Sbjct  388  VDCCGDACDF-------------RGWVPGNMMDGFLCPGCSKS  417


> sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus 
(strain JHM) OX=11144 GN=rep PE=1 SV=1
Length=7180

 Score = 1835 bits (4754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1072/2905 (37%), Positives = 1595/2905 (55%), Gaps = 151/2905 (5%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + V  TVD +N  +  V     +G+  G  + DG +VTK++    H+GK F+        
Sbjct  1610  VDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIHKGKVFFQYSGLSAA  1669

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              + A +     D   L +Y S L   K W         + K ++NNCY+  A L LQ + 
Sbjct  1670  DLAAVKDAFGFDEPQLLQYYSMLGMCK-WPVVVCGNYFAFKQSNNNCYINVACLMLQHLS  1728

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     +      R+G+   F +L+LA  +    E  D  + +    + A+L      
Sbjct  1729  LKFPKWQWRRPGNEFRSGKPLRFVSLVLAKGSFKFNEPSDSTDFIRVELREADLSGATCD  1788

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
             L  +CK CG +Q   KGV+AVM+ GTL      KG  I CTCG +   +  Q   PF++ 
Sbjct  1789  LEFICK-CGVKQEQRKGVDAVMHFGTLDKSGLVKGYNIACTCGDKLV-HCTQFNVPFLIC  1846

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  P   +L       A+ +TG    GHY H+  K      D   ++K SE KG  TD  
Sbjct  1847  SNTPEGKKLPDDV-VAANIFTGG-SVGHYTHVKCKPKYQLYDACNVSKVSEAKGNFTDCL  1904

Query  1868  YKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNAS--  1924
             Y +N   T +    TY LD V C    P L  YY +   Y+T +PI     + +      
Sbjct  1905  YLKNLKQTFSSVLTTYYLDDVKCVAYKPDLSQYYCESGKYYT-KPIIKAQFRTFEKVEGV  1963

Query  1925  FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK V  +I  A+ LN   G+       E K+T +P   GDVV      Y   +  G 
Sbjct  1964  YTNFKLVGHDI--AEKLNAKLGFDCNSPFMEYKITEWPTATGDVVLASDDLYVSRYSGGC  2021

Query  1984  KLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWSTKPVETSNSFD-------------  2026
                 KP++W  H   +    TY  +P+  C    ++  PV+ S   D             
Sbjct  2022  VTFGKPVIWRGHEEASLKSLTYFNRPSVVC-ENKFNVLPVDVSEPTDRRPVPSAVLVTGA  2080

Query  2027  -------VLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVG------  2073
                     + +E     +  AC     V +++V     +  V    VK  ++ G      
Sbjct  2081  ASGADASAISTEPGTAKEQKACAS-DSVEDQIVMEAQKKSSVTTVAVKEVKLNGVKKPVK  2139

Query  2074  ---DIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATH---GL  2127
                 +++    +  K+ + +   D+   ++      +   NELSR++   T+  +   G+
Sbjct  2140  WNCSVVVNDPTSETKVVKSLSIVDVYDMFLTGCRYVVWTANELSRLINSPTVREYVKWGM  2199

Query  2128  AAVNSVPWDTI--ANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRS  2185
             + +  +P + +   +  + F+   V     I        C   + +F         F   
Sbjct  2200  SKL-IIPANLLLLRDEKQEFVAPKVVKAKAIA-------CYGAVKWFLLYCFSWIKF---  2248

Query  2186  TNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLIN--------IIIWF--LL  2235
              N+  K    T +A    K   K C  A  N L++ N+S +           ++WF  L 
Sbjct  2249  -NTDNKVIYTTEVAS---KLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFNFLY  2304

Query  2236  LSVCLGSL---------IYSTAALGVLMSNLGMPSYCTGYRE---GYLNSTNVTIATYCT  2283
              +V L            ++    +  + +  G+ + C  Y+    GY +S       +C 
Sbjct  2305  ANVILSDFYLPNIGPLPMFVGQIVAWVKTTFGVLTICDFYQVTDLGYRSS-------FCN  2357

Query  2284  GSIPCSVCLSGLDSLDTYPSLETIQITIS---SFKWDLTAFGLVAEWFLAYILFTRFFYV  2340
             GS+ C +C SG D LD Y S+  +Q  +    SF + ++ F LV E  + Y L+T  FY 
Sbjct  2358  GSMVCELCFSGFDMLDNYESINVVQHVVDRRVSFDY-ISLFKLVVELVIGYSLYTVCFYP  2416

Query  2341  LGLAAIMQLFFSYFAVHFISNS--WLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYV  2398
             L +   MQL  ++    F+  +  W   L + +  M P   ++R YI   + Y V+    
Sbjct  2417  LFVLVGMQLLTTWLPEFFMLGTMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYCLCR  2476

Query  2399  HVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTF  2458
             HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R + V ANGG GFC  H WNC+NC+++
Sbjct  2477  HVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNCNSW  2536

Query  2459  CAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSL  2518
               G+TFI+ E A DLS + KRP+NPTD + Y V  V     S+ L++++ GQ+ Y+  S 
Sbjct  2537  KPGNTFITHEAAADLSKELKRPVNPTDSAYYSVIEVKQVGCSMRLFYERDGQRVYDDVSA  2596

Query  2519  SHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVS  2578
             S FV+++ L  +  KG    +V+V + ++  +++   +A+V+Y+Q + +P+L++++ L++
Sbjct  2597  SLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAGFLNAAVFYAQSLYRPMLMVEKKLIT  2654

Query  2579  DVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAAR  2638
                    V+  MFD YV +     +V  + L + V  A   L + V L+ V+ TF+  AR
Sbjct  2655  TANTGLSVSRTMFDLYVYSLLRHLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFVGCAR  2714

Query  2639  QG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSAR  2697
             +   +DSDVETK + + +  +  + +EVT +SCNN + TY K + +   DLG  I  +A+
Sbjct  2715  RKCAIDSDVETKSITKSVMAAVNAGVEVTDESCNNLVPTYVKSDTIVAADLGVLIQNNAK  2774

Query  2698  HINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTK  2757
             H+ + VAK+ N+A IW+V  F  LS  L+ ++R A  K  L  KLT       V ++TT 
Sbjct  2775  HVQSNVAKAANVACIWSVDAFNQLSADLQHRLRKACVKTGLKIKLTYNKQEANVPILTTP  2834

Query  2758  IALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVT  2817
              +LKGG + +  L+ L    L+   V    + + P + + K          +K ID GV 
Sbjct  2835  FSLKGGAVFSRVLQWLFVANLICFIV---LWALMPTYAVHKSDMQLPLYASFKVIDNGVL  2891

Query  2818  RDIASTDTCFANKHADFDTWFSQRGG--SYTNDKACPLIAAVITREVGFVVPGLPGTILR  2875
             RD++ TD CFANK   FD W+    G   Y N KACP++ AVI +++G  +  +P  +LR
Sbjct  2892  RDVSVTDACFANKFNQFDQWYESTFGLVYYRNSKACPVVVAVIDQDIGHTLFNVPTKVLR  2951

Query  2876  TTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYD  2935
                   LHF+   F+     CYTP   I Y +F  S CVL++ CT+   A G P PYCY 
Sbjct  2952  Y-GFHVLHFITHAFATDRVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGTPHPYCYT  3010

Query  2936  TNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEA  2994
               V+  +  Y SL P  RY L   +  I+FP    EG VRVV T    YCR G CE +E 
Sbjct  3011  EGVMHNASLYSSLVPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVGLCEEAEE  3070

Query  2995  GVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVA  3054
             G+C + +  WVLNN YYR++PG FCG +A +L+  +   L+QPI    ++AS VAG I+A
Sbjct  3071  GICFNFNSSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVQPIDFFALTASSVAGAILA  3130

Query  3055  IVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTF  3114
             I+V    YY ++ +RAFG+Y+ VV  N +++ ++F +L +  VY  L  +Y+  Y Y T 
Sbjct  3131  IIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYACFYFYTTL  3190

Query  3115  YLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFST  3174
             Y  +++S + H+QW+VM+  ++P W  I Y+  + + H  W FS    R++  +  S  T
Sbjct  3191  YFPSEISVVMHLQWLVMYGAIMPLWFCITYVAVVVSNHALWLFS--YCRKIGTDVRSDGT  3248

Query  3175  FEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL  3234
             FEE AL TF++ KE Y KL++ V      +NRYL+LYNKY+YFSG MDT +YREAAC  L
Sbjct  3249  FEEMALTTFMITKESYCKLKNSV--SDVAFNRYLSLYNKYRYFSGKMDTATYREAACSQL  3306

Query  3235  AKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGL  3293
             AKA+  F+ N+G+DVLYQPP  S+T++ LQSG  KM  P+ KVE C+V VT G  TLNGL
Sbjct  3307  AKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCVVSVTYGNMTLNGL  3366

Query  3294  WLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLK  3353
             WLDD VYCPRHVIC+S DM +P+Y +LL R ++ +F V +  + L V+ + MQ  +L L 
Sbjct  3367  WLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSDRMSLTVMSYQMQGSLLVLT  3426

Query  3354  VDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGF  3413
             V   NP TPKY F  ++PG+TF+VLA YNG P G +   MR + TIKGSFL GSCGSVG+
Sbjct  3427  VTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVVMRSSHTIKGSFLCGSCGSVGY  3486

Query  3414  NIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYA  3473
              +  D V F YMH +EL TG H GTD  GNFYGP+ D Q  Q    D T TVNV+AWLYA
Sbjct  3487  VLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAWLYA  3546

Query  3474  AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKE  3533
             A++N   WF+   + +L +FN+ AM   +  +  D V  L  L++ TG+ V  + A++K 
Sbjct  3547  AILNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV--LDALASMTGVTVEQVLAAIKR  3604

Query  3534  LLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLV  3593
              L +G  G+ ILGS +LEDE TP DV +Q +GV  QS   R IKGT  W+L +      +
Sbjct  3605  -LHSGFQGKQILGSCVLEDELTPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLFCSI  3663

Query  3594  LVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMV  3653
             +    +W++F ++  +  L   +  +    FAM+ +KHKH +L ++++P L T+ Y N +
Sbjct  3664  ISAFVKWTMFMYVTTH-MLGVTLCALCFVIFAMLLIKHKHLYLTMYIMPVLCTLFYTNYL  3722

Query  3654  YMPASWVMRIM--TWLDMVDTSLSGFKLKDCVMYASAVVLLILM---TARTVYDDGARRV  3708
              +      R +   WL     ++  +   D V+Y   VVLL+ M   T R++  D    +
Sbjct  3723  VVGYKQSFRGLAYAWLSYFVPAVD-YTYMDEVLY--GVVLLVAMVFVTMRSINHDVFSTM  3779

Query  3709  WTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARG-IVFMCVEYCP  3767
             + +  +++LV   Y+G  L++ + ++  + S+   Y+   TT++ LA   ++   +    
Sbjct  3780  FLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTYTW--TTMLSLATAKVIAKWLAVNV  3835

Query  3768  IFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQG  3827
             ++F     ++ ++L Y  +GY C CY+G+  LLN  FR+ LGVY+Y +S QE RYMN+ G
Sbjct  3836  LYFTDIPQIKLVLLSYLCIGYVCCCYWGVLSLLNSIFRMPLGVYNYKISVQELRYMNANG  3895

Query  3828  LLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKL  3887
             L PP+NS +A  LN KLLG+GG P I+V+ +QS+++DVKC +VVLL+ LQ L + S+SKL
Sbjct  3896  LRPPRNSFEALMLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSKL  3955

Query  3888  WAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVD------INKLCEEMLDNRATL  3941
             W  C  LHN+IL   D + AF+K+  LL VL +   AVD      I ++ ++ + +   L
Sbjct  3956  WQYCSTLHNEILATSDLSVAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTVL  4015

Query  3942  QAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVLKKLKKSLNVAKSEFDRDAAMQRK  4000
             QA+ SEF ++ S+  +  A++  ++A A+G + +  +K+L+K+ N+AKS ++RD A+ RK
Sbjct  4016  QALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVARK  4075

Query  4001  LEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLN  4060
             LE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+RKLDN ALN+I++NA  GCVPLN
Sbjct  4076  LERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPLN  4135

Query  4061  IIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSP  4120
              IP  T+  L +++PD   +    D    TYA  +W IQ + DAD  + QL+EI +    
Sbjct  4136  AIPPLTSNTLTIIVPDKQVFDQVVDNVYVTYAPNVWHIQSIQDADGAVKQLNEIDV----  4191

Query  4121  NLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGG  4178
             N  WPL+++A R N  S V LQNNEL P  LR     +G+      +     YYNTT  G
Sbjct  4192  NSTWPLVISANRHNEVSTVVLQNNELMPQKLRTQVVNSGSDMNC--NIPTQCYYNTTGTG  4249

Query  4179  RFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLN  4238
             + V A+LSD   LK+ +  K DG   +  EL+PPC+F     KG K+KYLYF+KG N L 
Sbjct  4250  KIVYAILSDCDGLKYTKIVKEDGNCVV-LELDPPCKFSVQDVKGLKIKYLYFVKGCNTLA  4308

Query  4239  RGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKML  4298
             RG V+G+L++TVRLQAG ATE  +NS +LS CAF+VD  K Y DY+  GG P+TNCVKML
Sbjct  4309  RGWVVGTLSSTVRLQAGTATEYASNSAILSLCAFSVDPKKTYLDYIQQGGVPVTNCVKML  4368

Query  4299  CTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCAN  4358
             C H GTG AIT+ PEA  +Q+S+GGAS C+YCR  ++HP+  G C L+GK+VQ+P     
Sbjct  4369  CDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLG-IK  4427

Query  4359  DPVGFTLKNTVCTVCGMWKGYGCSC  4383
             DPV + L + VC VCG W+   CSC
Sbjct  4428  DPVSYVLTHDVCQVCGFWRDGSCSC  4452


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 236/1025 (23%), Positives = 393/1025 (38%), Gaps = 219/1025 (21%)

Query  2    ESLVPGFNEKTHVQLS---LPVLQ-------VRDVLVRGFGDSVEEVLSEARQHLKDGTC  51
            E  V G     HV++    LP L+       +RD+ V    +  ++V +     L+ G+ 
Sbjct  46   EPKVKGKTLVNHVRVDCSRLPALECCVQSAIIRDIFV---DEDPQKVEASTMMALQFGSA  102

Query  52   GLVEVEK----------GVLPQLEQPYVFIKRSDARTAP---HGHVMVEL-VAELEGIQY  97
             LV+  K          GVLP+     +F +     T       HV  +L   + +G+  
Sbjct  103  VLVKPSKRLSVQAWAKLGVLPKTPAMGLFKRFCLCNTRECVCDAHVAFQLFTVQPDGVCL  162

Query  98   GRSGETLGVLVPHVGEIPVAYRK------VLLRKNGNKGA---GGHSYGADLKSFDLGDE  148
            G +G  +G  VP V  IP   ++      +LLRK GNKG+   G       +  +D   E
Sbjct  163  G-NGRFIGWFVP-VTAIPEYAKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVE  220

Query  149  LGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARA  208
               D  E+   N   K+S      L+R   G     +VD   C   G    C+   L   
Sbjct  221  ---DACEEVHLNPRGKYSCK-AYALLRGYRGVKPILFVDQYGCDYTG----CLAKGLEDY  272

Query  209  GKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKS-YELQTPFEIKLAKKF----  263
            G    TLSE  +     R      ++E  +AW+ +R  ++   LQT   ++  +      
Sbjct  273  GDL--TLSEMKELSPVWRDSL---DNEVVVAWHVDRDPRAVMRLQTLATVRSIEYVGQPI  327

Query  264  -DTFNGEC----PNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLS  318
             D  +G+     P  +   N+I+K + PR+ +  L              + +   + C  
Sbjct  328  EDMVDGDVVMREPAHLLAPNAIVKRL-PRLVETML-------------YTDSSVTEFCYK  373

Query  319  TLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPAC-----  373
            T + CD CG  + Q G +V    + CG            G++P N +    CP C     
Sbjct  374  TKL-CD-CGFIT-QFG-YVDCCGDTCGFR----------GWVPGNMMDGFPCPGCCKSYM  419

Query  374  ------HNSEVGPEHSL--AEYHNESGLKTILRKGGRTIAFGGCVF--SYVGCHNKCAYW  423
                   +S V PE  +   +  +    ++    G   + FGG  +   Y G       W
Sbjct  420  PWELEAQSSGVIPEGGVLFTQSTDTVNRESFKLYGHAVVPFGGAAYWSPYPG------MW  473

Query  424  VPRASANIGC----NHTGVVG-EGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILA  478
            +P   +++       +TGVVG +      D +   L  + V  +  G+    E+ AI+  
Sbjct  474  LPVIWSSVKSYSYLTYTGVVGCKAIVQETDAICRFLYMDYVQ-HKCGNL---EQRAIL--  527

Query  479  SFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFAS  538
                          GLD    +Q++ + G++ +                 +L  +  F  
Sbjct  528  --------------GLDDVYHRQLLVNRGDYSL-----------------LLENVDLFVK  556

Query  539  EAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDA-MMFTSDLATNNLVV  597
                  R+ F+    T  + +  L      +LDG+   S  LI +   FTS +   +  V
Sbjct  557  R-----RAEFACKFATCGDGLVPL------LLDGLVPRSYYLIKSGQAFTSLMVNFSREV  605

Query  598  ------MAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRD------G  645
                  MA +    V++ ++++  + G V  + K +   +  K  E  +   D      G
Sbjct  606  VDMCMDMALLFMHDVKVATKYVKKVTGKVAVRFKALGIAVVRKITEWFDLAVDTAASAAG  665

Query  646  WEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNL  705
            W   + ++      V   ++T  +E+ E V+ F      F  +  DS+ +      ++  
Sbjct  666  WLCYQLVN--GLFAVANGVITFIQEVPELVKNFVDKFKTFFKVLIDSMSV------SILS  717

Query  706  GETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVL---TEEVVLKTGD  762
            G T V  +    R C+             A  ++  +  ++LP  ++     E     G+
Sbjct  718  GLTVVKTASN--RVCL-------------AGSKVYEVVQKSLPAYIMPVGCSEATCLVGE  762

Query  763  LQP--LEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK-YCALAPN----MMVTNNTFTL  815
            ++P   E    + V+APL     C       +I   +K Y A   +    ++V N+T  +
Sbjct  763  IEPAVFEDDVVDVVKAPLTYQGCCKPPSSFEKICIVDKLYMAKCGDQFYPVVVDNDTVGV  822

Query  816  KGG------APTKVTFGDD-TVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEV  868
                     A  KV F D   V EV   + + I F LD   D VL++ CS + V+    +
Sbjct  823  LDQCWRFPCAGKKVVFNDKPKVKEVPSTRKIKIIFALDATFDSVLSKACSEFEVDKDVTL  882

Query  869  NEFACVVADAVIKTLQPVSE---LLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFY  925
            +E   VV DAV  TL P  E   + T +   L+       YLFDE GE  +AS MYCSF 
Sbjct  883  DELLDVVLDAVESTLSPCKEHGVIGTKVCALLERLVDDYVYLFDEGGEEVIASRMYCSFS  942

Query  926  PPDED  930
             PDED
Sbjct  943  APDED  947


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 82/153 (54%), Gaps = 2/153 (1%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  ++V   V+VN AN  + HG GVAGA+ KA   A   E+ D +  
Sbjct  1319  ITPNVCFVKGDVIKVLRRVGAEVIVNPANGRMAHGAGVAGAIAKAAGKAFINETADMVKA  1378

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNV--NKGEDIQLLKSAYENFNQHEVLLAPLLSA  1151
              G  +VGG    +G  L K  L++VGP+   +  E   LL+ AY++ N+ + ++  L+SA
Sbjct  1379  QGVCQVGGCYESTGGKLCKKVLNIVGPDARGHGNECYSLLERAYQHINKCDNVVTTLISA  1438

Query  1152  GIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             GIF      SL   +  V  NV L   +++ +D
Sbjct  1439  GIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFD  1471


 Score = 40.0 bits (92),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 86/217 (40%), Gaps = 33/217 (15%)

Query  1596  PTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLR-VEAFEYYHTTDPSFLGRYMSALNHTK  1654
             P  ++  D+ K++     E +T    P D T   V AF+  ++   S      S   H K
Sbjct  1047  PDQVEAFDIEKVEDSILSELQTELNAPADKTYEDVLAFDAIYSETLSAFYAVPSDETHFK  1106

Query  1655  KWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALI  1714
                   V G  S      NC+L + L+ +Q + L+F    +Q  +   +AG    F   +
Sbjct  1107  ------VCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDLGMQKLWLSYKAGYDQCFVDKL  1160

Query  1715  LAYCNKTV-----GELGDVRETMSYLFQHANLDSC--KRVLNVVCKTCGQQQTTLKGVEA  1767
             +    K++     G + D     +Y F    L  C  K   N  C  CG  +  L+G++A
Sbjct  1161  VKSAPKSIILPQGGYVAD----FAYFF----LSQCSFKVHANWRCLKCG-MELKLQGLDA  1211

Query  1768  VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPF  1804
             V + G +        V   C CG   T  L+  + P+
Sbjct  1212  VFFYGDV--------VSHMCKCGNSMT--LLSADIPY  1238


> sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus 
133/2005 OX=389230 GN=rep PE=3 SV=1
Length=7126

 Score = 1833 bits (4748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 955/2182 (44%), Positives = 1372/2182 (63%), Gaps = 55/2182 (3%)

Query  2255  SNLGMPSYCTGYREGYLNSTNVTIATYCTG-SIPCSVCLSGLDSLDTYPSLETIQITISS  2313
             S LG+ + C G    Y N T+  +  +C+  S+ C  CL G DSL  Y +L+ +Q  I+S
Sbjct  2274  SYLGIRTLCDGLAVEYRN-TSFDVVDFCSNRSVLCQWCLIGQDSLTRYSALQMLQTHITS  2332

Query  2314  FKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFA--VHFISNSWLMWLIINL  2371
             +  ++       E+FLAY+L+T  F VL L    Q FF+Y +  V++ + ++++  +  L
Sbjct  2333  YVLNIDWIWFALEFFLAYVLYTSSFNVLLLVVTAQYFFAYTSAFVNWRAYNYIVSGLFFL  2392

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
             V   P+  +VR+Y F A  +++ K Y HV++GC  + C++CYKRNR TRVE +TIV G +
Sbjct  2393  VTHIPLHGLVRVYNFLACLWFLRKFYSHVINGCKDTACLLCYKRNRLTRVEASTIVCGTK  2452

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R+FY+ ANGG  +C  HNWNCV CDT   G+TFI  EVA DL+   +R I PTDQS Y V
Sbjct  2453  RTFYIAANGGTSYCCKHNWNCVECDTAGVGNTFICTEVANDLTTTLRRLIKPTDQSHYYV  2512

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRAN---NTKGSLP-INVIVFDGKS  2547
             DSV VK+  + L++++ G   YER+ L +F NL+ L+      T   +P  N +++D   
Sbjct  2513  DSVVVKDAVVELHYNRDGSSCYERYPLCYFTNLEKLKFKEVCKTPTGIPEHNFLIYDTND  2572

Query  2548  KCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPME  2607
             + +E+ A+SA VYYSQ++C+P+LL+D  LV+ VGDS E+A+KM D+++N+F S F+V  +
Sbjct  2573  RGQENLARSACVYYSQVLCKPMLLVDVNLVTTVGDSREIAIKMLDSFINSFISLFSVSRD  2632

Query  2608  KLKTLVATAEAELAKNVSLDNVLSTFISAAR-QGFVDSDVETKDVVECLKLSHQSDIEVT  2666
             KL+ L+ TA   + +      VL TF  AAR    V+SDVET  VV+ L+ +H++DI++T
Sbjct  2633  KLEKLINTARDCVRRGDDFQTVLKTFTDAARGHAGVESDVETTMVVDALQYAHKNDIQLT  2692

Query  2667  GDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLR  2726
              +  NNY+  Y K +++   DLG  ID  A  +N    ++ N A +WN  D+M LS+  +
Sbjct  2693  TECYNNYVPGYIKPDSINTLDLGCLIDLKAASVNQTSMRNANGACVWNSGDYMKLSDSFK  2752

Query  2727  KQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVN---NWLKQLIKVTL-----  2778
             +QIR A +K N+PF+LT +  R   N+++ K +    KIV    +WL ++  +T+     
Sbjct  2753  RQIRIACRKCNIPFRLTTSKLRAADNILSVKFS--ATKIVGGAPSWLLRVRDLTVKGYCI  2810

Query  2779  --VFLF-VAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFD  2835
               +F+F VA + +   P + ++        I+ YK I+ G+ RDIA  D CFANK+  F 
Sbjct  2811  LTLFVFTVAVLSWFCLPSYSIATVNFNDDRILTYKVIENGIVRDIAPNDACFANKYGHFS  2870

Query  2836  TWFSQ-RGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGN  2894
              WF++  GG Y N   CP+  AVI    G  V  +P T L       + F+ RVF A  N
Sbjct  2871  KWFNENHGGVYRNSVDCPITIAVIAGVAGARVANVPAT-LAWVGRQIVLFVSRVF-ANTN  2928

Query  2895  ICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRY  2954
             +C+TP+  I Y  F+ S CVL++ECT+F+DA G   P+CYD  VL G+ +Y  ++P  RY
Sbjct  2929  VCFTPTNEIPYDTFSDSGCVLSSECTLFRDAEGNLNPFCYDPTVLPGASSYADMKPHVRY  2988

Query  2955  VLMDGSI-IQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRS  3013
              + D  + I+FP    E ++R+  T  ++YCR G+CE S AGVC+ST+G W L N  Y +
Sbjct  2989  DMYDSDMYIKFPEVIFESTLRITKTLATQYCRFGSCEESAAGVCISTNGSWALYNQNYST  3048

Query  3014  LPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGE  3073
              PG++CG D  +++  +   L QP+    +S S+  G ++ + +T   YY  + +RA  +
Sbjct  3049  RPGIYCGDDYFDIVRRLAVSLFQPVTYFQLSTSLAMGLVLCVFLTAAFYYINKVKRALAD  3108

Query  3074  YSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFT  3133
             Y+       +  L++   LC       L   Y+ +Y Y TFYLT + +F+ HI W VMF 
Sbjct  3109  YTQCAVVAVVAALLNSLCLCFIVANPLLVAPYTAMYYYATFYLTGEPAFIMHISWYVMFG  3168

Query  3134  PLVPFWITIAYIICISTKHFYWFFSNYLKRRV-VF-NGVSFSTFEEAALCTFLLNKEMYL  3191
              +VP W+  +Y + +  +H +W  + + K+ V VF +G    +F++AA   F++ K+ Y+
Sbjct  3169  TVVPIWMLASYTVGVMLRHLFWVLAYFSKKHVDVFTDGKLNCSFQDAASNIFVIGKDTYV  3228

Query  3192  KLRSDVLLPLTQ--YNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVL  3249
              LR+     +TQ  + RYL+L+NKYKY+SGAMDT SYREA   HL KAL  +S +GSD+L
Sbjct  3229  ALRN----AITQDSFVRYLSLFNKYKYYSGAMDTASYREACAAHLCKALQTYSETGSDIL  3284

Query  3250  YQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTS  3309
             YQPP  S+TS+VLQSG  KM+ PSG VE C+VQVTCG+ TLNGLWLD+ V+CPRH++C +
Sbjct  3285  YQPPNCSVTSSVLQSGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPA  3344

Query  3310  EDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF  3366
             + + +PNY+ LLI K+NH+F+VQ        LRV+ HSM   +LKL VD ANP TP Y F
Sbjct  3345  DQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTF  3404

Query  3367  VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMH  3426
               ++PG +FSVLACYNG P+GV+   +R N TIKGSFL GSCGSVG+  +   ++F YMH
Sbjct  3405  STVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVLNFVYMH  3464

Query  3427  HMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRF  3486
              MEL  G H G+  +G  YG F D+QT Q   TD   T+NV+AWLYAAV+NG +WF+   
Sbjct  3465  QMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPT  3524

Query  3487  TTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTIL  3545
                +  +N  A+   + E +    +D+L   + +TG++V  M A+++ L   G  G+TIL
Sbjct  3525  RVGIVTYNEWALSNQFTEFVGTQSIDML---AHRTGVSVEQMLAAIQSL-HAGFQGKTIL  3580

Query  3546  GSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFF  3605
             G + LEDEFTP DV  Q  GV  QS VKR   G  HWL+ T++ + + ++Q T+++++ +
Sbjct  3581  GQSTLEDEFTPDDVNMQVMGVVMQSGVKRISYGFMHWLMSTLVLAYVSVMQLTKFTMWTY  3640

Query  3606  LYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMP----ASWVM  3661
             L+E         +    A  M  VKHKH FL LFLLP    + Y N+VY P    +S ++
Sbjct  3641  LFETIPTQMTPLLFGFMACVMFTVKHKHTFLSLFLLPVALCLTYANIVYEPQTLVSSTLI  3700

Query  3662  RIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKV  3721
              +  WL      +    L D  +Y S   +L ++  R      +     L + +   Y  
Sbjct  3701  AVANWLTPTSVYMRTTHL-DFGLYISLSFVLAIIVRRLYRPSMSNLALALCSGVMWFYTY  3759

Query  3722  YYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIML  3781
               G+     I+    I ++TS+Y+  V   + LA+ I  +   Y P        ++ ++L
Sbjct  3760  VIGDH-SSPITYLMFITTLTSDYTITVFATVNLAKFISGLVFLYAPHLGFILPEVKLVLL  3818

Query  3782  VYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLN  3841
             +Y  LGY CT YFG+F LLN   R+ LGVYDY VSTQEFR++   GL  P+NS +A  LN
Sbjct  3819  IYLCLGYMCTMYFGVFSLLNLKLRVPLGVYDYSVSTQEFRFLTGNGLHAPRNSWEALILN  3878

Query  3842  IKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLA  3901
              KLLG+GG PCIKVATVQSK++D+KCTSVVLL+VLQQL +ES+SK W+ CV+LHN+IL A
Sbjct  3879  FKLLGIGGTPCIKVATVQSKLTDLKCTSVVLLTVLQQLHLESNSKAWSYCVKLHNEILAA  3938

Query  3902  KDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQ  3961
              D TEAFE+ V L + L+S    VD++ L  ++ +N + LQA  +EFS L +YA   TAQ
Sbjct  3939  VDPTEAFERFVCLFATLMSFSANVDLDALANDLFENSSVLQATLTEFSHLATYAELETAQ  3998

Query  3962  EAYEQAVANGD-SEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020
              +Y++A+ +GD S  VLK L+K++NVAK+ +++D A+ RKLE+MA+QAMT MYKQAR+ED
Sbjct  3999  SSYQKALNSGDASPQVLKALQKAVNVAKNAYEKDKAVARKLERMAEQAMTSMYKQARAED  4058

Query  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080
             K+AK+ SAMQTMLF M++KLDND LN +I NAR+GCVPL+I+PL  + KL VVIPD + +
Sbjct  4059  KKAKIVSAMQTMLFGMIKKLDNDVLNGVIANARNGCVPLSIVPLCASNKLRVVIPDISVW  4118

Query  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA-NSAVKL  4139
                 +  + +YA +LW++  + + D+++V+ +++ ++ + +L WPL++   RA +SAVKL
Sbjct  4119  NKVVNWPSVSYAGSLWDVTVINNVDNEVVKPTDV-VETNESLTWPLVIECSRASSSAVKL  4177

Query  4140  QNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKS  4199
             QNNE+ P  L+ M   AG  Q  C+  +A+AYY   +G R V+ LLS+   LKWA+    
Sbjct  4178  QNNEIHPKGLKTMVVTAGIDQVNCS-SSAVAYYEPVQGHRMVMGLLSENAHLKWAKVEGK  4236

Query  4200  DGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATE  4259
             D  G I  EL+PPC+F+   PKGP+++YLYF+K LNNL+RG +LG +AATVRLQAG  TE
Sbjct  4237  D--GFINIELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQLLGHIAATVRLQAGANTE  4294

Query  4260  VPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQE  4319
               +NSTVL+  AFAVD AKAY DY+ SGG P++N VKML   TGTG AI+V PEA  DQE
Sbjct  4295  FASNSTVLTLVAFAVDPAKAYLDYVGSGGTPLSNYVKMLAPKTGTGVAISVKPEATADQE  4354

Query  4320  SFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGY  4379
             ++GGAS CLYCR HI+HP+  G C  K ++VQIP     DPVGF LKN  C VC  W GY
Sbjct  4355  TYGGASVCLYCRAHIEHPDVSGVCKYKTRFVQIPAH-VRDPVGFLLKNVPCNVCQYWVGY  4413

Query  4380  GCSCDQLREPMLQSADAQSFLN  4401
             GC+CD LR   +  +   +FLN
Sbjct  4414  GCNCDALRNNTVPQSKDTNFLN  4435


 Score =  303 bits (775),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 225/771 (29%), Positives = 367/771 (48%), Gaps = 46/771 (6%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C E  A V  ++ K      +   VD G  +Y Y+++  +  +I   N     +  MP 
Sbjct  1352  ICTEYSANVKFLRTKGVDTTKKIQTVD-GVSYYLYSARDALTDVIAAANGC-PGICAMPF  1409

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L ++  Y+R +KVP    ++S + +   N  +  + +TPE  FI  ++  G 
Sbjct  1410  GYVTHGLDLAQSGNYVRQVKVPYVCLLASKEQIPIMNSDV--AIQTPETAFINNVTSNGG  1467

Query  1511  YKDWSY-SGQSTQLGI---EFLKRGDKSVYYTSNPTTFHLDGEVITFDNL---KTLLSLR  1563
             Y  W   SG      +   + L    +++ Y  N      +   + F +L   +  L+ R
Sbjct  1468  YHSWHLVSGDLIVKDVCYKKLLHWSGQTICYADNKFYVVKNDVALPFSDLEACRAYLTSR  1527

Query  1564  EVR--TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL  1621
               +   I+V  T+D +N  T +++ + T+ +Q G T+  G D++   P     G++ +V 
Sbjct  1528  AAQQVNIEVLVTIDGVNFRTVILNDATTFRKQLGATFYKGVDISDALPTVKMGGESLFVA  1587

Query  1622  PN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
              N  ++  V   EYY T+D +FL RY S     ++WK+   +G+ S+K ++ NCY+   +
Sbjct  1588  DNLSESEEVVLKEYYGTSDVTFLQRYYSLQPLVQQWKFVVHDGVKSLKLSNYNCYINATI  1647

Query  1681  LTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
             + +  + ++KF  PALQ+AY R + G+  +F ALI+AY + T     D  + +  L   A
Sbjct  1648  MMIDMLHDIKFVVPALQNAYLRYKGGDPYDFLALIMAYGDCTFDNPDDEAKLLHTLLAKA  1707

Query  1740  NLD-SCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV  1798
              L  S K V    C  CG +     G+ A +Y G  S E+ +      C CG    + LV
Sbjct  1708  ELTVSAKMVWREWCTVCGIRDIEYTGMRACVYAGVNSMEELQSVFNETCVCGSVKHRQLV  1767

Query  1799  QQESPFVMMSAPPAQYELKHGTFTCASEYTGNY------QCGHYKHITSKETL-YCIDGA  1851
             +  +P++++S      E+K  T T       N         GHY H+  K+ L Y  D  
Sbjct  1768  EHSTPWLLVSG---LNEVKVSTSTDPVYRAFNVFQGVETSVGHYVHVRVKDGLFYKYDSG  1824

Query  1852  LLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQP  1911
              LTK+S+ K  +T V+Y +  YT     V Y LDGV   E++P L NYY KD  Y+T +P
Sbjct  1825  SLTKTSDMKCKMTSVWYPKVRYTADCNVVVYDLDGVTKVEVNPDLSNYYMKDGKYYTSKP  1884

Query  1912  -IDLVPNQPYPNASFDNFKFV-CDNIKFADDL----NQLTGYK--KPASRELKVTFFPDL  1963
              I   P    P + + N   V  D    +D +    N L G+   KP S++L  +  P+ 
Sbjct  1885  TIKYSPATILPGSVYSNSCLVGVDGTPGSDTISKFFNDLLGFDETKPISKKLTYSLLPNE  1944

Query  1964  NGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSN  2023
             +GDV+  ++ +Y P +KKG  L  KPI+W  N   + A  KPN   +R L+   P+   N
Sbjct  1945  DGDVLLSEFNNYNPVYKKGVMLKGKPILWVNNGVCDSALNKPNRASLRQLYDVAPIVLDN  2004

Query  2024  SFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTE---VVGDIILKPA  2080
              + VL+   +Q +     E   PV E+V       + ++E   K      V G+      
Sbjct  2005  KYTVLQDNTSQLI-----EPNVPVVEDV---SITTRKLIEVKCKGLNKPFVKGNFSFVND  2056

Query  2081  NNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAV  2130
              N + + + +G T+L A YVD N+   + + N  S +  L T+ +  L  V
Sbjct  2057  PNGVTVVDTLGLTELRALYVDINTRYIVLRDNNWSSLFKLHTVESGDLQIV  2107


 Score =  172 bits (436),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 228/972 (23%), Positives = 407/972 (42%), Gaps = 88/972 (9%)

Query  8    FNEKT--HVQLSLPVLQVRDV---LVRGFGDSVEEVLSEARQHLKD-GTCGLVEVE-KGV  60
            +NEK   HV  ++P+    D+   L   F D  E   ++    LK+ G    V +  +  
Sbjct  21   YNEKRSDHVACTVPLCDTEDMASKLTPWFEDG-ETAFNQVSSILKEKGKILFVPMHMQRA  79

Query  61   LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETL-----GVLVPHVGEIP  115
            +  L  P V++           H +V  +A  + +       TL     G+  P+   + 
Sbjct  80   MKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDHVGAAMMRTTLNVKPLGMFFPYDSSLE  139

Query  116  VAYRKVLLRKNGNKGAGGHSYGADLKS---FDLGDELGTDPYEDFQENWNTKHSSGVTRE  172
                  LLRKNG  G        D K     ++ D+L  DP   + +N            
Sbjct  140  TGEHTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQN------------  187

Query  173  LMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSE-QLDF---IDTKRGV  228
            L+++L GG     VD   CG +G P+     ++A+ G    TL++ ++D    +D+ R +
Sbjct  188  LLKKLIGGDCIP-VDQYMCGKNGKPIADYAKIVAKEGLT--TLADIEVDVKSRMDSDRFI  244

Query  229  YCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQP--  286
                +  + + W   R    Y  QT F +    + D      P   F + S I  + P  
Sbjct  245  -VLNKKLYRVVWNVTRRNVPYSKQTAFTVVSVIQCDD-KESVPEHTFTIGSQILMVSPLK  302

Query  287  RVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGT  346
                K  +     + + Y   +  +   +  S  + C+ CG  +W TG+ ++     CG 
Sbjct  303  ATNNKNFNLKQRLLHTFYGKEAVQQPGYIYHSAYVDCNACGRGTWCTGNAIQGFACDCGA  362

Query  347  ENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGR--T  403
                 +    + G +P+NA+    CP  +N      H+ A+ ++    K  +  GG+  T
Sbjct  363  NYSANDVDLQSSGLVPKNALFLANCPCANNGAC--SHNAAQVYSILDGKACVEVGGKSFT  420

Query  404  IAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLE----ILQKEKV  459
            + FGG V++Y+GC +   Y+VPRA + +       +  G  G  D ++E     L+K + 
Sbjct  421  LTFGGVVYAYMGCCDGTMYFVPRAKSCVS-RIGDAIFTGCTGTWDKVVETANLFLEKAQH  479

Query  460  NINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN--FKVTKGKAK  517
            ++N    F L E   ++LA  S +TS F E        +++++ +   N  F VT G   
Sbjct  480  SLNFCQQFALTE---VVLAILSGTTSTFEELRDLCHNASYEKVRDHLVNHGFVVTIGDYI  536

Query  518  KGAWNIGE----QKSILSPLYAFA--SEAARVVRSIFSRTLETAQNSVRVLQKAAITILD  571
            + A NIG       +I +P  AF    E+ + V +I     +   N    L      I+ 
Sbjct  537  RDAINIGANGVCNATINAPFIAFTGLGESFKKVAAI---PWKICSNLKSALDYYCSNIMF  593

Query  572  GISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYE----KLKPV  627
             +  Y +   D   F   L     + +A  +  V++   +    + GTV       L   
Sbjct  594  RVFPYDIP-CDVNDFVELLLDCGKLTVA-TSYFVLRYLDEKFDTVLGTVSNACQTALSSF  651

Query  628  LDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLA  687
            L+      +    F+ D +++ K +            V  A+   + VQ    +++K + 
Sbjct  652  LNACVAASRATAGFISDMFKLFKVLMHKLYVYTSCGYVAVAEHSSKIVQQVLDIMSKAMK  711

Query  688  LCADSIIIGGAKLKALNL-GETFVTHSKGLYRKCVKSREET-----GLLMPLKAPKEIIF  741
            L   ++   G KL A+   G   +  + G Y  C+ ++ +T      L++P    K+ + 
Sbjct  712  LLHTNVSWAGTKLSAIIYEGREALLFNSGTYF-CLSTKAKTLQDQMNLVLPGDYNKKTLG  770

Query  742  L-----EGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDT  796
            +       +T+     +  V +  G L    +PT+E   + +VG  V ++  + +   D 
Sbjct  771  ILDPVPNADTIDVTANSTVVDVVHGQL----EPTNEHGPSMIVGNYVLVSDKLFVRTDDE  826

Query  797  EKYCALAPNMMVTNNTFTLKGGAPT-KVTFGDDTVIEVQGYKSVNITFELDERIDKVL-N  854
            E Y  L  N  V +  F LKGG P+ KVTFGD   +EV  Y+SV+IT+++   +D +L +
Sbjct  827  EFY-PLCINGKVVSTLFRLKGGMPSKKVTFGDVNTVEVTAYRSVSITYDIHPVLDALLSS  885

Query  855  EKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF  914
             K + +TVE    V +F  V+ D V+  L P+       G D++++     Y++++ G+ 
Sbjct  886  SKLATFTVEKDLLVEDFVDVIKDEVLTLLTPLLRGYDIDGFDVEDFIDVPCYVYNQDGDC  945

Query  915  KLASHMYCSFYP  926
              +S+M  S  P
Sbjct  946  AWSSNMTFSINP  957


 Score =  129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 8/176 (5%)

Query  991   QDGSEDNQT-------TTIQTIVE-VQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKN  1042
             QD + +NQ         T +T VE VQP+ ++    + ++    S   +  + ++V +  
Sbjct  1117  QDEASENQVHQVPDLQCTSETKVEIVQPRQDLRPRRLRKSKVDLSKYKHTVINNSVTLVL  1176

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
              D ++ A  +   V+VNAAN +LKHGGG+AGA+NKA+   +Q ESD+YI+ +GPL VG S
Sbjct  1177  GDAIQIASLLPKCVLVNAANRHLKHGGGIAGAINKASGGDVQEESDEYISNSGPLHVGDS  1236

Query  1103  CVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADP  1158
              +L G+ LA   L VVGP+    ED  LLK  Y+ FN+H +++ PL+S+GIF  DP
Sbjct  1237  VLLKGYGLADAILRVVGPDARNNEDAALLKRCYKTFNKHTIVVTPLISSGIFSVDP  1292


> sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus 
HKU4 OX=694007 GN=1a PE=1 SV=1
Length=4434

 Score = 1833 bits (4747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 960/2213 (43%), Positives = 1382/2213 (62%), Gaps = 61/2213 (3%)

Query  2230  IIWFLLLSVCLGSLIYSTAALGVLM------SNLGMPSYCTGYREGYLNSTNVTIATYCT  2283
             I   +L +  L S +    A G+L       S LG+ + C G    Y N T+  +  +C+
Sbjct  2236  IYHLVLFNQVLSSDVMLEDATGILAIYKEVRSYLGIRTLCDGLVVEYRN-TSFDVMEFCS  2294

Query  2284  G-SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLG  2342
               S+ C  CL G DSL  Y +L+ +Q  I+S+  ++       E+FLAY+L+T  F VL 
Sbjct  2295  NRSVLCQWCLIGQDSLTRYSALQMLQTHITSYVLNIDWIWFALEFFLAYVLYTSSFNVLL  2354

Query  2343  LAAIMQLFFSYFA--VHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
             L    Q FF+Y +  V++ + ++++  +  LV   P+  +VR+Y F A  +++ K Y HV
Sbjct  2355  LVVTAQYFFAYTSAFVNWRAYNYIVSGLFFLVTHIPLHGLVRVYNFLACLWFLRKFYSHV  2414

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
             ++GC  + C++CYKRNR TRVE +TIV G +R+FY+ ANGG  +C  HNWNCV CDT   
Sbjct  2415  INGCKDTACLLCYKRNRLTRVEASTIVCGTKRTFYIAANGGTSYCCKHNWNCVECDTAGV  2474

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             G+TFI  EVA DL+   +R I PTDQS Y VDSV VK+  + L++++ G   YER+ L +
Sbjct  2475  GNTFICTEVANDLTTTLRRLIKPTDQSHYYVDSVVVKDAVVELHYNRDGSSCYERYPLCY  2534

Query  2521  FVNLDNLRAN---NTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQAL  2576
             F NL+ L+      T   +P  N +++D   + +E+ A+SA VYYSQ++C+P+LL+D  L
Sbjct  2535  FTNLEKLKFKEVCKTPTGIPEHNFLIYDTNDRGQENLARSACVYYSQVLCKPMLLVDVNL  2594

Query  2577  VSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISA  2636
             V+ VGDS E+A+KM D+++N+F S F+V  +KL+ L+ TA   + +     NVL TF  A
Sbjct  2595  VTTVGDSREIAIKMLDSFINSFISLFSVSRDKLEKLINTARDCVRRGDDFQNVLKTFTDA  2654

Query  2637  AR-QGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCS  2695
             AR    V+SDVET  VV+ L+ +H++DI++T +  NNY+  Y K +++   DLG  ID  
Sbjct  2655  ARGHAGVESDVETTMVVDALQYAHKNDIQLTTECYNNYVPGYIKPDSINTLDLGCLIDLK  2714

Query  2696  ARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVT  2755
             A  +N    ++ N A +WN  D+M LS+  ++QIR A +K N+PF+LT +  R   N+++
Sbjct  2715  AASVNQTSMRNANGACVWNSGDYMKLSDSFKRQIRIACRKCNIPFRLTTSKLRAADNILS  2774

Query  2756  TKIALKGGKIVN---NWLKQLIKVTL-------VFLF-VAAIFYLITPVHVMSKHTDFSS  2804
              K +    KIV    +WL ++  +T+       +F+F VA + +   P + ++       
Sbjct  2775  VKFS--ATKIVGGAPSWLLRVRDLTVKGYCILTLFVFTVAVLSWFCLPSYSIATVNFNDD  2832

Query  2805  EIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQ-RGGSYTNDKACPLIAAVITREVG  2863
              I+ YK I+ G+ RDIA  D CFANK+  F  WF++  GG Y N   CP+  AVI    G
Sbjct  2833  RILTYKVIENGIVRDIAPNDVCFANKYGHFSKWFNENHGGVYRNSMDCPITIAVIAGVAG  2892

Query  2864  FVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFK  2923
               V  +P   L       + F+ RVF A  N+C+TP   I Y  F+ S CVL++ECT+F+
Sbjct  2893  ARVANVPAN-LAWVGKQIVLFVSRVF-ANTNVCFTPINEIPYDTFSDSGCVLSSECTLFR  2950

Query  2924  DASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEGSVRVVTTFDSE  2982
             DA G   P+CYD  VL G+ +Y  ++P  RY + D  + I+FP   +E ++R+  T  ++
Sbjct  2951  DAEGNLNPFCYDPTVLPGASSYADMKPHVRYDMYDSDMYIKFPEVIVESTLRITKTLATQ  3010

Query  2983  YCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALD  3042
             YCR G+CE S AGVC+ST+G W L N  Y + PG++CG D  +++  +   L QP+    
Sbjct  3011  YCRFGSCEESAAGVCISTNGSWALYNQNYSTRPGIYCGDDYFDIVRRLAISLFQPVTYFQ  3070

Query  3043  ISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLP  3102
             +S S+  G ++ + +T   YY  + +RA  +Y+       +  L++   LC       L 
Sbjct  3071  LSTSLAMGLVLCVFLTAAFYYINKVKRALADYTQCAVVAVVAALLNSLCLCFIVANPLLV  3130

Query  3103  GVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLK  3162
               Y+ +Y Y TFYLT + +F+ HI W VMF  +VP W+  +Y + +  +H +W  + + K
Sbjct  3131  APYTAMYYYATFYLTGEPAFIMHISWYVMFGAVVPIWMLASYTVGVMLRHLFWVLAYFSK  3190

Query  3163  RRV-VF-NGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQ--YNRYLALYNKYKYFS  3218
             + V VF +G    +F++AA   F++ K+ Y+ LR+     +TQ  + RYL+L+NKYKY+S
Sbjct  3191  KHVDVFTDGKLNCSFQDAASNIFVIGKDTYVALRN----AITQDSFVRYLSLFNKYKYYS  3246

Query  3219  GAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEG  3278
             GAMDT SYREA   HL KAL  +S +GSD+LYQPP  S+TS+VLQSG  KM+ PSG VE 
Sbjct  3247  GAMDTASYREACAAHLCKALQTYSETGSDILYQPPNCSVTSSVLQSGLVKMSAPSGAVEN  3306

Query  3279  CMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGN  3335
             C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI K+NH+F+VQ      
Sbjct  3307  CIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQ  3366

Query  3336  VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRP  3395
               LRV+ HSM   +LKL VD ANP TP Y F  ++PG +FSVLACYNG P+GV+   +R 
Sbjct  3367  ANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRH  3426

Query  3396  NFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQ  3455
             N TIKGSFL GSCGSVG+  +   ++F YMH MEL  G H G+  +G  YG F D+QT Q
Sbjct  3427  NSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQ  3486

Query  3456  AAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILG  3514
                TD   T+NV+AWLYAAV+NG +WF+      +  +N  A+   + E +    +D+L 
Sbjct  3487  LQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDML-  3545

Query  3515  PLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
               + +TG++V  M A+++ L   G  G+TILG + LEDEFTP DV  Q  GV  QS VKR
Sbjct  3546  --AHRTGVSVEQMLAAIQSL-HAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQSGVKR  3602

Query  3575  TIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHA  3634
                G  HWL+ T + + + ++Q T+++++ +L+E         ++   A  M  VKHKH 
Sbjct  3603  ISYGFIHWLISTFVLAYVSVMQLTKFTMWTYLFETIPTQMTPLLLGFMACVMFTVKHKHT  3662

Query  3635  FLCLFLLPSLATVAYFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVV  3690
             F+ LFLLP    + Y N+VY P    +S ++ +  WL      +      D  +Y S   
Sbjct  3663  FMSLFLLPVALCLTYANIVYEPQTLISSTLIAVANWLTPTSVYMRTTHF-DFGLYISLSF  3721

Query  3691  LLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT  3750
             +L ++  R      +     L + +   Y    G+     I+    I ++TS+Y+  V  
Sbjct  3722  VLAIIVRRLYRPSMSNLALALCSGVMWFYTYVIGDH-SSPITYLMFITTLTSDYTITVFA  3780

Query  3751  VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGV  3810
              + LA+ I  +   Y P        ++ ++L+Y  LGY CT YFG+F LLN   R+ LGV
Sbjct  3781  TVNLAKFISGLVFFYAPHLGFILPEVKLVLLIYLGLGYMCTMYFGVFSLLNLKLRVPLGV  3840

Query  3811  YDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSV  3870
             YDY VSTQEFR++   GL  P+NS +A  LN KLLG+GG PCIKVATVQSK++D+KCTSV
Sbjct  3841  YDYSVSTQEFRFLTGNGLHAPRNSWEALILNFKLLGIGGTPCIKVATVQSKLTDLKCTSV  3900

Query  3871  VLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL  3930
             VLL+VLQQL +ES+SK W+ CV+LHN+IL A D TEAFE+ V L + L+S    VD++ L
Sbjct  3901  VLLTVLQQLHLESNSKAWSYCVKLHNEILAAVDPTEAFERFVCLFATLMSFSANVDLDAL  3960

Query  3931  CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKLKKSLNVAKS  3989
               ++ +N + LQA  +EFS L +YA   TAQ +Y++A+ +GD S  VLK L+K++NVAK+
Sbjct  3961  ANDLFENSSVLQATLTEFSHLATYAELETAQSSYQKALNSGDASPQVLKALQKAVNVAKN  4020

Query  3990  EFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNII  4049
              +++D A+ RKLE+MA+QAMT MYKQAR+EDK+AK+ SAMQTMLF M++KLDND LN +I
Sbjct  4021  AYEKDKAVARKLERMAEQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGVI  4080

Query  4050  NNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIV  4109
              NAR+GCVPL+I+PL  + KL VVIPD + +    +  + +YA +LW+I  + + D+++V
Sbjct  4081  ANARNGCVPLSIVPLCASNKLRVVIPDISVWNKVVNWPSVSYAGSLWDITVINNVDNEVV  4140

Query  4110  QLSEISMDNSPNLAWPLIVTALR-ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNA  4168
             + +++ ++ + +L WPL++   R ++SAVKLQNNE+ P  L+ M   AG  Q  C + +A
Sbjct  4141  KPTDV-VETNESLTWPLVIECSRSSSSAVKLQNNEIHPKGLKTMVITAGVDQVNC-NSSA  4198

Query  4169  LAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYL  4228
             +AYY   +G R V+ LLS+   LKWA+    D  G I  EL+PPC+F+   PKGP+++YL
Sbjct  4199  VAYYEPVQGHRMVMGLLSENAHLKWAKVEGKD--GFINIELQPPCKFLIAGPKGPEIRYL  4256

Query  4229  YFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGG  4288
             YF+K LNNL+RG +LG +AATVRLQAG  TE  +NSTVL+  AFAVD AKAY DY+ SGG
Sbjct  4257  YFVKNLNNLHRGQLLGHIAATVRLQAGANTEFASNSTVLTLVAFAVDPAKAYLDYVGSGG  4316

Query  4289  QPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGK  4348
              P++N VKML   TGTG AI+V PEA  DQE++GGAS CLYCR HI+HP+  G C  K +
Sbjct  4317  TPLSNYVKMLAPKTGTGVAISVKPEATADQETYGGASVCLYCRAHIEHPDVSGVCKYKTR  4376

Query  4349  YVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             +VQIP     DPVGF LKN  C VC  W GYGC+CD LR   +  +   +FLN
Sbjct  4377  FVQIPAH-VRDPVGFLLKNVPCNVCQYWVGYGCNCDALRNNTVPQSKDTNFLN  4428


 Score =  306 bits (785),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 226/771 (29%), Positives = 368/771 (48%), Gaps = 46/771 (6%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C E  A V  ++ K      +   VD G  +Y Y+++  +  +I   N  +  +  MP 
Sbjct  1345  ICTEYSANVKFLRTKGVDTTKKIQTVD-GVSYYLYSARDALTDVIAAANGCS-GICAMPF  1402

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L ++  Y+R +KVP    ++S + +   N  +  + +TPE  FI  ++  G 
Sbjct  1403  GYVTHGLDLAQSGNYVRQVKVPYVCLLASKEQIPIMNSDV--AIQTPETAFINNVTSNGG  1460

Query  1511  YKDWSY-SGQSTQLGI---EFLKRGDKSVYYTSNPTTFHLDGEVITFDNL---KTLLSLR  1563
             Y  W   SG      +   + L    +++ Y  N      +   + F +L   +  L+ R
Sbjct  1461  YHSWHLVSGDLIVKDVCYKKLLHWSGQTICYADNKFYVVKNDVALPFSDLEACRAYLTSR  1520

Query  1564  EVR--TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL  1621
               +   I+V  T+D +N  T +++ + T+ +Q G T+  G D++   P     G++ +V 
Sbjct  1521  AAQQVNIEVLVTIDGVNFRTVILNDTTTFRKQLGATFYKGVDISDAFPTVKMGGESLFVA  1580

Query  1622  PN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
              N  ++ +V   EYY T+D +FL RY S     ++WK+   +G+ S+K ++ NCY+   +
Sbjct  1581  DNLSESEKVVLKEYYGTSDVTFLQRYYSLQPLVQQWKFVVHDGVKSLKLSNYNCYINATI  1640

Query  1681  LTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
             + +  + ++KF  PALQ+AY R + G+  +F ALI+AY + T     D  + +  L   A
Sbjct  1641  MMIDMLHDIKFVVPALQNAYLRYKGGDPYDFLALIMAYGDCTFDNPDDEAKLLHTLLAKA  1700

Query  1740  NLD-SCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV  1798
              L  S K V    C  CG +     G+ A +Y G  S E+ +      C CG    + LV
Sbjct  1701  ELTVSAKMVWREWCTVCGIRDIEYTGMRACVYAGVNSMEELQSVFNETCVCGSVKHRQLV  1760

Query  1799  QQESPFVMMSAPPAQYELKHGTFTCASEYTGNY------QCGHYKHITSKETL-YCIDGA  1851
             +  +P++++S      E+K  T T       N         GHY HI  K+ L Y  D  
Sbjct  1761  EHSAPWLLVSG---LNEVKVSTSTDPIYRAFNVFQGVETSVGHYVHIRVKDGLFYKYDSG  1817

Query  1852  LLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQP  1911
              LTK+S+ K  +T V+Y    YT     V Y LDGV   E++P L NYY KD  Y+T +P
Sbjct  1818  SLTKTSDMKCKMTSVWYPTVRYTADCNVVVYDLDGVTKVEVNPDLSNYYMKDGKYYTSKP  1877

Query  1912  -IDLVPNQPYPNASFDNFKFV-CDNIKFADDL----NQLTGYK--KPASRELKVTFFPDL  1963
              I   P    P + + N   V  D    +D +    N L G+   KP S++L  +  P+ 
Sbjct  1878  TIKYSPATILPGSVYSNSCLVGVDGTPGSDTISKFFNDLLGFDETKPISKKLTYSLLPNE  1937

Query  1964  NGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSN  2023
             +GDV+  ++ +Y P +KKG  L  KPI+W  N   + A  KPN   +R L+   P+   N
Sbjct  1938  DGDVLLSEFSNYNPVYKKGVMLKGKPILWVNNGVCDSALNKPNRASLRQLYDVAPIVLDN  1997

Query  2024  SFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTE---VVGDIILKPA  2080
              + VL+   +Q       E   PV ++V   P   + ++E   K      V G+      
Sbjct  1998  KYTVLQDNTSQ-----LVEHNVPVVDDV---PITTRKLIEVKCKGLNKPFVKGNFSFVND  2049

Query  2081  NNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAV  2130
              N + + + +G T+L A YVD N+   + + N  S +  L T+ +  L  V
Sbjct  2050  PNGVTVVDTLGLTELRALYVDINTRYIVLRDNNWSSLFKLHTVESGDLQIV  2100


 Score =  249 bits (635),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 316/1307 (24%), Positives = 534/1307 (41%), Gaps = 198/1307 (15%)

Query  8     FNEKT--HVQLSLPVLQVRDV---LVRGFGDSVEEVLSEARQHLKD-GTCGLVEVE-KGV  60
             +NEK   HV  ++P+    D+   L   F D  E   ++    LK+ G    V +  +  
Sbjct  21    YNEKRSDHVACTVPLCDTDDMACKLTPWFEDG-ETAFNQVSSILKEKGKILFVPMHMQRA  79

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGR-----SGETLGVLVPHVGEIP  115
             +  L  P V++           H +V  +A  + +         + + LG+  P+   + 
Sbjct  80    MKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDQVGAAMMRTTLNAKPLGMFFPYDSSLE  139

Query  116   VAYRKVLLRKNGNKGAGGHSYGADLKS---FDLGDELGTDPYEDFQENWNTKHSSGVTRE  172
                   LLRKNG  G        D K     ++ D+L  DP   + +N            
Sbjct  140   TGEYTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQN------------  187

Query  173   LMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSE-QLDF---IDTKRGV  228
             L+++L GG     +D   CG +G P+     ++A+ G    TL++ ++D    +D+ R +
Sbjct  188   LLKKLIGGDCIP-IDQYMCGKNGKPIADYAKIVAKEGLT--TLADIEVDVKSRMDSDRFI  244

Query  229   YCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRV  288
                 +  + + W   R    Y  QT F I    + D      P   F + S I  + P +
Sbjct  245   -VLNKKLYRVVWNVTRRNVPYPKQTAFTIVSVVQCDD-KDSVPEHTFTIGSQILMVSP-L  301

Query  289   EKKKLDGFMGRIRSVYPVASPNECNQ---MCLSTLMKCDHCGETSWQTGDFVKATCEFCG  345
             +      F  + R +Y     +   Q   +  S  + C+ CG  +W TG+ ++     CG
Sbjct  302   KATNNKNFNLKQRLLYTFYGKDAVQQPGYIYHSAYVDCNACGRGTWCTGNAIQGFACDCG  361

Query  346   TENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGR--  402
                   +    + G +P+NA+    CP  +N      HS A+ +N    K  +  GG+  
Sbjct  362   ANYSANDVDLQSSGLVPRNALFLANCPCANNGAC--SHSAAQVYNILDGKACVEVGGKSF  419

Query  403   TIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLE----ILQKEK  458
             T+ FGG V++Y+GC +   Y+VPRA + +       +  G  G  D ++E     L+K +
Sbjct  420   TLTFGGVVYAYMGCCDGTMYFVPRAKSCVS-RIGDAIFTGCTGTWDKVVETANLFLEKAQ  478

Query  459   VNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN--FKVTKGKA  516
              ++N    F L E   ++LA  S +TS F E        +++++ +   N  F VT G  
Sbjct  479   RSLNFCQQFALTE---VVLAILSGTTSTFEELRDLCHNASYEKVRDHLVNHGFVVTIGDY  535

Query  517   KKGAWNIGEQ----KSILSPLYAFAS--EAARVVRSI---FSRTLETAQN---SVRVLQK  564
              + A NIG       +I +P  AF    E+ + V +I       L++A +   S  + + 
Sbjct  536   IRDAINIGANGVCNATINAPFIAFTGLGESFKKVSAIPWKICSNLKSALDYYSSNIMFRV  595

Query  565   AAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEK-  623
                 I   +S +   L+D    T        V  +Y    V++   +    + GTV    
Sbjct  596   FPYDIPCDVSNFVELLLDCGKLT--------VATSYF---VLRYLDEKFDTVLGTVSSAC  644

Query  624   ---LKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFK  680
                L   L+      +    F+ D +++ K +            V  A+   + VQ    
Sbjct  645   QTALSSFLNACVAASRATAGFINDMFKLFKVLMHKLYVYTSCGYVAVAEHSSKIVQQVLD  704

Query  681   LVNKFLALCADSIIIGGAKLKALNL-GETFVTHSKGLYRKCVKSREET-----GLLMPLK  734
             +++K + L   ++   G KL A+   G   +  + G Y  C+ ++ +T      L++P  
Sbjct  705   IMSKAMKLLHTNVSWAGTKLSAIIYEGREALLFNSGTYF-CLSTKAKTLQGQMNLVLPGD  763

Query  735   APKEIIFL-----EGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLM  789
               K+ + +       +T+     +  V +  G L+P    T+E   + +VG  V ++  +
Sbjct  764   YNKKTLGILDPVPNADTIDVNANSTVVDVVHGQLEP----TNEHGPSMIVGNYVLVSDKL  819

Query  790   LLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSVNITFELDER  848
              +  +D E Y  L  N  V +  F LKGG P+K VTFGD   +EV  Y+SV+IT+++   
Sbjct  820   FVRTEDEEFY-PLCTNGKVVSTLFRLKGGMPSKKVTFGDVNTVEVTAYRSVSITYDIHPV  878

Query  849   IDKVL-NEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYL  907
             +D +L + K + +TVE    V +F  V+ D V+  L P+       G D++++     Y+
Sbjct  879   LDALLSSSKLATFTVEKDLLVEDFVDVIKDEVLTLLTPLLRGYDIDGFDVEDFIDVPCYV  938

Query  908   FDESGEFKLASHMYCSFYP--------------------PDEDEEEGDCEE-EEFEPSTQ  946
             +++ G+   +S+M  S  P                    P  D+EE      EE  P   
Sbjct  939   YNQDGDCAWSSNMTFSINPVEDVEEVEEFIEDDYLSDELPIADDEEAWARAVEEVMPLDD  998

Query  947   YEYGTEDDYQGKPLEFGATSA---ALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQ  1003
                   +  +  PLE    S     ++  E QE      DS  +     G  D     + 
Sbjct  999   ILVAEIELEEDPPLETALESVEAEVVETAEAQEPSVESIDSTPSTSTVVGENDLSVKPMS  1058

Query  1004  TIVEVQPQLEME----------LTPVV----------QTIEVNSFSGYLKLTDNVYIKNA  1043
              + E    LE+E          +T +V          Q   V+S     + ++N   + +
Sbjct  1059  RVAETDDVLELETAVVGGPVSDVTAIVTNDIVSVEQAQQCGVSSLPIQDEASENQVHQVS  1118

Query  1044  D--------------IVEEAKKVKP---------------TVVVNAANVYLKHGGGVAGA  1074
             D              IV+  + +KP               TV+ N+  + L     +A  
Sbjct  1119  DLQGNELLCSETKVEIVQPRQDLKPRRSRKSKVDLSKYKHTVINNSVTLVLGDAIQIASL  1178

Query  1075  LNK-----------------------ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA  1111
             L K                       A+   +Q ESD+YI+ NGPL VG S +L GH LA
Sbjct  1179  LPKCILVNAANRHLKHGGGIAGVINKASGGDVQEESDEYISNNGPLHVGDSVLLKGHGLA  1238

Query  1112  KHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADP  1158
                LHVVGP+    ED  LLK  Y+ FN+H +++ PL+SAGIF  DP
Sbjct  1239  DAILHVVGPDARNNEDAALLKRCYKAFNKHTIVVTPLISAGIFSVDP  1285


> sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=1a PE=3 SV=1
Length=4441

 Score = 1832 bits (4745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1062/2889 (37%), Positives = 1592/2889 (55%), Gaps = 118/2889 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1620  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1679

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1680  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1738

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1739  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1798

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1799  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1856

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1857  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1914

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1915  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  1973

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  1974  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2031

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2032  GCETFGKPVIWLCHDEASLNSLTY----------FNKPSFKSENRYSVLS------VDSV  2075

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2076  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2135

Query  2099  YVDNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2136  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2191

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCL--EA  2213
                R +      ++ + F  +  L  FT          + +    N       FCL  + 
Sbjct  2192  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKTIFYTTEIASKFTFNL------FCLALKN  2243

Query  2214  SFNYLKSPNFSKLINII-----IWF--LLLSVCLGSL---------IYSTAALGVLMSNL  2257
             +F   +   F K   ++      WF  L ++V              I+    +  + +  
Sbjct  2244  AFQTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKATF  2303

Query  2258  GMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---F  2314
             G+ + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     F
Sbjct  2304  GLVTICDFYSKLGVGFT----SHFCNGSFICELCYSGFDMLDTYAAIDFVQYEVDRRVLF  2359

Query  2315  KWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLV  2372
              + ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ + 
Sbjct  2360  DY-VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFVA  2418

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV R
Sbjct  2419  NMLPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVIR  2478

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V 
Sbjct  2479  YYDITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVVT  2538

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              +      + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V   +S  + +
Sbjct  2539  DIKQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVV--VESDADRA  2596

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +     
Sbjct  2597  NFLNAVVFYAQSLYRPILLVDKKLITTACNGISVTQTMFDVYVDTFMSHFDVDRKSFNNF  2656

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             V  A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ N
Sbjct  2657  VNIAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENYN  2716

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I   A+H+   VAK+ NI+ IW +  F  L+  L+ +++ 
Sbjct  2717  NLVPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKAANISCIWFIDTFNQLTADLQHKLKK  2776

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V ++TT  +LKGG +++N L  L  ++L+      + + + 
Sbjct  2777  ACVKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFISLICFI---LLWALL  2833

Query  2792  PVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTNDK  2849
             P + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N  
Sbjct  2834  PTYSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSFYYHNSM  2893

Query  2850  ACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFA  2909
              CP++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF 
Sbjct  2894  DCPIVVAVMDEDIGSTMFNVPTKVLRH-GFHVLHFLTYAFASDSVQCYTPHIQISYNDFY  2952

Query  2910  TSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTY  2968
              S CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+  
Sbjct  2953  ASGCVLSSLCTMFKRGDGTPHPYCYSDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDVI  3012

Query  2969  LEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLT  3028
              EG VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L  
Sbjct  3013  SEGIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDLFDLFY  3072

Query  3029  NMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMS  3088
               F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ ++
Sbjct  3073  QFFSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVIVWCIN  3132

Query  3089  FTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICI  3148
             F +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  +
Sbjct  3133  FLMLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAMV  3192

Query  3149  STKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYL  3208
                H  W FS    R++  N  + STFEE +L TF++ K+ Y +L++ V      YNRYL
Sbjct  3193  IANHVLWLFS--YCRKIGVNVCNDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRYL  3248

Query  3209  ALYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFR  3267
             +LYNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG  
Sbjct  3249  SLYNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGIV  3308

Query  3268  KMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNH  3327
             KM  P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M  P+Y  LL R +  
Sbjct  3309  KMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCRVTLG  3368

Query  3328  NFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSG  3387
             +F + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P G
Sbjct  3369  DFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNGRPQG  3428

Query  3388  VYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGP  3447
              +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP
Sbjct  3429  AFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGP  3488

Query  3448  FVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQ  3507
             + D Q  Q    D   TVNV+AWLYAA++N   WF+     ++ DFN+ AM   +  +  
Sbjct  3489  YRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFSQVKA  3548

Query  3508  DHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVT  3567
             D V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV 
Sbjct  3549  DLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGVK  3605

Query  3568  FQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMM  3627
              QS  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M+
Sbjct  3606  LQSKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMML  3664

Query  3628  FVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYA  3686
              VKHKH +L ++++P L T+ Y N +V     +      WL     +++   + +     
Sbjct  3665  LVKHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGLTYVWLSYFVPAVNFTYVYEVFYGC  3724

Query  3687  SAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSG  3746
                V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+ 
Sbjct  3725  ILCVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYTW  3782

Query  3747  VVTTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFR  3805
               TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  FR
Sbjct  3783  --TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVFR  3840

Query  3806  LTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDV  3865
             + +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++DV
Sbjct  3841  MPMGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTDV  3900

Query  3866  KCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAV  3925
             KC +VVLL+ LQ L V S+S+LW  C  LHN+IL   D + AF+K+  LL VL +   AV
Sbjct  3901  KCANVVLLNCLQHLHVASNSRLWQYCSILHNEILSTSDLSVAFDKLAQLLIVLFANPAAV  3960

Query  3926  D------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLK  3978
             D      I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +K
Sbjct  3961  DTKCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQIK  4020

Query  3979  KLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLR  4038
             +L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+R
Sbjct  4021  QLEKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVR  4080

Query  4039  KLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEI  4098
             KLDN ALN+I++NA  GCVPLN IP   A  L ++IPD   +    D     YA ++W I
Sbjct  4081  KLDNQALNSILDNAVKGCVPLNAIPALAANTLTIIIPDKQVFDKVVDNVYVAYAGSVWHI  4140

Query  4099  QQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCAA  4156
             Q V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     +
Sbjct  4141  QTVQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVNS  4196

Query  4157  GTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFV  4216
             G+      +     YYN    GR V A+LSD+  LK+ +  K DG   +  EL+PPC+F 
Sbjct  4197  GSDMNC--NIPTQCYYNNGSSGRIVYAVLSDVDGLKYTKIIKDDGNCVV-LELDPPCKFS  4253

Query  4217  TDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDA  4276
                 KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS CAF+VD 
Sbjct  4254  IQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLCAFSVDP  4313

Query  4277  AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH  4336
              K Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YCR  ++H
Sbjct  4314  KKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYCRARVEH  4373

Query  4337  PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADA  4396
             P+  G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC       +QS D 
Sbjct  4374  PDVDGLCKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSCVG-SGVAVQSKDL  4431

Query  4397  QSFLNGFAV  4405
              +FLNGF V
Sbjct  4432  -NFLNGFGV  4439


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1328  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1387

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1388  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1447

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1448  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1482


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 102/422 (24%), Positives = 172/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G+           F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGL-----------FVVSQANFNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDQAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    +   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKDHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 44.7 bits (104),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1115  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1174

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++AV + G + 
Sbjct  1175  IPKAIVLPQGGYVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDAVFFYGDI-  1229

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1230  -------VSHVCKCGHNMT--LIAADLP  1248


> sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU4 OX=694007 GN=rep PE=1 SV=1
Length=7119

 Score = 1831 bits (4743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 960/2213 (43%), Positives = 1382/2213 (62%), Gaps = 61/2213 (3%)

Query  2230  IIWFLLLSVCLGSLIYSTAALGVLM------SNLGMPSYCTGYREGYLNSTNVTIATYCT  2283
             I   +L +  L S +    A G+L       S LG+ + C G    Y N T+  +  +C+
Sbjct  2236  IYHLVLFNQVLSSDVMLEDATGILAIYKEVRSYLGIRTLCDGLVVEYRN-TSFDVMEFCS  2294

Query  2284  G-SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLG  2342
               S+ C  CL G DSL  Y +L+ +Q  I+S+  ++       E+FLAY+L+T  F VL 
Sbjct  2295  NRSVLCQWCLIGQDSLTRYSALQMLQTHITSYVLNIDWIWFALEFFLAYVLYTSSFNVLL  2354

Query  2343  LAAIMQLFFSYFA--VHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
             L    Q FF+Y +  V++ + ++++  +  LV   P+  +VR+Y F A  +++ K Y HV
Sbjct  2355  LVVTAQYFFAYTSAFVNWRAYNYIVSGLFFLVTHIPLHGLVRVYNFLACLWFLRKFYSHV  2414

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
             ++GC  + C++CYKRNR TRVE +TIV G +R+FY+ ANGG  +C  HNWNCV CDT   
Sbjct  2415  INGCKDTACLLCYKRNRLTRVEASTIVCGTKRTFYIAANGGTSYCCKHNWNCVECDTAGV  2474

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             G+TFI  EVA DL+   +R I PTDQS Y VDSV VK+  + L++++ G   YER+ L +
Sbjct  2475  GNTFICTEVANDLTTTLRRLIKPTDQSHYYVDSVVVKDAVVELHYNRDGSSCYERYPLCY  2534

Query  2521  FVNLDNLRAN---NTKGSLP-INVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQAL  2576
             F NL+ L+      T   +P  N +++D   + +E+ A+SA VYYSQ++C+P+LL+D  L
Sbjct  2535  FTNLEKLKFKEVCKTPTGIPEHNFLIYDTNDRGQENLARSACVYYSQVLCKPMLLVDVNL  2594

Query  2577  VSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISA  2636
             V+ VGDS E+A+KM D+++N+F S F+V  +KL+ L+ TA   + +     NVL TF  A
Sbjct  2595  VTTVGDSREIAIKMLDSFINSFISLFSVSRDKLEKLINTARDCVRRGDDFQNVLKTFTDA  2654

Query  2637  AR-QGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCS  2695
             AR    V+SDVET  VV+ L+ +H++DI++T +  NNY+  Y K +++   DLG  ID  
Sbjct  2655  ARGHAGVESDVETTMVVDALQYAHKNDIQLTTECYNNYVPGYIKPDSINTLDLGCLIDLK  2714

Query  2696  ARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVT  2755
             A  +N    ++ N A +WN  D+M LS+  ++QIR A +K N+PF+LT +  R   N+++
Sbjct  2715  AASVNQTSMRNANGACVWNSGDYMKLSDSFKRQIRIACRKCNIPFRLTTSKLRAADNILS  2774

Query  2756  TKIALKGGKIVN---NWLKQLIKVTL-------VFLF-VAAIFYLITPVHVMSKHTDFSS  2804
              K +    KIV    +WL ++  +T+       +F+F VA + +   P + ++       
Sbjct  2775  VKFS--ATKIVGGAPSWLLRVRDLTVKGYCILTLFVFTVAVLSWFCLPSYSIATVNFNDD  2832

Query  2805  EIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQ-RGGSYTNDKACPLIAAVITREVG  2863
              I+ YK I+ G+ RDIA  D CFANK+  F  WF++  GG Y N   CP+  AVI    G
Sbjct  2833  RILTYKVIENGIVRDIAPNDVCFANKYGHFSKWFNENHGGVYRNSMDCPITIAVIAGVAG  2892

Query  2864  FVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFK  2923
               V  +P   L       + F+ RVF A  N+C+TP   I Y  F+ S CVL++ECT+F+
Sbjct  2893  ARVANVPAN-LAWVGKQIVLFVSRVF-ANTNVCFTPINEIPYDTFSDSGCVLSSECTLFR  2950

Query  2924  DASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI-IQFPNTYLEGSVRVVTTFDSE  2982
             DA G   P+CYD  VL G+ +Y  ++P  RY + D  + I+FP   +E ++R+  T  ++
Sbjct  2951  DAEGNLNPFCYDPTVLPGASSYADMKPHVRYDMYDSDMYIKFPEVIVESTLRITKTLATQ  3010

Query  2983  YCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALD  3042
             YCR G+CE S AGVC+ST+G W L N  Y + PG++CG D  +++  +   L QP+    
Sbjct  3011  YCRFGSCEESAAGVCISTNGSWALYNQNYSTRPGIYCGDDYFDIVRRLAISLFQPVTYFQ  3070

Query  3043  ISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLP  3102
             +S S+  G ++ + +T   YY  + +RA  +Y+       +  L++   LC       L 
Sbjct  3071  LSTSLAMGLVLCVFLTAAFYYINKVKRALADYTQCAVVAVVAALLNSLCLCFIVANPLLV  3130

Query  3103  GVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLK  3162
               Y+ +Y Y TFYLT + +F+ HI W VMF  +VP W+  +Y + +  +H +W  + + K
Sbjct  3131  APYTAMYYYATFYLTGEPAFIMHISWYVMFGAVVPIWMLASYTVGVMLRHLFWVLAYFSK  3190

Query  3163  RRV-VF-NGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQ--YNRYLALYNKYKYFS  3218
             + V VF +G    +F++AA   F++ K+ Y+ LR+     +TQ  + RYL+L+NKYKY+S
Sbjct  3191  KHVDVFTDGKLNCSFQDAASNIFVIGKDTYVALRN----AITQDSFVRYLSLFNKYKYYS  3246

Query  3219  GAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEG  3278
             GAMDT SYREA   HL KAL  +S +GSD+LYQPP  S+TS+VLQSG  KM+ PSG VE 
Sbjct  3247  GAMDTASYREACAAHLCKALQTYSETGSDILYQPPNCSVTSSVLQSGLVKMSAPSGAVEN  3306

Query  3279  CMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGN  3335
             C+VQVTCG+ TLNGLWLD+ V+CPRH++C ++ + +PNY+ LLI K+NH+F+VQ      
Sbjct  3307  CIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQ  3366

Query  3336  VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRP  3395
               LRV+ HSM   +LKL VD ANP TP Y F  ++PG +FSVLACYNG P+GV+   +R 
Sbjct  3367  ANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRH  3426

Query  3396  NFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQ  3455
             N TIKGSFL GSCGSVG+  +   ++F YMH MEL  G H G+  +G  YG F D+QT Q
Sbjct  3427  NSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQ  3486

Query  3456  AAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILG  3514
                TD   T+NV+AWLYAAV+NG +WF+      +  +N  A+   + E +    +D+L 
Sbjct  3487  LQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDML-  3545

Query  3515  PLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
               + +TG++V  M A+++ L   G  G+TILG + LEDEFTP DV  Q  GV  QS VKR
Sbjct  3546  --AHRTGVSVEQMLAAIQSL-HAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQSGVKR  3602

Query  3575  TIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHA  3634
                G  HWL+ T + + + ++Q T+++++ +L+E         ++   A  M  VKHKH 
Sbjct  3603  ISYGFIHWLISTFVLAYVSVMQLTKFTMWTYLFETIPTQMTPLLLGFMACVMFTVKHKHT  3662

Query  3635  FLCLFLLPSLATVAYFNMVYMP----ASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVV  3690
             F+ LFLLP    + Y N+VY P    +S ++ +  WL      +      D  +Y S   
Sbjct  3663  FMSLFLLPVALCLTYANIVYEPQTLISSTLIAVANWLTPTSVYMRTTHF-DFGLYISLSF  3721

Query  3691  LLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT  3750
             +L ++  R      +     L + +   Y    G+     I+    I ++TS+Y+  V  
Sbjct  3722  VLAIIVRRLYRPSMSNLALALCSGVMWFYTYVIGDH-SSPITYLMFITTLTSDYTITVFA  3780

Query  3751  VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGV  3810
              + LA+ I  +   Y P        ++ ++L+Y  LGY CT YFG+F LLN   R+ LGV
Sbjct  3781  TVNLAKFISGLVFFYAPHLGFILPEVKLVLLIYLGLGYMCTMYFGVFSLLNLKLRVPLGV  3840

Query  3811  YDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSV  3870
             YDY VSTQEFR++   GL  P+NS +A  LN KLLG+GG PCIKVATVQSK++D+KCTSV
Sbjct  3841  YDYSVSTQEFRFLTGNGLHAPRNSWEALILNFKLLGIGGTPCIKVATVQSKLTDLKCTSV  3900

Query  3871  VLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL  3930
             VLL+VLQQL +ES+SK W+ CV+LHN+IL A D TEAFE+ V L + L+S    VD++ L
Sbjct  3901  VLLTVLQQLHLESNSKAWSYCVKLHNEILAAVDPTEAFERFVCLFATLMSFSANVDLDAL  3960

Query  3931  CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKLKKSLNVAKS  3989
               ++ +N + LQA  +EFS L +YA   TAQ +Y++A+ +GD S  VLK L+K++NVAK+
Sbjct  3961  ANDLFENSSVLQATLTEFSHLATYAELETAQSSYQKALNSGDASPQVLKALQKAVNVAKN  4020

Query  3990  EFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNII  4049
              +++D A+ RKLE+MA+QAMT MYKQAR+EDK+AK+ SAMQTMLF M++KLDND LN +I
Sbjct  4021  AYEKDKAVARKLERMAEQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGVI  4080

Query  4050  NNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIV  4109
              NAR+GCVPL+I+PL  + KL VVIPD + +    +  + +YA +LW+I  + + D+++V
Sbjct  4081  ANARNGCVPLSIVPLCASNKLRVVIPDISVWNKVVNWPSVSYAGSLWDITVINNVDNEVV  4140

Query  4110  QLSEISMDNSPNLAWPLIVTALR-ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNA  4168
             + +++ ++ + +L WPL++   R ++SAVKLQNNE+ P  L+ M   AG  Q  C + +A
Sbjct  4141  KPTDV-VETNESLTWPLVIECSRSSSSAVKLQNNEIHPKGLKTMVITAGVDQVNC-NSSA  4198

Query  4169  LAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYL  4228
             +AYY   +G R V+ LLS+   LKWA+    D  G I  EL+PPC+F+   PKGP+++YL
Sbjct  4199  VAYYEPVQGHRMVMGLLSENAHLKWAKVEGKD--GFINIELQPPCKFLIAGPKGPEIRYL  4256

Query  4229  YFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGG  4288
             YF+K LNNL+RG +LG +AATVRLQAG  TE  +NSTVL+  AFAVD AKAY DY+ SGG
Sbjct  4257  YFVKNLNNLHRGQLLGHIAATVRLQAGANTEFASNSTVLTLVAFAVDPAKAYLDYVGSGG  4316

Query  4289  QPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGK  4348
              P++N VKML   TGTG AI+V PEA  DQE++GGAS CLYCR HI+HP+  G C  K +
Sbjct  4317  TPLSNYVKMLAPKTGTGVAISVKPEATADQETYGGASVCLYCRAHIEHPDVSGVCKYKTR  4376

Query  4349  YVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             +VQIP     DPVGF LKN  C VC  W GYGC+CD LR   +  +   +FLN
Sbjct  4377  FVQIPAH-VRDPVGFLLKNVPCNVCQYWVGYGCNCDALRNNTVPQSKDTNFLN  4428


 Score =  306 bits (784),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 226/771 (29%), Positives = 368/771 (48%), Gaps = 46/771 (6%)

Query  1391  VCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPL  1450
             +C E  A V  ++ K      +   VD G  +Y Y+++  +  +I   N  +  +  MP 
Sbjct  1345  ICTEYSANVKFLRTKGVDTTKKIQTVD-GVSYYLYSARDALTDVIAAANGCS-GICAMPF  1402

Query  1451  GYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGS  1510
             GYVTHGL+L ++  Y+R +KVP    ++S + +   N  +  + +TPE  FI  ++  G 
Sbjct  1403  GYVTHGLDLAQSGNYVRQVKVPYVCLLASKEQIPIMNSDV--AIQTPETAFINNVTSNGG  1460

Query  1511  YKDWSY-SGQSTQLGI---EFLKRGDKSVYYTSNPTTFHLDGEVITFDNL---KTLLSLR  1563
             Y  W   SG      +   + L    +++ Y  N      +   + F +L   +  L+ R
Sbjct  1461  YHSWHLVSGDLIVKDVCYKKLLHWSGQTICYADNKFYVVKNDVALPFSDLEACRAYLTSR  1520

Query  1564  EVR--TIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVL  1621
               +   I+V  T+D +N  T +++ + T+ +Q G T+  G D++   P     G++ +V 
Sbjct  1521  AAQQVNIEVLVTIDGVNFRTVILNDTTTFRKQLGATFYKGVDISDAFPTVKMGGESLFVA  1580

Query  1622  PN-DDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
              N  ++ +V   EYY T+D +FL RY S     ++WK+   +G+ S+K ++ NCY+   +
Sbjct  1581  DNLSESEKVVLKEYYGTSDVTFLQRYYSLQPLVQQWKFVVHDGVKSLKLSNYNCYINATI  1640

Query  1681  LTLQQI-ELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
             + +  + ++KF  PALQ+AY R + G+  +F ALI+AY + T     D  + +  L   A
Sbjct  1641  MMIDMLHDIKFVVPALQNAYLRYKGGDPYDFLALIMAYGDCTFDNPDDEAKLLHTLLAKA  1700

Query  1740  NLD-SCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV  1798
              L  S K V    C  CG +     G+ A +Y G  S E+ +      C CG    + LV
Sbjct  1701  ELTVSAKMVWREWCTVCGIRDIEYTGMRACVYAGVNSMEELQSVFNETCVCGSVKHRQLV  1760

Query  1799  QQESPFVMMSAPPAQYELKHGTFTCASEYTGNY------QCGHYKHITSKETL-YCIDGA  1851
             +  +P++++S      E+K  T T       N         GHY HI  K+ L Y  D  
Sbjct  1761  EHSAPWLLVSG---LNEVKVSTSTDPIYRAFNVFQGVETSVGHYVHIRVKDGLFYKYDSG  1817

Query  1852  LLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQP  1911
              LTK+S+ K  +T V+Y    YT     V Y LDGV   E++P L NYY KD  Y+T +P
Sbjct  1818  SLTKTSDMKCKMTSVWYPTVRYTADCNVVVYDLDGVTKVEVNPDLSNYYMKDGKYYTSKP  1877

Query  1912  -IDLVPNQPYPNASFDNFKFV-CDNIKFADDL----NQLTGYK--KPASRELKVTFFPDL  1963
              I   P    P + + N   V  D    +D +    N L G+   KP S++L  +  P+ 
Sbjct  1878  TIKYSPATILPGSVYSNSCLVGVDGTPGSDTISKFFNDLLGFDETKPISKKLTYSLLPNE  1937

Query  1964  NGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSN  2023
             +GDV+  ++ +Y P +KKG  L  KPI+W  N   + A  KPN   +R L+   P+   N
Sbjct  1938  DGDVLLSEFSNYNPVYKKGVMLKGKPILWVNNGVCDSALNKPNRASLRQLYDVAPIVLDN  1997

Query  2024  SFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTE---VVGDIILKPA  2080
              + VL+   +Q       E   PV ++V   P   + ++E   K      V G+      
Sbjct  1998  KYTVLQDNTSQ-----LVEHNVPVVDDV---PITTRKLIEVKCKGLNKPFVKGNFSFVND  2049

Query  2081  NNSLKITEEVGHTDLMAAYVD-NSSLTIKKPNELSRVLGLKTLATHGLAAV  2130
              N + + + +G T+L A YVD N+   + + N  S +  L T+ +  L  V
Sbjct  2050  PNGVTVVDTLGLTELRALYVDINTRYIVLRDNNWSSLFKLHTVESGDLQIV  2100


 Score =  250 bits (638),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 314/1301 (24%), Positives = 531/1301 (41%), Gaps = 186/1301 (14%)

Query  8     FNEKT--HVQLSLPVLQVRDV---LVRGFGDSVEEVLSEARQHLKD-GTCGLVEVE-KGV  60
             +NEK   HV  ++P+    D+   L   F D  E   ++    LK+ G    V +  +  
Sbjct  21    YNEKRSDHVACTVPLCDTDDMACKLTPWFEDG-ETAFNQVSSILKEKGKILFVPMHMQRA  79

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGR-----SGETLGVLVPHVGEIP  115
             +  L  P V++           H +V  +A  + +         + + LG+  P+   + 
Sbjct  80    MKFLPGPRVYLVERLTGGMLSKHFLVNQLAYKDQVGAAMMRTTLNAKPLGMFFPYDSSLE  139

Query  116   VAYRKVLLRKNGNKGAGGHSYGADLKS---FDLGDELGTDPYEDFQENWNTKHSSGVTRE  172
                   LLRKNG  G        D K     ++ D+L  DP   + +N            
Sbjct  140   TGEYTFLLRKNGLGGQLFRERPWDRKETPYVEILDDLEADPTGKYSQN------------  187

Query  173   LMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSE-QLDF---IDTKRGV  228
             L+++L GG     +D   CG +G P+     ++A+ G    TL++ ++D    +D+ R +
Sbjct  188   LLKKLIGGDCIP-IDQYMCGKNGKPIADYAKIVAKEGLT--TLADIEVDVKSRMDSDRFI  244

Query  229   YCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRV  288
                 +  + + W   R    Y  QT F I    + D      P   F + S I  + P +
Sbjct  245   -VLNKKLYRVVWNVTRRNVPYPKQTAFTIVSVVQCDD-KDSVPEHTFTIGSQILMVSP-L  301

Query  289   EKKKLDGFMGRIRSVYPVASPNECNQ---MCLSTLMKCDHCGETSWQTGDFVKATCEFCG  345
             +      F  + R +Y     +   Q   +  S  + C+ CG  +W TG+ ++     CG
Sbjct  302   KATNNKNFNLKQRLLYTFYGKDAVQQPGYIYHSAYVDCNACGRGTWCTGNAIQGFACDCG  361

Query  346   TENLTKE-GATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGR--  402
                   +    + G +P+NA+    CP  +N      HS A+ +N    K  +  GG+  
Sbjct  362   ANYSANDVDLQSSGLVPRNALFLANCPCANNGAC--SHSAAQVYNILDGKACVEVGGKSF  419

Query  403   TIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLE----ILQKEK  458
             T+ FGG V++Y+GC +   Y+VPRA + +       +  G  G  D ++E     L+K +
Sbjct  420   TLTFGGVVYAYMGCCDGTMYFVPRAKSCVS-RIGDAIFTGCTGTWDKVVETANLFLEKAQ  478

Query  459   VNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN--FKVTKGKA  516
              ++N    F L E   ++LA  S +TS F E        +++++ +   N  F VT G  
Sbjct  479   RSLNFCQQFALTE---VVLAILSGTTSTFEELRDLCHNASYEKVRDHLVNHGFVVTIGDY  535

Query  517   KKGAWNIGEQ----KSILSPLYAFAS--EAARVVRSIFSRTLETAQNSVRVLQKAAITIL  570
              + A NIG       +I +P  AF    E+ + V +I     +   N    L   +  I+
Sbjct  536   IRDAINIGANGVCNATINAPFIAFTGLGESFKKVSAI---PWKICSNLKSALDYYSSNIM  592

Query  571   DGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEK----LKP  626
               +  Y +   D   F   L     + +A  +  V++   +    + GTV       L  
Sbjct  593   FRVFPYDIP-CDVSNFVELLLDCGKLTVA-TSYFVLRYLDEKFDTVLGTVSSACQTALSS  650

Query  627   VLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFL  686
              L+      +    F+ D +++ K +            V  A+   + VQ    +++K +
Sbjct  651   FLNACVAASRATAGFINDMFKLFKVLMHKLYVYTSCGYVAVAEHSSKIVQQVLDIMSKAM  710

Query  687   ALCADSIIIGGAKLKALNL-GETFVTHSKGLYRKCVKSREET-----GLLMPLKAPKEII  740
              L   ++   G KL A+   G   +  + G Y  C+ ++ +T      L++P    K+ +
Sbjct  711   KLLHTNVSWAGTKLSAIIYEGREALLFNSGTYF-CLSTKAKTLQGQMNLVLPGDYNKKTL  769

Query  741   FL-----EGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKD  795
              +       +T+     +  V +  G L+P    T+E   + +VG  V ++  + +  +D
Sbjct  770   GILDPVPNADTIDVNANSTVVDVVHGQLEP----TNEHGPSMIVGNYVLVSDKLFVRTED  825

Query  796   TEKYCALAPNMMVTNNTFTLKGGAPTK-VTFGDDTVIEVQGYKSVNITFELDERIDKVL-  853
              E Y  L  N  V +  F LKGG P+K VTFGD   +EV  Y+SV+IT+++   +D +L 
Sbjct  826   EEFY-PLCTNGKVVSTLFRLKGGMPSKKVTFGDVNTVEVTAYRSVSITYDIHPVLDALLS  884

Query  854   NEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGE  913
             + K + +TVE    V +F  V+ D V+  L P+       G D++++     Y++++ G+
Sbjct  885   SSKLATFTVEKDLLVEDFVDVIKDEVLTLLTPLLRGYDIDGFDVEDFIDVPCYVYNQDGD  944

Query  914   FKLASHMYCSFYP--------------------PDEDEEEGDCEE-EEFEPSTQYEYGTE  952
                +S+M  S  P                    P  D+EE      EE  P         
Sbjct  945   CAWSSNMTFSINPVEDVEEVEEFIEDDYLSDELPIADDEEAWARAVEEVMPLDDILVAEI  1004

Query  953   DDYQGKPLEFGATSA---ALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQ  1009
             +  +  PLE    S     ++  E QE      DS  +     G  D     +  + E  
Sbjct  1005  ELEEDPPLETALESVEAEVVETAEAQEPSVESIDSTPSTSTVVGENDLSVKPMSRVAETD  1064

Query  1010  PQLEME----------LTPVV----------QTIEVNSFSGYLKLTDNVYIKNAD-----  1044
               LE+E          +T +V          Q   V+S     + ++N   + +D     
Sbjct  1065  DVLELETAVVGGPVSDVTAIVTNDIVSVEQAQQCGVSSLPIQDEASENQVHQVSDLQGNE  1124

Query  1045  ---------IVEEAKKVKP---------------TVVVNAANVYLKHGGGVAGALNK---  1077
                      IV+  + +KP               TV+ N+  + L     +A  L K   
Sbjct  1125  LLCSETKVEIVQPRQDLKPRRSRKSKVDLSKYKHTVINNSVTLVLGDAIQIASLLPKCIL  1184

Query  1078  --------------------ATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHV  1117
                                 A+   +Q ESD+YI+ NGPL VG S +L GH LA   LHV
Sbjct  1185  VNAANRHLKHGGGIAGVINKASGGDVQEESDEYISNNGPLHVGDSVLLKGHGLADAILHV  1244

Query  1118  VGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADP  1158
             VGP+    ED  LLK  Y+ FN+H +++ PL+SAGIF  DP
Sbjct  1245  VGPDARNNEDAALLKRCYKAFNKHTIVVTPLISAGIFSVDP  1285


> sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain A59) OX=11142 GN=rep PE=1 SV=1
Length=7176

 Score = 1831 bits (4742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1081/2906 (37%), Positives = 1597/2906 (55%), Gaps = 160/2906 (6%)

Query  1568  IKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTL  1627
             + V  TVD +N  +  V     +G+  G  + DG +VTK++    ++GK F+   +    
Sbjct  1611  VDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEA  1670

Query  1628  RVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIE  1687
              + A +     D   L +Y + L   K W         + K ++NNCY+  A L LQ + 
Sbjct  1671  DLVAVKDAFGFDEPQLLKYYTMLGMCK-WPVVVCGNYFAFKQSNNNCYINVACLMLQHLS  1729

Query  1688  LKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRV  1747
             LKF     Q+A+   R+G+   F +L+LA  +    E  D  + M  + + A+L      
Sbjct  1730  LKFPKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCN  1789

Query  1748  LNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
             L  VCK CG +Q   KGV+AVM+ GTL      +G  I CTCG +   +  Q   PF++ 
Sbjct  1790  LEFVCK-CGVKQEQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLV-HCTQFNVPFLIC  1847

Query  1808  SAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVF  1867
             S  P   +L       A+ +TG    GHY H+  K      D   + K SE KG  TD  
Sbjct  1848  SNTPEGRKLPDDVVA-ANIFTGG-SVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCL  1905

Query  1868  YKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--NAS  1924
             Y +N   T +    T+ LD V C E  P L  YY +   Y+T +PI     + +   +  
Sbjct  1906  YLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQYYCESGKYYT-KPIIKAQFRTFEKVDGV  1964

Query  1925  FDNFKFVCDNIKFADDLNQLTGYK-KPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGA  1983
             + NFK V  +I  A+ LN   G+       E K+T +P   GDVV      Y   +  G 
Sbjct  1965  YTNFKLVGHSI--AEKLNAKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGC  2022

Query  1984  KLLHKPIVW--HVNNATNKATY--KPNTWCIRCLWSTKPVETSNSFDV-----------L  2028
                 KP+VW  H   +    TY  +P+  C    ++  PV+ S   D            +
Sbjct  2023  ITFGKPVVWLGHEEASLKSLTYFNRPSVVC-ENKFNVLPVDVSEPTDKGPVPAAVLVTGV  2081

Query  2029  KSEDAQGMDNLACEDLKPVSE--------EVVENPTIQ-KDVLECNV----KTTEVVGDI  2075
                DA     +A E     S         EV + P++   DV E  +    K  +V G +
Sbjct  2082  PGADASAGAGIAKEQKACASASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSV  2141

Query  2076  ILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPW  2135
             ++    +  K+ + +   D+   ++      +   NELSR+             VNS   
Sbjct  2142  VVNDPTSETKVVKSLSIVDVYDMFLTGCKYVVWTANELSRL-------------VNS---  2185

Query  2136  DTIANYAKPFLNKVVSTTTNIVTRCLNR-------------VCTNYMPYFFTLLLQLCTF  2182
              T+  Y K  + K+V+    ++ R   +              C   + +F         F
Sbjct  2186  PTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKVVKAKAIACYCAVKWFLLYCFSWIKF  2245

Query  2183  TRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLIN--------IIIW--  2232
                 N+  K    T +A    K   K C  A  N L++ N+S +           ++W  
Sbjct  2246  ----NTDNKVIYTTEVAS---KLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFN  2298

Query  2233  FLLLSVCLGSL---------IYSTAALGVLMSNLGMPSYCTGYRE---GYLNSTNVTIAT  2280
             FL  +V L             +    +    +  G+ + C  Y+    GY +S       
Sbjct  2299  FLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDFYQVTDLGYRSS-------  2351

Query  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITIS---SFKWDLTAFGLVAEWFLAYILFTRF  2337
             +C GS+ C +C SG D LD Y ++  +Q  +    SF + ++ F LV E  + Y L+T  
Sbjct  2352  FCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDY-ISLFKLVVELVIGYSLYTVC  2410

Query  2338  FYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWK  2395
             FY L +   MQL  ++    F+  +  W   L + +  M P   ++R YI   + Y V+ 
Sbjct  2411  FYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYC  2470

Query  2396  SYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNC  2455
                HV+ GC+   C+ CYKRNR+ RV+C+T+V G  R + V ANGG GFC  H WNC+NC
Sbjct  2471  LCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNC  2530

Query  2456  DTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYER  2515
             +++  G+TFI+ E A DLS + KRP+NPTD + Y V  V     S+ L++++ GQ+ Y+ 
Sbjct  2531  NSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFYERDGQRVYDD  2590

Query  2516  HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQA  2575
              + S FV+++ L  +  KG    +V+V + ++  +++    A+V+Y+Q + +P+L++++ 
Sbjct  2591  VNASLFVDMNGLLHSKVKGVPETHVVVVENEA--DKAGFLGAAVFYAQSLYRPMLMVEKK  2648

Query  2576  LVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFIS  2635
             L++       V+  MFD YV++  +  +V  + L + V  A   L + V L+ V+ TFI 
Sbjct  2649  LITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFIG  2708

Query  2636  AARQG-FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDC  2694
              AR+   +DSDVETK + + +  +  + ++ T +SCNN + TY K + +   DLG  I  
Sbjct  2709  CARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAADLGVLIQN  2768

Query  2695  SARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVV  2754
             +A+H+ A VAK+ N+A IW+V  F  LS  L+ ++R A  K  L  KLT       V ++
Sbjct  2769  NAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNKQEANVPIL  2828

Query  2755  TTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDG  2814
             TT  +LKGG + +  L+ L    L+   V    + + P + + K          +K ID 
Sbjct  2829  TTPFSLKGGAVFSRMLQWLFVANLICFIV---LWALMPTYAVHKSDMQLPLYASFKVIDN  2885

Query  2815  GVTRDIASTDTCFANKHADFDTWFSQRGG--SYTNDKACPLIAAVITREVGFVVPGLPGT  2872
             GV RD++ TD CFANK   FD W+    G   Y N KACP++ AVI +++G  +  +P T
Sbjct  2886  GVLRDVSVTDACFANKFNQFDQWYESTFGLAYYRNSKACPVVVAVIDQDIGHTLFNVPTT  2945

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +LR      LHF+   F+     CYTP   I Y +F  S CVL++ CT+   A G P PY
Sbjct  2946  VLR-YGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGTPHPY  3004

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLEGSVRVVTTFDSEYCRHGTCER  2991
             CY   V+  +  Y SL P  RY L   +  I+FP    EG VRVV T    YCR G CE 
Sbjct  3005  CYTGGVMHNASLYSSLAPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVGLCEE  3064

Query  2992  SEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGG  3051
             +E G+C + +  WVLNN YYR++PG FCG +A +L+  +   L++PI    ++AS VAG 
Sbjct  3065  AEEGICFNFNRSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVRPIDFFALTASSVAGA  3124

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLY  3111
             I+AI+V    YY ++ +RAFG+Y+ VV  N +++ ++F +L +  VY  L  +Y+  Y Y
Sbjct  3125  ILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYACFYFY  3184

Query  3112  LTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVS  3171
              T Y  +++S + H+QW+VM+  ++P W  I Y+  + + H  W FS    R++     S
Sbjct  3185  TTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVVSNHALWLFS--YCRKIGTEVRS  3242

Query  3172  FSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAAC  3231
               TFEE AL TF++ KE Y KL++ V      +NRYL+LYNKY+YFSG MDT +YREAAC
Sbjct  3243  DGTFEEMALTTFMITKESYCKLKNSV--SDVAFNRYLSLYNKYRYFSGKMDTAAYREAAC  3300

Query  3232  CHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTL  3290
               LAKA+  F+ N+G+DVLYQPP  S+T++ LQSG  KM  P+ KVE C+V VT G  TL
Sbjct  3301  SQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCIVSVTYGNMTL  3360

Query  3291  NGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL  3350
             NGLWLDD VYCPRHVIC+S DM +P+Y +LL R ++ +F V +G + L V+ + MQ C L
Sbjct  3361  NGLWLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSGRMSLTVMSYQMQGCQL  3420

Query  3351  KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGS  3410
              L V   NP TPKY F  ++PG+TF+VLA YNG P G +   +R + TIKGSFL GSCGS
Sbjct  3421  VLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGS  3480

Query  3411  VGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAW  3470
             VG+ +  D V F YMH +EL TG H GTD  GNFYGP+ D Q  Q    D T TVNV+AW
Sbjct  3481  VGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAW  3540

Query  3471  LYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAS  3530
             LYAA+ N   WF+   + +L +FN+ AM   +  +  D V  L  L++ TG+ V  + A+
Sbjct  3541  LYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLV--LDALASMTGVTVEQVLAA  3598

Query  3531  LKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTS  3590
             +K  L +G  G+ ILGS +LEDE TP DV +Q +GV  QS   R IKGT  W+L +    
Sbjct  3599  IKR-LHSGFQGKQILGSCVLEDE-TPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLF  3656

Query  3591  LLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYF  3650
               ++    +W++F ++  +  L   +  +   +FAM+ +KHKH +L ++++P L T    
Sbjct  3657  CSIISAFVKWTMFMYVTTH-MLGVTLCALCFVSFAMLLIKHKHLYLTMYIMPVLCTFYTN  3715

Query  3651  NMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILM---TARTVYDDGARR  3707
              +V    S+      WL     ++  +   D V+Y   VVLL+ M   T R++  D    
Sbjct  3716  YLVVYKQSFRGLAYAWLSHFVPAVD-YTYMDEVLY--GVVLLVAMVFVTMRSINHDVFSI  3772

Query  3708  VWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARG-IVFMCVEYC  3766
             ++ +  +++LV   Y+G  L++ + ++  + S+   Y+   TT++ LA   ++   +   
Sbjct  3773  MFLVGRLVSLVSMWYFGANLEEEVLLF--LTSLFGTYTW--TTMLSLATAKVIAKWLAVN  3828

Query  3767  PIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQ  3826
              ++F     ++ ++L Y  +GY C CY+G+  LLN  FR+ LGVY+Y +S QE RYMN+ 
Sbjct  3829  VLYFTDVPQIKLVLLSYLCIGYVCCCYWGILSLLNSIFRMPLGVYNYKISVQELRYMNAN  3888

Query  3827  GLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSK  3886
             GL PP+NS +A  LN KLLG+GG P I+V+ +QS+++DVKC +VVLL+ LQ L + S+SK
Sbjct  3889  GLRPPRNSFEALMLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSK  3948

Query  3887  LWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVD------INKLCEEMLDNRAT  3940
             LW  C  LHN+IL   D + AF+K+  LL VL +   AVD      I ++ ++ + +   
Sbjct  3949  LWQYCSTLHNEILATSDLSMAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTV  4008

Query  3941  LQAIASEFSSLPSYAAFATAQEAYEQAVANGDS-EVVLKKLKKSLNVAKSEFDRDAAMQR  3999
             LQA+ SEF ++ S+  +  A++  ++A A+G + +  +K+L+K+ N+AKS ++RD A+ R
Sbjct  4009  LQALQSEFVNMASFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVAR  4068

Query  4000  KLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPL  4059
             KLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+RKLDN ALN+I++NA  GCVPL
Sbjct  4069  KLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPL  4128

Query  4060  NIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNS  4119
             N IP  T+  L +++PD   +    D    TYA  +W IQ + DAD  + QL+EI +   
Sbjct  4129  NAIPSLTSNTLTIIVPDKQVFDQVVDNVYVTYAGNVWHIQFIQDADGAVKQLNEIDV---  4185

Query  4120  PNLAWPLIVTALRAN--SAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKG  4177
              N  WPL++ A R N  S V LQNNEL P  LR     +G+     T      YYNTT  
Sbjct  4186  -NSTWPLVIAANRHNEVSTVVLQNNELMPQKLRTQVVNSGSDMNCNTPTQ--CYYNTTGT  4242

Query  4178  GRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNL  4237
             G+ V A+LSD   LK+ +  K DG   +  EL+PPC+F     KG K+KYLYF+KG N L
Sbjct  4243  GKIVYAILSDCDGLKYTKIVKEDGNCVV-LELDPPCKFSVQDVKGLKIKYLYFVKGCNTL  4301

Query  4238  NRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKM  4297
              RG V+G+L++TVRLQAG ATE  +NS +LS CAF+VD  K Y DY+  GG P+TNCVKM
Sbjct  4302  ARGWVVGTLSSTVRLQAGTATEYASNSAILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKM  4361

Query  4298  LCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCA  4357
             LC H GTG AIT+ PEA  +Q+S+GGAS C+YCR  ++HP+  G C L+GK+VQ+P    
Sbjct  4362  LCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLG-I  4420

Query  4358  NDPVGFTLKNTVCTVCGMWKGYGCSC  4383
              DPV + L + VC VCG W+   CSC
Sbjct  4421  KDPVSYVLTHDVCQVCGFWRDGSCSC  4446


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 118/252 (47%), Gaps = 20/252 (8%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T NV     D+++  + V   V+VN AN  + HG GVAGA+ +   +A   E+ D +  
Sbjct  1320  ITPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKA  1379

Query  1094  NGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQ---LLKSAYENFNQHEVLLAPLLS  1150
              G  +VG     +G  L K  L++VGP+  +G   Q   LL+ AY++ N+ + ++  L+S
Sbjct  1380  QGVCQVGECYESAGGKLCKKVLNIVGPDA-RGHGKQCYSLLERAYQHINKCDNVVTTLIS  1438

Query  1151  AGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVS-SFLEMKSEKQVEQKIAEIPKE  1209
             AGIF      SL   +  V  NV L   +++ +D +       +   K +  ++A+    
Sbjct  1439  AGIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCR  1498

Query  1210  EVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLL------YIDINGNL  1263
             +VK F+T +  S+          ++C       L+E + L  ++ L      ++  N + 
Sbjct  1499  DVK-FVTNACSSLFS--------ESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDC  1549

Query  1264  HPDSATLVSDID  1275
              P    LV+  D
Sbjct  1550  LPTDWRLVNKFD  1561


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 108/457 (24%), Positives = 188/457 (41%), Gaps = 59/457 (13%)

Query  569   ILDGISQYSLRLIDA-MMFTSDLA------TNNLVVMAYITGGVVQLTSQWLTNIFGTVY  621
             +LDG+   S  LI +   FTS +       T+  + MA +    V++ ++++  + G + 
Sbjct  576   LLDGLVPRSYYLIKSGQAFTSMMVNFSHEVTDMCMDMALLFMHDVKVATKYVKKVTGKLA  635

Query  622   EKLKPVLDWLEEKFKEGVEFLRD------GWEIVKFISTCACEIVGGQIVTCAKEIKESV  675
              + K +   +  K  E  +   D      GW   + ++      V   ++T  +E+ E V
Sbjct  636   VRFKALGVAVVRKITEWFDLAVDIAASAAGWLCYQLVN--GLFAVANGVITFVQEVPELV  693

Query  676   QTFFKLVNKFLALCADSI---IIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMP  732
             + F      F  +  DS+   I+ G  +         +  SK +Y   V  +  +  +MP
Sbjct  694   KNFVDKFKAFFKVLIDSMSVSILSGLTVVKTASNRVCLAGSK-VYE--VVQKSLSAYVMP  750

Query  733   LKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTPVCINGLML  790
             +    E   L GE  P        V +   +  ++ P +     + P     +CI   + 
Sbjct  751   VGC-SEATCLVGEIEPA-------VFEDDVVDVVKAPLTYQGCCKPPTSFEKICIVDKLY  802

Query  791   LEIKDTEKYCALAPN--MMVTNNTFTLKGGAPTKVTFGDD-TVIEVQGYKSVNITFELDE  847
             +     + Y  +  N  + V +  +     A  KV F D   V ++   + + ITF LD 
Sbjct  803   MAKCGDQFYPVVVDNDTVGVLDQCWRFPC-AGKKVEFNDKPKVRKIPSTRKIKITFALDA  861

Query  848   RIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPLGIDLDEWSMAT  904
               D VL++ CS + V+    ++E   VV DAV  TL P  E   + T +   LD  +   
Sbjct  862   TFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDY  921

Query  905   YYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGA  964
              YLFDE G+  +A  MYCSF  PD++    DC   +   + + +   +DD         A
Sbjct  922   VYLFDEGGDEVIAPRMYCSFSAPDDE----DCVAADVVDADENQ---DDD---------A  965

Query  965   TSAALQPEEEQEED-----WLDDDSQQTVGQQDGSED  996
               +A+   + QEED      ++ DS+  V      E+
Sbjct  966   EDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEE  1002


> sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=1a PE=3 SV=1
Length=4421

 Score = 1830 bits (4741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1066/2894 (37%), Positives = 1592/2894 (55%), Gaps = 128/2894 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1600  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1659

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1660  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1718

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1719  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1778

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1779  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1836

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1837  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1894

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1895  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  1953

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  1954  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2011

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2012  GCETFGKPVIWFCHDEASLNSLTY----------FNKPSFKSENRYSVL------SVDSV  2055

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2056  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2115

Query  2099  YVDNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2116  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2171

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCL--EA  2213
                R +      ++ + F  +  L  FT          + +    N       FCL  + 
Sbjct  2172  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKTIFYTTEIASKFTFNL------FCLALKN  2223

Query  2214  SFNYLKSPNFSKLINII-----IWF--LLLSVCLGSL---------IYSTAALGVLMSNL  2257
             +F   +   F K   ++      WF  L ++V              I+    +  + +  
Sbjct  2224  AFQTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKATF  2283

Query  2258  GMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---F  2314
             G+ + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     F
Sbjct  2284  GLVTICDFYSKLGVGFT----SHFCNGSFICELCHSGFDMLDTYAAIDFVQYEVDRRVLF  2339

Query  2315  KWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLV  2372
              + ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ + 
Sbjct  2340  DY-VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFVA  2398

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV R
Sbjct  2399  NMLPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVIR  2458

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V 
Sbjct  2459  YYDITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVVT  2518

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              +      + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V   +S  + +
Sbjct  2519  DIKQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVV--VESDADRA  2576

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +     
Sbjct  2577  NFLNAVVFYAQSLYRPILLVDKKLITTACNGISVTQIMFDVYVDTFMSHFDVDRKSFNNF  2636

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             V  A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ N
Sbjct  2637  VNIAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENYN  2696

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I   A+H+   VAK  NI+ IW +  F  L+  L+ +++ 
Sbjct  2697  NLVPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKVANISCIWFIDAFNQLTADLQHKLKK  2756

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V ++TT  +LKGG +++N L  L  ++L+      + + + 
Sbjct  2757  ACVKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFISLICFI---LLWALL  2813

Query  2792  PVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTNDK  2849
             P + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N  
Sbjct  2814  PTYSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSVYYHNSM  2873

Query  2850  ACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFA  2909
              CP++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF 
Sbjct  2874  DCPIVVAVMDEDIGSTMFNVPTKVLRY-GFHVLHFLTYAFASDSVQCYTPHIQISYNDFY  2932

Query  2910  TSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTY  2968
              S CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+  
Sbjct  2933  ASGCVLSSLCTMFKRGDGTPHPYCYTDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDVI  2992

Query  2969  LEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLT  3028
              EG VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L  
Sbjct  2993  SEGIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDFFDLFY  3052

Query  3029  NMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMS  3088
               F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ ++
Sbjct  3053  QFFSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVIVWCIN  3112

Query  3089  FTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICI  3148
             F +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  +
Sbjct  3113  FLMLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAMV  3172

Query  3149  STKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYL  3208
                H  W FS    R++  N  S STFEE +L TF++ K+ Y +L++ V      YNRYL
Sbjct  3173  IANHVLWLFS--YCRKIGVNVCSDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRYL  3228

Query  3209  ALYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFR  3267
             +LYNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG  
Sbjct  3229  SLYNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGIV  3288

Query  3268  KMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNH  3327
             KM  P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M  P+Y  LL R +  
Sbjct  3289  KMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCRVTLG  3348

Query  3328  NFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSG  3387
             +F + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P G
Sbjct  3349  DFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNGRPQG  3408

Query  3388  VYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGP  3447
              +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP
Sbjct  3409  AFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGNFYGP  3468

Query  3448  FVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQ  3507
             + D Q  Q    D   TVNV+AWLYAA++N   WF+     ++ DFN+ AM   +  +  
Sbjct  3469  YRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFSQVKA  3528

Query  3508  DHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVT  3567
             D V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV 
Sbjct  3529  DLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGVK  3585

Query  3568  FQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMM  3627
              QS  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M+
Sbjct  3586  LQSKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMML  3644

Query  3628  FVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYA  3686
              VKHKH +L ++++P L T+ Y N +V     +      WL     +++   + +     
Sbjct  3645  LVKHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGFTYVWLSHFVPAVNFTYVYEVFYGC  3704

Query  3687  SAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSG  3746
                V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+ 
Sbjct  3705  ILCVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYTW  3762

Query  3747  VVTTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFR  3805
               TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  FR
Sbjct  3763  --TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVFR  3820

Query  3806  LTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDV  3865
             + +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++DV
Sbjct  3821  MPMGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTDV  3880

Query  3866  KCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAV  3925
             KC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AF+K+  LL VL S   AV
Sbjct  3881  KCANVVLLNCLQHLHVASNSKLWQYCSVLHNEILSTSDLSVAFDKLAQLLIVLFSNPAAV  3940

Query  3926  D------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLK  3978
             D      I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +K
Sbjct  3941  DTKCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQIK  4000

Query  3979  KLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLR  4038
             +L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+R
Sbjct  4001  QLEKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVR  4060

Query  4039  KLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEI  4098
             KLDN ALN+I++NA  GCVPL+ IP   A  L ++IPD   +    D    TYA ++W I
Sbjct  4061  KLDNQALNSILDNAVKGCVPLSAIPALAANTLTIIIPDKQVFDKVVDNVYVTYAGSVWHI  4120

Query  4099  QQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCAA  4156
             Q V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     +
Sbjct  4121  QTVQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVNS  4176

Query  4157  GT-----TQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEP  4211
             G+       T C       YYN    GR V A+LSD+  LK+ +  K DG   +  EL+P
Sbjct  4177  GSDINCNIPTQC-------YYNNVSSGRIVYAVLSDVDGLKYTKIMKDDGNCVV-LELDP  4228

Query  4212  PCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCA  4271
             PC+F     KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS CA
Sbjct  4229  PCKFSIQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLCA  4288

Query  4272  FAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR  4331
             F+VD  K Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YCR
Sbjct  4289  FSVDPKKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYCR  4348

Query  4332  CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPML  4391
               ++HP+  G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC       +
Sbjct  4349  ARVEHPDVDGICKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSCVG-SSVAV  4406

Query  4392  QSADAQSFLNGFAV  4405
             QS D  +FLNG  V
Sbjct  4407  QSKDL-NFLNGLGV  4419


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1308  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1367

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1368  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1427

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1428  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1462


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 171/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G            F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGF-----------FVVSQANLNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDHAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    E   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKEHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 44.7 bits (104),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1095  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1154

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++AV + G + 
Sbjct  1155  IPKAIVLPQGGYVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDAVFFYGDI-  1209

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1210  -------VSHVCKCGHNMT--LIAADLP  1228


> sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=1a PE=1 SV=1
Length=4471

 Score = 1826 bits (4729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1066/2889 (37%), Positives = 1593/2889 (55%), Gaps = 118/2889 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1650  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1709

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1710  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1768

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1769  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1828

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1829  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1886

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1887  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1944

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1945  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  2003

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  2004  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2061

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2062  GCETFGKPVIWFCHDEASLNSLTY----------FNKPSFKSENRYSVLS------VDSV  2105

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2106  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2165

Query  2099  YVDNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2166  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2221

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCL--EA  2213
                R +      ++ + F  +  L  FT          + +    N       FCL  + 
Sbjct  2222  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKTIFYTTEIASKFTFNL------FCLALKN  2273

Query  2214  SFNYLKSPNFSKLINII-----IWF--LLLSVCLGSL---------IYSTAALGVLMSNL  2257
             +F   +   F K   ++      WF  L ++V              I+    +  + +  
Sbjct  2274  AFQTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKATF  2333

Query  2258  GMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---F  2314
             G+ + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     F
Sbjct  2334  GLVTICDFYSKLGVGFT----SHFCNGSFICELCHSGFDMLDTYAAIDFVQYEVDRRVLF  2389

Query  2315  KWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLV  2372
              + ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ + 
Sbjct  2390  DY-VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFVA  2448

Query  2373  QMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRR  2432
              M P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV R
Sbjct  2449  NMLPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVIR  2508

Query  2433  SFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVD  2492
              + + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V 
Sbjct  2509  YYDITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVVT  2568

Query  2493  SVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEES  2552
              +      + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V   +S  + +
Sbjct  2569  DIKQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVV--VESDADRA  2626

Query  2553  SAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTL  2612
             +  +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +     
Sbjct  2627  NFLNAVVFYAQSLYRPILLVDKKLITTACNGISVTQTMFDVYVDTFMSHFDVDRKSFNNF  2686

Query  2613  VATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCN  2671
             V  A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ N
Sbjct  2687  VNIAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENYN  2746

Query  2672  NYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRS  2731
             N + TY K +N+   DLG  I   A+H+   VAK+ NI+ IW +  F  L+  L+ +++ 
Sbjct  2747  NLVPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKAANISCIWFIDAFNQLTADLQHKLKK  2806

Query  2732  AAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLIT  2791
             A  K  L  KLT       V ++TT  +LKGG +++N L  L  V+L+      + + + 
Sbjct  2807  ACVKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFVSLICFI---LLWALL  2863

Query  2792  PVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTNDK  2849
             P + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N  
Sbjct  2864  PTYSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSVYYHNSM  2923

Query  2850  ACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFA  2909
              CP++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF 
Sbjct  2924  DCPIVVAVMDEDIGSTMFNVPTKVLRH-GFHVLHFLTYAFASDSVQCYTPHIQISYNDFY  2982

Query  2910  TSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTY  2968
              S CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+  
Sbjct  2983  ASGCVLSSLCTMFKRGDGTPHPYCYSDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDVI  3042

Query  2969  LEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLT  3028
              EG VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L  
Sbjct  3043  SEGIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDLFDLFY  3102

Query  3029  NMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMS  3088
               F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ ++
Sbjct  3103  QFFSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVVVWCIN  3162

Query  3089  FTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICI  3148
             F +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  +
Sbjct  3163  FLMLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAMV  3222

Query  3149  STKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYL  3208
                H  W FS    R++  N  S STFEE +L TF++ K+ Y +L++ V      YNRYL
Sbjct  3223  IANHVLWLFS--YCRKIGVNVCSDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRYL  3278

Query  3209  ALYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFR  3267
             +LYNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG  
Sbjct  3279  SLYNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGIV  3338

Query  3268  KMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNH  3327
             KM  P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M  P+Y  LL R +  
Sbjct  3339  KMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLG  3398

Query  3328  NFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSG  3387
             +F + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P G
Sbjct  3399  DFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNGRPQG  3458

Query  3388  VYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGP  3447
              +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP
Sbjct  3459  AFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGP  3518

Query  3448  FVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQ  3507
             + D Q  Q    D   TVNV+AWLYAA++N   WF+     +  DFN+ AM   +  +  
Sbjct  3519  YRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKA  3578

Query  3508  DHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVT  3567
             D V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV 
Sbjct  3579  DLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGVK  3635

Query  3568  FQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMM  3627
              QS  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M+
Sbjct  3636  LQSKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMML  3694

Query  3628  FVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYA  3686
              VKHKH +L ++++P L T+ Y N +V     +      WL     +++   + +     
Sbjct  3695  LVKHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGFTYVWLSYFVPAVNFTYVYEVFYGC  3754

Query  3687  SAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSG  3746
                V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+ 
Sbjct  3755  ILCVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYTW  3812

Query  3747  VVTTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFR  3805
               TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  FR
Sbjct  3813  --TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVFR  3870

Query  3806  LTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDV  3865
             + +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++DV
Sbjct  3871  MPMGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTDV  3930

Query  3866  KCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAV  3925
             KC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AF+K+  LL VL +   AV
Sbjct  3931  KCANVVLLNCLQHLHVASNSKLWQYCSVLHNEILSTSDLSVAFDKLAQLLIVLFANPAAV  3990

Query  3926  D------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLK  3978
             D      I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +K
Sbjct  3991  DTKCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQIK  4050

Query  3979  KLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLR  4038
             +L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+R
Sbjct  4051  QLEKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVR  4110

Query  4039  KLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEI  4098
             KLDN ALN+I++NA  GCVPL+ IP   A  L +VIPD   +    D    TYA ++W I
Sbjct  4111  KLDNQALNSILDNAVKGCVPLSAIPALAANTLTIVIPDKQVFDKVVDNVYVTYAGSVWHI  4170

Query  4099  QQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCAA  4156
             Q V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     +
Sbjct  4171  QTVQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVNS  4226

Query  4157  GTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFV  4216
             G+      +     YYN    GR V A+LSD+  LK+ +  K DG   +  EL+PPC+F 
Sbjct  4227  GSDMNC--NIPTQCYYNNGSSGRIVYAVLSDVDGLKYTKIMKDDGNCVV-LELDPPCKFS  4283

Query  4217  TDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDA  4276
                 KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS CAF+VD 
Sbjct  4284  IQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLCAFSVDP  4343

Query  4277  AKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH  4336
              K Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YCR  ++H
Sbjct  4344  KKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYCRARVEH  4403

Query  4337  PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADA  4396
             P+  G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC       +QS D 
Sbjct  4404  PDVDGICKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSCVG-SSVAVQSKDL  4461

Query  4397  QSFLNGFAV  4405
              +FLNGF V
Sbjct  4462  -NFLNGFGV  4469


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1358  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1417

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1418  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1477

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1478  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1512


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 172/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G+           F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGL-----------FVVSQANFNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDQAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    E   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKEHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 43.5 bits (101),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1145  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1204

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++A+ + G + 
Sbjct  1205  IPKAIVLPQGGFVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDALFFYGDI-  1259

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1260  -------VSHVCKCGHNMT--LIAADLP  1278


> sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1
Length=7132

 Score = 1825 bits (4726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1059/2873 (37%), Positives = 1582/2873 (55%), Gaps = 128/2873 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1600  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1659

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1660  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1718

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1719  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1778

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1779  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1836

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1837  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1894

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1895  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  1953

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  1954  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2011

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2012  GCETFGKPVIWFCHDEASLNSLTY----------FNKPSFKSENRYSVL------SVDSV  2055

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2056  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2115

Query  2099  YVDNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2116  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2171

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASF  2215
                R +      ++ + F  +  L  FT          + +    N       FCL A  
Sbjct  2172  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKTIFYTTEIASKFTFNL------FCL-ALK  2222

Query  2216  NYLKSPNFSKLIN--------IIIWF--LLLSVCLGSL---------IYSTAALGVLMSN  2256
             N  ++  +S  I          + WF  L ++V              I+    +  + + 
Sbjct  2223  NAFQTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKAT  2282

Query  2257  LGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---  2313
              G+ + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     
Sbjct  2283  FGLVTICDFYSKLGVGFT----SHFCNGSFICELCHSGFDMLDTYAAIDFVQYEVDRRVL  2338

Query  2314  FKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINL  2371
             F + ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ +
Sbjct  2339  FDY-VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFV  2397

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV 
Sbjct  2398  ANMLPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVI  2457

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V
Sbjct  2458  RYYDITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVV  2517

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               +      + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V   +S  + 
Sbjct  2518  TDIKQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVV--VESDADR  2575

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +    
Sbjct  2576  ANFLNAVVFYAQSLYRPILLVDKKLITTACNGISVTQIMFDVYVDTFMSHFDVDRKSFNN  2635

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
              V  A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ 
Sbjct  2636  FVNIAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENY  2695

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I   A+H+   VAK  NI+ IW +  F  L+  L+ +++
Sbjct  2696  NNLVPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKVANISCIWFIDAFNQLTADLQHKLK  2755

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V ++TT  +LKGG +++N L  L  ++L+      + + +
Sbjct  2756  KACVKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFISLICFI---LLWAL  2812

Query  2791  TPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTND  2848
              P + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N 
Sbjct  2813  LPTYSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSVYYHNS  2872

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
               CP++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF
Sbjct  2873  MDCPIVVAVMDEDIGSTMFNVPTKVLRY-GFHVLHFLTYAFASDSVQCYTPHIQISYNDF  2931

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNT  2967
               S CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+ 
Sbjct  2932  YASGCVLSSLCTMFKRGDGTPHPYCYTDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDV  2991

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L 
Sbjct  2992  ISEGIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDFFDLF  3051

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
                F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ +
Sbjct  3052  YQFFSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVIVWCI  3111

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  
Sbjct  3112  NFLMLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAM  3171

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             +   H  W FS    R++  N  S STFEE +L TF++ K+ Y +L++ V      YNRY
Sbjct  3172  VIANHVLWLFS--YCRKIGVNVCSDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRY  3227

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG 
Sbjct  3228  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGI  3287

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M  P+Y  LL R + 
Sbjct  3288  VKMVSPTSKIEPCLVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCRVTL  3347

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3348  GDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNGRPQ  3407

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYG
Sbjct  3408  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFNGNFYG  3467

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   TVNV+AWLYAA++N   WF+     ++ DFN+ AM   +  + 
Sbjct  3468  PYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFSQVK  3527

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV
Sbjct  3528  ADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGV  3584

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M
Sbjct  3585  KLQSKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMM  3643

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V     +      WL     +++   + +    
Sbjct  3644  LLVKHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGFTYVWLSHFVPAVNFTYVYEVFYG  3703

Query  3686  ASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYS  3745
                 V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+
Sbjct  3704  CILCVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYT  3761

Query  3746  GVVTTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
                TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  F
Sbjct  3762  W--TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVF  3819

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++D
Sbjct  3820  RMPMGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTD  3879

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AF+K+  LL VL S   A
Sbjct  3880  VKCANVVLLNCLQHLHVASNSKLWQYCSVLHNEILSTSDLSVAFDKLAQLLIVLFSNPAA  3939

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVL  3977
             VD      I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +
Sbjct  3940  VDTKCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQI  3999

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  4000  KQLEKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4059

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPL+ IP   A  L ++IPD   +    D    TYA ++W 
Sbjct  4060  RKLDNQALNSILDNAVKGCVPLSAIPALAANTLTIIIPDKQVFDKVVDNVYVTYAGSVWH  4119

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCA  4155
             IQ V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     
Sbjct  4120  IQTVQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVN  4175

Query  4156  AGT-----TQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE  4210
             +G+       T C       YYN    GR V A+LSD+  LK+ +  K DG   +  EL+
Sbjct  4176  SGSDINCNIPTQC-------YYNNVSSGRIVYAVLSDVDGLKYTKIMKDDGNCVV-LELD  4227

Query  4211  PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFC  4270
             PPC+F     KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS C
Sbjct  4228  PPCKFSIQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLC  4287

Query  4271  AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC  4330
             AF+VD  K Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YC
Sbjct  4288  AFSVDPKKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYC  4347

Query  4331  RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC  4383
             R  ++HP+  G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC
Sbjct  4348  RARVEHPDVDGICKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSC  4399


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1308  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1367

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1368  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1427

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1428  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1462


 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 171/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G            F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGF-----------FVVSQANLNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDHAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    E   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKEHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 44.7 bits (104),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1095  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1154

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++AV + G + 
Sbjct  1155  IPKAIVLPQGGYVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDAVFFYGDI-  1209

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1210  -------VSHVCKCGHNMT--LIAADLP  1228


> sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1
Length=7152

 Score = 1823 bits (4722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1053/2865 (37%), Positives = 1581/2865 (55%), Gaps = 112/2865 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1620  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1679

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1680  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1738

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1739  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1798

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1799  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1856

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1857  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1914

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1915  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  1973

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  1974  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2031

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2032  GCETFGKPVIWLCHDEASLNSLTY----------FNKPSFKSENRYSVL------SVDSV  2075

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2076  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2135

Query  2099  YVDNSSLTIKKPNELSRVLGLKTL---ATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2136  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2191

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASF  2215
                R +      ++ + F  +  L  FT            T IA     ++    L+ +F
Sbjct  2192  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKT----IFYTTEIASKFTFNLFCLALKNAF  2245

Query  2216  NYLKSPNFSKLINII-----IWF--LLLSVCLGSL---------IYSTAALGVLMSNLGM  2259
                +   F K   ++      WF  L ++V              I+    +  + +  G+
Sbjct  2246  QTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKATFGL  2305

Query  2260  PSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---FKW  2316
              + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     F +
Sbjct  2306  VTICDFYSKLGVGFT----SHFCNGSFICELCYSGFDMLDTYAAIDFVQYEVDRRVLFDY  2361

Query  2317  DLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINLVQM  2374
              ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ +  M
Sbjct  2362  -VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFVANM  2420

Query  2375  APISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSF  2434
              P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV R +
Sbjct  2421  LPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVIRYY  2480

Query  2435  YVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSV  2494
              + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V  +
Sbjct  2481  DITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVVTDI  2540

Query  2495  TVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSA  2554
                   + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V +  S  + ++ 
Sbjct  2541  KQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVVVE--SDADRANF  2598

Query  2555  KSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVA  2614
              +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +     V 
Sbjct  2599  LNAVVFYAQSLYRPILLVDKKLITTACNGISVTQTMFDVYVDTFMSHFDVDRKSFNNFVN  2658

Query  2615  TAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSCNNY  2673
              A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ NN 
Sbjct  2659  IAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENYNNL  2718

Query  2674  MLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAA  2733
             + TY K +N+   DLG  I   A+H+   VAK+ NI+ IW +  F  L+  L+ +++ A 
Sbjct  2719  VPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKAANISCIWFIDTFNQLTADLQHKLKKAC  2778

Query  2734  KKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPV  2793
              K  L  KLT       V ++TT  +LKGG +++N L  L  ++L+      + + + P 
Sbjct  2779  VKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFISLICFI---LLWALLPT  2835

Query  2794  HVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTNDKAC  2851
             + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N   C
Sbjct  2836  YSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSFYYHNSMDC  2895

Query  2852  PLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATS  2911
             P++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF  S
Sbjct  2896  PIVVAVMDEDIGSTMFNVPTKVLRH-GFHVLHFLTYAFASDSVQCYTPHIQISYNDFYAS  2954

Query  2912  ACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNTYLE  2970
              CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+   E
Sbjct  2955  GCVLSSLCTMFKRGDGTPHPYCYSDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDVISE  3014

Query  2971  GSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNM  3030
             G VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L    
Sbjct  3015  GIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDLFDLFYQF  3074

Query  3031  FTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFT  3090
             F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ ++F 
Sbjct  3075  FSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVIVWCINFL  3134

Query  3091  VLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST  3150
             +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  +  
Sbjct  3135  MLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAMVIA  3194

Query  3151  KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLAL  3210
              H  W FS    R++  N  + STFEE +L TF++ K+ Y +L++ V      YNRYL+L
Sbjct  3195  NHVLWLFS--YCRKIGVNVCNDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRYLSL  3250

Query  3211  YNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGFRKM  3269
             YNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG  KM
Sbjct  3251  YNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGIVKM  3310

Query  3270  AFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNF  3329
               P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC S +M  P+Y  LL R +  +F
Sbjct  3311  VSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICLSSNMNEPDYSALLCRVTLGDF  3370

Query  3330  LVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVY  3389
              + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P G +
Sbjct  3371  TIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGVVKPGETFTVLAAYNGRPQGAF  3430

Query  3390  QCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFV  3449
                MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYGP+ 
Sbjct  3431  HVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYR  3490

Query  3450  DRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH  3509
             D Q  Q    D   TVNV+AWLYAA++N   WF+     ++ DFN+ AM   +  +  D 
Sbjct  3491  DAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSIEDFNVWAMTNGFSQVKADL  3550

Query  3510  VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ  3569
             V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV  Q
Sbjct  3551  V--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGVKLQ  3607

Query  3570  SAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFV  3629
             S  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M+ V
Sbjct  3608  SKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMMLLV  3666

Query  3630  KHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASA  3688
             KHKH +L ++++P L T+ Y N +V     +      WL     +++   + +       
Sbjct  3667  KHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGLTYVWLSYFVPAVNFTYVYEVFYGCIL  3726

Query  3689  VVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVV  3748
              V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+   
Sbjct  3727  CVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYTW--  3782

Query  3749  TTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLT  3807
             TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  FR+ 
Sbjct  3783  TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVFRMP  3842

Query  3808  LGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKC  3867
             +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++DVKC
Sbjct  3843  MGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTDVKC  3902

Query  3868  TSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVD-  3926
              +VVLL+ LQ L V S+S+LW  C  LHN+IL   D + AF+K+  LL VL +   AVD 
Sbjct  3903  ANVVLLNCLQHLHVASNSRLWQYCSILHNEILSTSDLSVAFDKLAQLLIVLFANPAAVDT  3962

Query  3927  -----INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVLKKL  3980
                  I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +K+L
Sbjct  3963  KCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQIKQL  4022

Query  3981  KKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKL  4040
             +K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+RKL
Sbjct  4023  EKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMVRKL  4082

Query  4041  DNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQ  4100
             DN ALN+I++NA  GCVPLN IP   A  L ++IPD   +    D     YA ++W IQ 
Sbjct  4083  DNQALNSILDNAVKGCVPLNAIPALAANTLTIIIPDKQVFDKVVDNVYVAYAGSVWHIQT  4142

Query  4101  VVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCAAGT  4158
             V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     +G+
Sbjct  4143  VQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVNSGS  4198

Query  4159  TQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTD  4218
                   +     YYN    GR V A+LSD+  LK+ +  K DG   +  EL+PPC+F   
Sbjct  4199  DMNC--NIPTQCYYNNGSSGRIVYAVLSDVDGLKYTKIIKDDGNCVV-LELDPPCKFSIQ  4255

Query  4219  TPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK  4278
               KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS CAF+VD  K
Sbjct  4256  DVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLCAFSVDPKK  4315

Query  4279  AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPN  4338
              Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YCR  ++HP+
Sbjct  4316  TYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYCRARVEHPD  4375

Query  4339  PKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC  4383
               G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC
Sbjct  4376  VDGLCKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSC  4419


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1328  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1387

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1388  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1447

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1448  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1482


 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 102/422 (24%), Positives = 172/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G+           F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGL-----------FVVSQANFNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDQAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    +   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKDHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 44.7 bits (104),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1115  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1174

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++AV + G + 
Sbjct  1175  IPKAIVLPQGGYVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDAVFFYGDI-  1229

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1230  -------VSHVCKCGHNMT--LIAADLP  1248


> sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1
Length=7182

 Score = 1818 bits (4709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1058/2868 (37%), Positives = 1582/2868 (55%), Gaps = 118/2868 (4%)

Query  1566  RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             + I V  TVD +N  +  + +   +G+  G  + DG DVTK+K  + +  K  Y   N  
Sbjct  1650  KKIDVLLTVDGVNFKSISLTVGEVFGKILGNVFCDGIDVTKLKCSDFYADKILYQYENLS  1709

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQ  1685
                + A +     D   L  Y + L    KW         S + + NNCY+  A L LQ 
Sbjct  1710  LADISAVQSSFGFDQQQLLAYYNFLT-VCKWSVVVNGPFFSFEQSHNNCYVNVACLMLQH  1768

Query  1686  IELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCK  1745
             I LKFN    Q+A+Y  RAG      AL+LA  +    E  D  + +  + + A+L    
Sbjct  1769  INLKFNKWQWQEAWYEFRAGRPHRLVALVLAKGHFKFDEPSDATDFIRVVLKQADLSGAI  1828

Query  1746  RVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFV  1805
               L ++C  CG +Q +  GV+AVM+ GTL+      G +I C C  +   +  +   PF+
Sbjct  1829  CELELICD-CGIKQESRVGVDAVMHFGTLAKTDLFNGYKIGCNCAGRIV-HCTKLNVPFL  1886

Query  1806  MMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD  1865
             + S  P   +L       A+ + G    GHY H+         D   + K +   G +TD
Sbjct  1887  ICSNTPLSKDLPDDV-VAANMFMG-VGVGHYTHLKCGSPYQHYDACSVKKYTGVSGCLTD  1944

Query  1866  VFYKEN-SYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYP--N  1922
               Y +N + T T     Y LD V     +P L  YY  +  Y+T +PI     +P+   +
Sbjct  1945  CLYLKNLTQTFTSMLTNYFLDDVEMVAYNPDLSQYYCDNGKYYT-KPIIKAQFKPFAKVD  2003

Query  1923  ASFDNFKFVCDNIKFADDLNQLTGYKKPAS-RELKVTFFPDLNGDVVAIDYKHYTPSFKK  1981
               + NFK V  +I     LN   G+       E KVT +P   GDVV      Y   + K
Sbjct  2004  GVYTNFKLVGHDI--CAQLNDKLGFNVDLPFVEYKVTVWPVATGDVVLASDDLYVKRYFK  2061

Query  1982  GAKLLHKPIVW--HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNL  2039
             G +   KP++W  H   + N  TY          ++    ++ N + VL       +D++
Sbjct  2062  GCETFGKPVIWFCHDEASLNSLTY----------FNKPSFKSENRYSVL------SVDSV  2105

Query  2040  ACEDLKPVSEEVVENPTIQKDV-LECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAA  2098
             + E    V   V+E+    K+V L+   KT ++   II+   N+S+K+ + +   D+   
Sbjct  2106  SEESQGNVVTSVMESQISTKEVKLKGVRKTVKIEDAIIVNDENSSIKVVKSLSLVDVWDM  2165

Query  2099  YVDNSSLTIKKPNELSRVLGLKTLA---THGLAAVNSVPWDTIANYAKPFLNKVVSTTTN  2155
             Y+      +   NELSR++   T+     +G+  + ++P D +        N+ +     
Sbjct  2166  YLTGCDYVVWVANELSRLVKSPTVREYIRYGIKPI-TIPIDLLCLRDD---NQTLLVPKI  2221

Query  2156  IVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASF  2215
                R +      ++ + F  +  L  FT          + +    N       FCL A  
Sbjct  2222  FKARAIEFY--GFLKWLFIYVFSLLHFTNDKTIFYTTEIASKFTFNL------FCL-ALK  2272

Query  2216  NYLKSPNFSKLIN--------IIIWF--LLLSVCLGSL---------IYSTAALGVLMSN  2256
             N  ++  +S  I          + WF  L ++V              I+    +  + + 
Sbjct  2273  NAFQTFRWSIFIKGFLVVATVFLFWFNFLYINVIFSDFYLPNISVFPIFVGRIVMWIKAT  2332

Query  2257  LGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS---  2313
              G+ + C  Y +  +  T    + +C GS  C +C SG D LDTY +++ +Q  +     
Sbjct  2333  FGLVTICDFYSKLGVGFT----SHFCNGSFICELCHSGFDMLDTYAAIDFVQYEVDRRVL  2388

Query  2314  FKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFI--SNSWLMWLIINL  2371
             F + ++   L+ E  + Y L+T +FY L     +QLF ++    F+  +  WL+  I+ +
Sbjct  2389  FDY-VSLVKLIVELVIGYSLYTVWFYPLFCLIGLQLFTTWLPDLFMLETMHWLIRFIVFV  2447

Query  2372  VQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVR  2431
               M P   ++R YI   + Y V     H+V GCN + C+ CYKRN + RV+C+TIV GV 
Sbjct  2448  ANMLPAFVLLRFYIVVTAMYKVVGFIRHIVYGCNKAGCLFCYKRNCSVRVKCSTIVGGVI  2507

Query  2432  RSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIV  2491
             R + + ANGG GFC  H WNC NC +F  G+TFI+ E A +LS + KRP+NPTD S Y+V
Sbjct  2508  RYYDITANGGTGFCVKHQWNCFNCHSFKPGNTFITVEAAIELSKELKRPVNPTDASHYVV  2567

Query  2492  DSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEE  2551
               +      + L++D+ GQ+ Y+    S FV+++NL  +  K    + V+V +  S  + 
Sbjct  2568  TDIKQVGCMMRLFYDRDGQRVYDDVDASLFVDINNLLHSKVKVVPNLYVVVVE--SDADR  2625

Query  2552  SSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKT  2611
             ++  +A V+Y+Q + +PILL+D+ L++   +   V   MFD YV+TF S F+V  +    
Sbjct  2626  ANFLNAVVFYAQSLYRPILLVDKKLITTACNGISVTQTMFDVYVDTFMSHFDVDRKSFNN  2685

Query  2612  LVATAEAELAKNVSLDNVLSTFISAARQGF-VDSDVETKDVVECLKLSHQSDIEVTGDSC  2670
              V  A A L + V L+ VL TF+   R+   +DSDVET+ + + +  +  + +E T ++ 
Sbjct  2686  FVNIAHASLREGVQLEKVLDTFVGCVRKCCSIDSDVETRFITKSMISAVAAGLEFTDENY  2745

Query  2671  NNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIR  2730
             NN + TY K +N+   DLG  I   A+H+   VAK+ NI+ IW +  F  L+  L+ +++
Sbjct  2746  NNLVPTYLKSDNIVAADLGVLIQNGAKHVQGNVAKAANISCIWFIDAFNQLTADLQHKLK  2805

Query  2731  SAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLI  2790
              A  K  L  KLT       V ++TT  +LKGG +++N L  L  V+L+      + + +
Sbjct  2806  KACVKTGLKLKLTFNKQEASVPILTTPFSLKGGVVLSNLLYILFFVSLICFI---LLWAL  2862

Query  2791  TPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGS--YTND  2848
              P + + K          +K ID GV RDI+  D CFANK   FD W+    GS  Y N 
Sbjct  2863  LPTYSVYKSDIHLPAYASFKVIDNGVVRDISVNDLCFANKFFQFDQWYESTFGSVYYHNS  2922

Query  2849  KACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDF  2908
               CP++ AV+  ++G  +  +P  +LR      LHFL   F++    CYTP   I Y DF
Sbjct  2923  MDCPIVVAVMDEDIGSTMFNVPTKVLRH-GFHVLHFLTYAFASDSVQCYTPHIQISYNDF  2981

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGS-IIQFPNT  2967
               S CVL++ CT+FK   G P PYCY   V++ +  Y SL P TRY L + +  I+FP+ 
Sbjct  2982  YASGCVLSSLCTMFKRGDGTPHPYCYSDGVMKNASLYTSLVPHTRYSLANSNGFIRFPDV  3041

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
               EG VR+V T    YCR G CE +E G+C + +  WVLNNDYYRS+PG FCG D  +L 
Sbjct  3042  ISEGIVRIVRTRSMTYCRVGACEYAEEGICFNFNSSWVLNNDYYRSMPGTFCGRDLFDLF  3101

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
                F+ LI+PI    ++AS + G I+AIVV  + YY ++ +RAFG+Y+ VV  N +++ +
Sbjct  3102  YQFFSSLIRPIDFFSLTASSIFGAILAIVVVLVFYYLIKLKRAFGDYTSVVVINVVVWCI  3161

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIIC  3147
             +F +L +  VY     VY+  Y Y+T Y  +++S + H+QW+VM+  ++PFW  + Y+  
Sbjct  3162  NFLMLFVFQVYPICACVYACFYFYVTLYFPSEISVIMHLQWIVMYGAIMPFWFCVTYVAM  3221

Query  3148  ISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRY  3207
             +   H  W FS    R++  N  S STFEE +L TF++ K+ Y +L++ V      YNRY
Sbjct  3222  VIANHVLWLFS--YCRKIGVNVCSDSTFEETSLTTFMITKDSYCRLKNSV--SDVAYNRY  3277

Query  3208  LALYNKYKYFSGAMDTTSYREAACCHLAKALNDFS-NSGSDVLYQPPQTSITSAVLQSGF  3266
             L+LYNKY+Y+SG MDT +YREAAC  LAKA+  F+ N+G+DVLYQPP  S++++ LQSG 
Sbjct  3278  LSLYNKYRYYSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVSTSFLQSGI  3337

Query  3267  RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSN  3326
              KM  P+ K+E C+V VT G+ TLNGLWLDD VYCPRHVIC+S +M  P+Y  LL R + 
Sbjct  3338  VKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTL  3397

Query  3327  HNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPS  3386
              +F + +G + L V+ + MQ C L L V   NP TPKY F  ++PG+TF+VLA YNG P 
Sbjct  3398  GDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKYTFGNVKPGETFTVLAAYNGRPQ  3457

Query  3387  GVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYG  3446
             G +   MR ++TIKGSFL GSCGSVG+ +  D V F YMH +EL TG H GTD  GNFYG
Sbjct  3458  GAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYG  3517

Query  3447  PFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLT  3506
             P+ D Q  Q    D   TVNV+AWLYAA++N   WF+     +  DFN+ AM   +  + 
Sbjct  3518  PYRDAQVVQLPVKDYVQTVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVK  3577

Query  3507  QDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGV  3566
              D V  L  L++ TG+++  + A++K L   G  GR ILGS   EDE  P DV +Q +GV
Sbjct  3578  ADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLAGV  3634

Query  3567  TFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAM  3626
               QS  KR IK T +W+L++      ++    +W++F ++     +   + ++   +F M
Sbjct  3635  KLQSKTKRFIKETIYWILISTFLFSCIISAFVKWTIFMYI-NTHMIGVTLCVLCFVSFMM  3693

Query  3627  MFVKHKHAFLCLFLLPSLATVAYFN-MVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMY  3685
             + VKHKH +L ++++P L T+ Y N +V     +      WL     +++   + +    
Sbjct  3694  LLVKHKHFYLTMYIIPVLCTLFYVNYLVVYKEGFRGFTYVWLSYFVPAVNFTYVYEVFYG  3753

Query  3686  ASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYS  3745
                 V  I +T  ++  D    ++ +  ++TL+   Y+G+ L++ + ++  I +    Y+
Sbjct  3754  CILCVFAIFITMHSINHDIFSLMFLVGRIVTLISMWYFGSNLEEDVLLF--ITAFLGTYT  3811

Query  3746  GVVTTVMFLARGIVFMCVEYCPIFFITG-NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYF  3804
                TT++ LA   +        IF+ T    ++ I+L Y F+GY  +CY+G F LLN  F
Sbjct  3812  W--TTILSLAIAKIVANWLSVNIFYFTDVPYIKLILLSYLFIGYILSCYWGFFSLLNSVF  3869

Query  3805  RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSD  3864
             R+ +GVY+Y +S QE RYMN+ GL PP+NS +A  LN+KLLG+GG P I+V+ +QSK++D
Sbjct  3870  RMPMGVYNYKISVQELRYMNANGLRPPRNSFEAILLNLKLLGIGGVPVIEVSQIQSKLTD  3929

Query  3865  VKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGA  3924
             VKC +VVLL+ LQ L V S+SKLW  C  LHN+IL   D + AF+K+  LL VL +   A
Sbjct  3930  VKCANVVLLNCLQHLHVASNSKLWQYCSVLHNEILSTSDLSVAFDKLAQLLIVLFANPAA  3989

Query  3925  VD------INKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGD-SEVVL  3977
             VD      I+++ ++ + +   LQA+ SEF ++ S+  +  A++    A  +G  ++  +
Sbjct  3990  VDTKCLASIDEVSDDYVQDSTVLQALQSEFVNMASFVEYEVAKKNLADAKNSGSVNQQQI  4049

Query  3978  KKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTML  4037
             K+L+K+ N+AKS ++RD A+ RKLE+MAD A+T MYK+AR  DK++KV SA+QTMLF+M+
Sbjct  4050  KQLEKACNIAKSVYERDKAVARKLERMADLALTNMYKEARINDKKSKVVSALQTMLFSMV  4109

Query  4038  RKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWE  4097
             RKLDN ALN+I++NA  GCVPL+ IP   A  L +VIPD   +    D    TYA ++W 
Sbjct  4110  RKLDNQALNSILDNAVKGCVPLSAIPALAANTLTIVIPDKQVFDKVVDNVYVTYAGSVWH  4169

Query  4098  IQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK--LQNNELSPVALRQMSCA  4155
             IQ V DAD    QL++IS+D++    WPL++ A R N      +QNNEL P  L+     
Sbjct  4170  IQTVQDADGINKQLTDISVDSN----WPLVIIANRYNEVANAVMQNNELMPHKLKIQVVN  4225

Query  4156  AGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRF  4215
             +G+      +     YYN    GR V A+LSD+  LK+ +  K DG   +  EL+PPC+F
Sbjct  4226  SGSDMNC--NIPTQCYYNNGSSGRIVYAVLSDVDGLKYTKIMKDDGNCVV-LELDPPCKF  4282

Query  4216  VTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVD  4275
                  KG K+KYLYFIKG N L RG V+G+L++T+RLQAG ATE  ANS++LS CAF+VD
Sbjct  4283  SIQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQAGVATEYAANSSILSLCAFSVD  4342

Query  4276  AAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHID  4335
               K Y DY+  GG PI NCVKMLC H GTG AIT+ PEA ++Q+S+GGAS C+YCR  ++
Sbjct  4343  PKKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYGGASVCIYCRARVE  4402

Query  4336  HPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSC  4383
             HP+  G C L+GK+VQ+P     DP+ + L + VC VCG W+   CSC
Sbjct  4403  HPDVDGICKLRGKFVQVPLG-IKDPILYVLTHDVCQVCGFWRDGSCSC  4449


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 2/155 (1%)

Query  1032  LKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             L +T NV     DI+  A+ VK  V+VN AN ++ HGGGVA A+  A       E+   +
Sbjct  1358  LCITPNVCFVKGDIINVARLVKADVIVNPANGHMLHGGGVAKAIAVAAGKKFSKETAAMV  1417

Query  1092  ATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG--EDIQLLKSAYENFNQHEVLLAPLL  1149
              + G  +VG   V +G  L K  L++VGP+  +   +   LL  AY++ N ++  L+ L+
Sbjct  1418  KSKGVCQVGDCYVSTGGKLCKTILNIVGPDARQDGRQSYVLLARAYKHLNNYDCCLSTLI  1477

Query  1150  SAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYD  1184
             SAGIF      SL   +  V   V L   +K  +D
Sbjct  1478  SAGIFSVPADVSLTYLLGVVDKQVILVSNNKEDFD  1512


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 172/422 (41%), Gaps = 63/422 (15%)

Query  562  LQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMA-YITGGVVQLTSQW--------  612
            L ++ I     +SQ+S  + D  +    L  + + V   YI   V +L +Q+        
Sbjct  562  LIQSGIFFTSLMSQFSQEVSDMCLKMCILFMDRVSVATFYIEHYVNRLVTQFKLLGTTLV  621

Query  613  --LTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKE  670
              + N F T+ +   P   WL  +   G+           F+ + A       I   AK 
Sbjct  622  NKMVNWFNTMLDASAPATGWLLYQLLNGL-----------FVVSQANFNFVALIPDYAKI  670

Query  671  IKESVQTFFKLVNKFLALCADSIIIGGAKLKALN-----LGETFVTHSKGLYRKCVKSRE  725
            +     TFFKL+   L      ++     LK +N     +G  F   S GL         
Sbjct  671  LVNKFYTFFKLL---LECVTVDVLKDMPVLKTINGLVCIVGNKFYNVSTGLI--------  719

Query  726  ETGLLMPLKA-PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTS--EAVEAPLVGTP  782
              G ++P  A  ++I F EG       + E V+++   ++ ++   S  E  + P     
Sbjct  720  -PGFVLPCNAQEQQIYFFEG-------VAESVIVEDDVIENVKSSLSSYEYCQPPKSVEK  771

Query  783  VCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG-----APTKVTFGDDTVI-EVQGY  836
            +CI   M +  K  +K+    P +M   N   L        A  KV F +  V+ E+   
Sbjct  772  ICIIDNMYMG-KCGDKF---FPIVMNDKNICLLDQAWRFPCAGRKVNFNEKPVVMEIPSL  827

Query  837  KSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE---LLTPL  893
             +V + F+LD   D +L + CS + VE G  V++F  VV DA+   L    E   +   +
Sbjct  828  MTVKVMFDLDSTFDDILGKVCSEFEVEKGVTVDDFVAVVCDAIENALNSCKEHPVVGYQV  887

Query  894  GIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPD-EDEEEGDCEEEEFEPSTQYEYGTE  952
               L++ +    YLFDE+G+  +AS MYC+F   D ED    +  E+  +   +     +
Sbjct  888  RAFLNKLNENVVYLFDEAGDEAMASRMYCTFAIEDVEDVISSEAVEDTIDGVVEDTINDD  947

Query  953  DD  954
            +D
Sbjct  948  ED  949


 Score = 43.5 bits (101),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 64/148 (43%), Gaps = 16/148 (11%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             Y +VNGL S      NC+L + LL +Q++  KF   A+++ +   + G   +F   +L  
Sbjct  1145  YFKVNGLWSPTITHTNCWLRSVLLVMQKLPFKFKDLAIENMWLSYKVGYNQSFVDYLLTT  1204

Query  1718  CNKTV--GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
               K +   + G V +   +     ++++     N  C  CG     L G++A+ + G + 
Sbjct  1205  IPKAIVLPQGGFVADFAYWFLNQFDINA---YANWCCLKCG-FSFDLNGLDALFFYGDI-  1259

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESP  1803
                    V   C CG   T  L+  + P
Sbjct  1260  -------VSHVCKCGHNMT--LIAADLP  1278


> sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus 
512/2005 OX=693999 GN=1a PE=3 SV=1
Length=4128

 Score = 1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/2263 (35%), Positives = 1215/2263 (54%), Gaps = 159/2263 (7%)

Query  2171  YFFTLLLQLCTFTRSTNSRIKASMPT---TIAKNTVK---SVGKFCLEASFNYLKSPNFS  2224
             Y F+LL       +  + ++ A +P     I K +VK      KF     F Y+K     
Sbjct  1984  YLFSLLAICFRALKKRDMKVMAGVPERTGIILKRSVKYNYKALKFFFRLKFQYIKV----  2039

Query  2225  KLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTG  2284
                     FL  S+ L +L Y+   + +  + +G P  C  Y +GY NST      YC G
Sbjct  2040  --------FLKFSLVLYTL-YALMFMFIRFTPVGTP-ICKRYTDGYANST-FDKNDYC-G  2087

Query  2285  SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLA  2344
             ++ C +CL G + L  +     I       K  L    L   + +  I+F  FF  +G+ 
Sbjct  2088  NVLCKICLYGYEELSDFTHTRVIW---QHLKDPLIGNILPLFYLVFLIIFGGFFVRIGIT  2144

Query  2345  AIMQLFFSY--FAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVD  2402
               +  + +    A+ +  N WL+ L+       P ++M  + +       +     HV+ 
Sbjct  2145  YFIMQYINAAGVALGYQDNVWLLHLL-------PFNSMGNIIVVAFIVTRILLFLKHVLF  2197

Query  2403  GCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGS  2462
             GC+  +C+ C K  + TRV   TI+ GV +SFYV ANGGK FCK HN+ CV+CD++  G 
Sbjct  2198  GCDKPSCIACSKSAKLTRVPLQTILQGVTKSFYVNANGGKKFCKKHNFFCVDCDSYGYGC  2257

Query  2463  TFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFV  2522
             TFI+D +A +LS   K  + PT  ++ I+D V   NG  +LY      K     + + + 
Sbjct  2258  TFINDVIAPELSNVTKLNVIPTGPATIIIDKVEFSNGFYYLYSGSTFWKYNFDITEAKYA  2317

Query  2523  NLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGD  2582
               D L+  N    +  + +VF+  S    +  K+A VY+SQL+C+PI L+D AL++ +  
Sbjct  2318  CKDVLKNCN----ILTDFVVFN-NSGSNVTQVKNACVYFSQLLCKPIKLVDSALLASL--  2370

Query  2583  SAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFV  2642
             + + +  +  A+V   S++F   +     +                      +  R+   
Sbjct  2371  NVDFSANLHKAFVEVLSNSFGKDLSNCSNM----------------------NECRESLG  2408

Query  2643  DSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVE-NMTPRDLGACIDCSARHINA  2701
              SDV  ++    +  +H+ D+ ++  S NN +++Y K E  +   D+  C+   A+ +N 
Sbjct  2409  LSDVPEEEFSAAVSEAHRYDVLISDVSFNNLIVSYAKPEEKLAVHDIANCMRVGAKVVNH  2468

Query  2702  QVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK  2761
              V    N+ ++W  KDF++LSE+ RK I    K   + F LT    R  + + T  +A K
Sbjct  2469  NVLTKDNVPVVWLAKDFIALSEEARKYIVRTTKTKGINFMLTFNDRRMHLTIPTISVANK  2528

Query  2762  GGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIG-----YKAIDGGV  2816
              G  + +   +L      + F   +  LI  + V +   DFS+++       +K I+ GV
Sbjct  2529  KGAGLPSLFTRL------YSFFWHLCVLIVVLFVATSLLDFSAQVTSDTQYDFKYIENGV  2582

Query  2817  TRDIASTDTCFANKHADFDTWFSQRGGSY-TNDKACPLIAAVITREVGFVVPGLPGTILR  2875
              +       C  N   +F+ W + + GS  TN + CP++    + EV ++ PG+P  +  
Sbjct  2583  LKVFEKPLDCVHNAFVNFNEWHNAKFGSIPTNSRRCPIVVGT-SDEVRYI-PGVPAGVF-  2639

Query  2876  TTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYD  2935
                G  L F          +C+    L +       +C+  + CT      G+ V YCY 
Sbjct  2640  -LYGKSLIFAMSTIFGTSGLCFDDRGLTD-----PDSCIFNSACTTLSGIGGRNV-YCYR  2692

Query  2936  TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVRVVTTFDSEYCRHGTCERSEA  2994
               V++ +  Y SL P + Y LMDG+ I  P     G  +R + T    YCR G C  S+A
Sbjct  2693  EGVVDNAKLYSSLLPHSYYRLMDGNHIVLPEIITRGFGIRTIKTQAMTYCRTGECIDSQA  2752

Query  2995  GVCVSTSGRWVLNNDYYRSLPG--VFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGI  3052
             GVCV     +V     Y   PG    CG    +LL N+       I    +S  I+   +
Sbjct  2753  GVCVGLDRFFV-----YSKTPGSDYVCGTGFFSLLFNVIGMFSNSIPVTVMSGQILLNCV  2807

Query  3053  VAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYL  3112
             VA       + F +F+R FG+ S    F  L   +   V  L+ V +    +  + Y  L
Sbjct  2808  VAFTAVMACFAFTKFKRLFGDMS----FGVLSVGLCTVVNNLSYVVT-QNSIGMLAYATL  2862

Query  3113  TFYLTNDV--SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV---VF  3167
              F  T  V  S++ H+ + + +  L P+W+ +AY+IC   +    F  N  K +V   +F
Sbjct  2863  YFLCTKGVRYSWVWHVGFAISYCFLAPWWVVLAYLICALLE----FLPNLFKLKVSTQLF  2918

Query  3168  NGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSY  3226
              G  F  +FE AA  TF+L+   Y KL + +     +  +Y A YN+YKY+SG+     Y
Sbjct  2919  EGDKFVGSFESAASGTFVLDMHSYQKLANSI--STEKLKQYCASYNRYKYYSGSASEADY  2976

Query  3227  REAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCG  3286
             R A   HLAKA++DF+N   D LY PP  S  S  LQ+G RKMA PSG VEGC+V+V+ G
Sbjct  2977  RLACFAHLAKAMSDFANDHMDKLYTPPTVSYNST-LQAGLRKMAQPSGIVEGCIVRVSYG  3035

Query  3287  TTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSM  3345
               TLNGLWL D V CPRHVI + + ++++ ++   L+R   HNF + +GN+ L VI  SM
Sbjct  3036  NLTLNGLWLGDTVICPRHVIASNTTNVIDYDHAMSLVRL--HNFSISSGNMFLGVISASM  3093

Query  3346  QNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLN  3405
             +  +L +KV+ +N  TP Y +  ++PG +F++LACY+GS +GVY   MR N+TI+GSF++
Sbjct  3094  RGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYDGSAAGVYGVNMRTNYTIRGSFIS  3153

Query  3406  GSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV  3465
             G+CGS G+NI+   V FCYMHH+EL +G H G+D++G  YG + D+ T Q  G    +T 
Sbjct  3154  GACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDGTMYGKYEDQPTLQIEGASNLVTE  3213

Query  3466  NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVL  3525
             NV +WLY A+INGDRW+L+  +  ++ +N  A++     L   +VD    L A+TG+ V 
Sbjct  3214  NVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGMTALK--NVDCFSLLVAKTGVDVG  3271

Query  3526  DMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSA-VKRTIKGTHHWLL  3584
              + AS+++L  N   G++ILG   L DEFT  +VV+Q  GVT QS  V R  +       
Sbjct  3272  RLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQMYGVTLQSGKVSRAFRNA-----  3325

Query  3585  LTILTSLLVLVQSTQW--SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLP  3642
              +I+  LL L  S     S  F++      P  + II  S+  M+ VKHK  FL L+LLP
Sbjct  3326  -SIVCCLLFLFLSEMLNHSKLFWINPGYITPVFLAIIVASSALMLLVKHKLLFLQLYLLP  3384

Query  3643  SLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYD  3702
             SL  V+ +N ++    +   ++   D       GF +   +  +    ++ L T R  + 
Sbjct  3385  SLCIVSGYN-IFKDYHFYTYMLEEFDY-KVPFGGFNVTGVLNISLCCFVMGLHTFR--FL  3440

Query  3703  DGARRVWT-LMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFM  3761
                 ++++ ++ VLT++Y  YY      +  +  LI++  S +    T   F+      +
Sbjct  3441  QTPNKIFSYVVAVLTVLYTYYY------STDVLGLILTSMSGF----TNYWFIGTATYKL  3490

Query  3762  CVEYCP--IFFITGNTLQCIMLVYCFLGYFCTC-YFGLFCLLNRYFRLTLGVYDYLVSTQ  3818
                  P      + + ++ ++ +Y  LGY C C Y+G    +NR+ +LTLG Y++ VS  
Sbjct  3491  ATYVLPHTSLLDSFDAIKAVVFLYLLLGY-CNCVYYGSLYWINRFCKLTLGCYEFKVSAA  3549

Query  3819  EFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQ  3878
             EF+YM + GL  P    DA  L++KL+GVGG+  IK+++VQSK++D+KCT+VVLL  L  
Sbjct  3550  EFKYMVANGLRAPTGVFDALILSLKLIGVGGRKTIKISSVQSKLTDLKCTNVVLLGCLSN  3609

Query  3879  LRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNR  3938
             + + ++S+ WA CV LHN I L  D   A E +++LL+  LS   A  +++L +   ++ 
Sbjct  3610  MNIAANSREWAYCVDLHNKINLCNDAEAAQEMLLALLAFFLSKNSAFGVDELLDSYFNDS  3669

Query  3939  ATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQ  3998
             + LQ++A+ + +LPSY A+ TA+++YE A+ANG    ++K+L+ ++NVAKSEFDR+A+ Q
Sbjct  3670  SVLQSVAATYVNLPSYLAYETARQSYEDALANGSPPQLVKQLRHAMNVAKSEFDREASTQ  3729

Query  3999  RKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVP  4058
             RKL++MA+QA +QMYK+AR+ ++++KV SAM ++LF MLR+LD  +++ I++ A+DG VP
Sbjct  3730  RKLDRMAEQAASQMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMSSVDTILSLAKDGVVP  3789

Query  4059  LNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDN  4118
             L+IIP  +A KL +V+ D  +Y          YA  +W +  + D D K V   E+   N
Sbjct  3790  LSIIPAVSATKLNIVVSDIESYSKIQREGCVHYAGVIWSVVDIKDNDGKPVHAKEVVTSN  3849

Query  4119  SPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGG  4178
               +LAWPL +   R    +KLQNNE+ P  ++Q    A   +    D NAL  Y+   G 
Sbjct  3850  VESLAWPLFLNCER---IIKLQNNEIIPSKIKQRPIKA-EGEGVVADGNAL--YSNEGGR  3903

Query  4179  RFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLN  4238
              F+ A +SD  DLK  ++    G+  I  ELEPPC+F+ + P GP VKYLYF++ LNNL 
Sbjct  3904  TFMYAFISDKPDLKVVKWEFDGGSNAI--ELEPPCKFLVEAPSGPVVKYLYFVRNLNNLR  3961

Query  4239  RGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKML  4298
             RG VLG + ATVRLQAG  TE   NS++L+ CAFAVD  K Y D + SG +P+ NCVKML
Sbjct  3962  RGAVLGFIGATVRLQAGKQTEQATNSSLLTLCAFAVDPPKTYLDAVKSGHRPVGNCVKML  4021

Query  4299  CTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCAN  4358
                +G GQAIT   EA+ +Q+S+GGAS CLYCR H++HP+  GFC L+GKYVQ+P     
Sbjct  4022  ANGSGNGQAITNGVEASTNQDSYGGASVCLYCRAHVEHPDMDGFCKLRGKYVQVPLGTL-  4080

Query  4359  DPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             DP+ F L+NTVC VCG W+  GC+CD+    ++QS D+  +LN
Sbjct  4081  DPIRFVLENTVCKVCGCWQANGCTCDR---AVIQSVDS-GYLN  4119


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 94/204 (46%), Gaps = 16/204 (8%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLH  1116
             VVNAAN  L HGGG+A AL+  T   +QV S+ Y++ NG +KVG   ++         L+
Sbjct  1323  VVNAANEQLSHGGGIAKALDDLTKGELQVLSNQYVSRNGSIKVGSGVLIKCKE--HSILN  1380

Query  1117  VVGPNVNKGEDIQLLKSAYE-NFNQHEVLLAPLLSAGIFGADPIHSLR---VCVDTVRTN  1172
             VVGP   K    +LL  AY   F Q  V L PLLS GIF      SL     CV      
Sbjct  1381  VVGPRKGK-HAAELLTKAYTFVFKQKGVPLMPLLSVGIFKVPITESLAAFLACVGDRVCK  1439

Query  1173  VYLAVFDKNL-YDKLVSSFLEMKSEKQVE-----QKIAEIPKEEVKPFITESKPSVEQRK  1226
              +     + L     V+SF   ++E+ VE     Q++  +  E+  P +    P    R 
Sbjct  1440  CFCYTDKERLAIQNFVTSF---QTEQPVEPLPVIQEVKGVQLEKPVPDVKVENPCEPFRI  1496

Query  1227  QDDKKIKACVEEVTTTLEETKFLT  1250
             + D K       +  +L+ T+ ++
Sbjct  1497  EGDAKFYDLTPSMVQSLQVTRLVS  1520


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 83/196 (42%), Gaps = 12/196 (6%)

Query  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             +L E + ++V  T D  + HT  +  S TYGQQ G   ++   VT +KP +  +  +  V
Sbjct  1634  TLFEAKPVQVVVTQDQRSFHTVELSTSQTYGQQLGDCVVEDKKVTNLKPVSKDKVVS--V  1691

Query  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTK-KWKYPQVNGLTSIKWADNNCYLATA  1679
             +PN     V+  ++Y   D          L+HT   +    VNG   ++ +DNNC++   
Sbjct  1692  VPN-----VDWDKHYGFVDAGIF----HTLDHTMFVFDNNVVNGKRVLRTSDNNCWINAV  1742

Query  1680  LLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
              L LQ    KF P  LQ  +     G+ A F   +        GE  D   T++ + +  
Sbjct  1743  CLQLQFANAKFKPKGLQQLWESYCTGDVAMFVHWLYWITGVEKGEPSDAENTLNIISRFL  1802

Query  1740  NLDSCKRVLNVVCKTC  1755
                    +L     TC
Sbjct  1803  KPQGSVEMLRATSTTC  1818


> sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus 
512/2005 OX=693999 GN=rep PE=3 SV=1
Length=6793

 Score = 1226 bits (3173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/2268 (35%), Positives = 1219/2268 (54%), Gaps = 169/2268 (7%)

Query  2171  YFFTLLLQLCTFTRSTNSRIKASMPT---TIAKNTVK---SVGKFCLEASFNYLKSPNFS  2224
             Y F+LL       +  + ++ A +P     I K +VK      KF     F Y+K     
Sbjct  1984  YLFSLLAICFRALKKRDMKVMAGVPERTGIILKRSVKYNYKALKFFFRLKFQYIKV----  2039

Query  2225  KLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTG  2284
                     FL  S+ L +L Y+   + +  + +G P  C  Y +GY NST      YC G
Sbjct  2040  --------FLKFSLVLYTL-YALMFMFIRFTPVGTP-ICKRYTDGYANST-FDKNDYC-G  2087

Query  2285  SIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLA  2344
             ++ C +CL G + L  +     I       K  L    L   + +  I+F  FF  +G+ 
Sbjct  2088  NVLCKICLYGYEELSDFTHTRVIW---QHLKDPLIGNILPLFYLVFLIIFGGFFVRIGIT  2144

Query  2345  AIMQLFFSY--FAVHFISNSWLMWLII-----NLVQMAPISAMVRMYIFFASFYYVWKSY  2397
               +  + +    A+ +  N WL+ L+      N++ +A I  + R+ +F           
Sbjct  2145  YFIMQYINAAGVALGYQDNVWLLHLLPFNSMGNIIVVAFI--VTRILLFLK---------  2193

Query  2398  VHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDT  2457
              HV+ GC+  +C+ C K  + TRV   TI+ GV +SFYV ANGGK FCK HN+ CV+CD+
Sbjct  2194  -HVLFGCDKPSCIACSKSAKLTRVPLQTILQGVTKSFYVNANGGKKFCKKHNFFCVDCDS  2252

Query  2458  FCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHS  2517
             +  G TFI+D +A +LS   K  + PT  ++ I+D V   NG  +LY      K     +
Sbjct  2253  YGYGCTFINDVIAPELSNVTKLNVIPTGPATIIIDKVEFSNGFYYLYSGSTFWKYNFDIT  2312

Query  2518  LSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALV  2577
              + +   D L+  N    +  + +VF+  S    +  K+A VY+SQL+C+PI L+D AL+
Sbjct  2313  EAKYACKDVLKNCN----ILTDFVVFN-NSGSNVTQVKNACVYFSQLLCKPIKLVDSALL  2367

Query  2578  SDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAA  2637
             + +  + + +  +  A+V   S++F   +     +                      +  
Sbjct  2368  ASL--NVDFSANLHKAFVEVLSNSFGKDLSNCSNM----------------------NEC  2403

Query  2638  RQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVE-NMTPRDLGACIDCSA  2696
             R+    SDV  ++    +  +H+ D+ ++  S NN +++Y K E  +   D+  C+   A
Sbjct  2404  RESLGLSDVPEEEFSAAVSEAHRYDVLISDVSFNNLIVSYAKPEEKLAVHDIANCMRVGA  2463

Query  2697  RHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTT  2756
             + +N  V    N+ ++W  KDF++LSE+ RK I    K   + F LT    R  + + T 
Sbjct  2464  KVVNHNVLTKDNVPVVWLAKDFIALSEEARKYIVRTTKTKGINFMLTFNDRRMHLTIPTI  2523

Query  2757  KIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIG-----YKA  2811
              +A K G  + +   +L      + F   +  LI  + V +   DFS+++       +K 
Sbjct  2524  SVANKKGAGLPSLFTRL------YSFFWHLCVLIVVLFVATSLLDFSAQVTSDTQYDFKY  2577

Query  2812  IDGGVTRDIASTDTCFANKHADFDTWFSQRGGSY-TNDKACPLIAAVITREVGFVVPGLP  2870
             I+ GV +       C  N   +F+ W + + GS  TN + CP++    + EV ++ PG+P
Sbjct  2578  IENGVLKVFEKPLDCVHNAFVNFNEWHNAKFGSIPTNSRRCPIVVGT-SDEVRYI-PGVP  2635

Query  2871  GTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPV  2930
               +     G  L F          +C+    L +       +C+  + CT      G+ V
Sbjct  2636  AGVF--LYGKSLIFAMSTIFGTSGLCFDDRGLTD-----PDSCIFNSACTTLSGIGGRNV  2688

Query  2931  PYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVRVVTTFDSEYCRHGTC  2989
              YCY   V++ +  Y SL P + Y LMDG+ I  P     G  +R + T    YCR G C
Sbjct  2689  -YCYREGVVDNAKLYSSLLPHSYYRLMDGNHIVLPEIITRGFGIRTIKTQAMTYCRTGEC  2747

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPG--VFCGVDAVNLLTNMFTPLIQPIGALDISASI  3047
               S+AGVCV     +V     Y   PG    CG    +LL N+       I    +S  I
Sbjct  2748  IDSQAGVCVGLDRFFV-----YSKTPGSDYVCGTGFFSLLFNVIGMFSNSIPVTVMSGQI  2802

Query  3048  VAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSV  3107
             +   +VA       + F +F+R FG+ S    F  L   +   V  L+ V +    +  +
Sbjct  2803  LLNCVVAFTAVMACFAFTKFKRLFGDMS----FGVLSVGLCTVVNNLSYVVT-QNSIGML  2857

Query  3108  IYLYLTFYLTNDV--SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV  3165
              Y  L F  T  V  S++ H+ + + +  L P+W+ +AY+IC   +    F  N  K +V
Sbjct  2858  AYATLYFLCTKGVRYSWVWHVGFAISYCFLAPWWVVLAYLICALLE----FLPNLFKLKV  2913

Query  3166  ---VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAM  3221
                +F G  F  +FE AA  TF+L+   Y KL + +     +  +Y A YN+YKY+SG+ 
Sbjct  2914  STQLFEGDKFVGSFESAASGTFVLDMHSYQKLANSI--STEKLKQYCASYNRYKYYSGSA  2971

Query  3222  DTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMV  3281
                 YR A   HLAKA++DF+N   D LY PP  S  S  LQ+G RKMA PSG VEGC+V
Sbjct  2972  SEADYRLACFAHLAKAMSDFANDHMDKLYTPPTVSYNST-LQAGLRKMAQPSGIVEGCIV  3030

Query  3282  QVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRV  3340
             +V+ G  TLNGLWL D V CPRHVI + + ++++ ++   L+R   HNF + +GN+ L V
Sbjct  3031  RVSYGNLTLNGLWLGDTVICPRHVIASNTTNVIDYDHAMSLVRL--HNFSISSGNMFLGV  3088

Query  3341  IGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK  3400
             I  SM+  +L +KV+ +N  TP Y +  ++PG +F++LACY+GS +GVY   MR N+TI+
Sbjct  3089  ISASMRGTLLHIKVNQSNVNTPNYTYKVLKPGDSFNILACYDGSAAGVYGVNMRTNYTIR  3148

Query  3401  GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD  3460
             GSF++G+CGS G+NI+   V FCYMHH+EL +G H G+D++G  YG + D+ T Q  G  
Sbjct  3149  GSFISGACGSPGYNINNGVVEFCYMHHLELGSGCHVGSDMDGTMYGKYEDQPTLQIEGAS  3208

Query  3461  TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQT  3520
               +T NV +WLY A+INGDRW+L+  +  ++ +N  A++     L   +VD    L A+T
Sbjct  3209  NLVTENVCSWLYGALINGDRWWLSSVSVGVDTYNEWALRNGMTALK--NVDCFSLLVAKT  3266

Query  3521  GIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSA-VKRTIKGT  3579
             G+ V  + AS+++L  N   G++ILG   L DEFT  +VV+Q  GVT QS  V R  +  
Sbjct  3267  GVDVGRLLASIQKLHGN-FGGKSILGCTSLCDEFTLSEVVKQMYGVTLQSGKVSRAFRNA  3325

Query  3580  HHWLLLTILTSLLVLVQSTQW--SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLC  3637
                   +I+  LL L  S     S  F++      P  + II  S+  M+ VKHK  FL 
Sbjct  3326  ------SIVCCLLFLFLSEMLNHSKLFWINPGYITPVFLAIIVASSALMLLVKHKLLFLQ  3379

Query  3638  LFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTA  3697
             L+LLPSL  V+ +N ++    +   ++   D       GF +   +  +    ++ L T 
Sbjct  3380  LYLLPSLCIVSGYN-IFKDYHFYTYMLEEFDY-KVPFGGFNVTGVLNISLCCFVMGLHTF  3437

Query  3698  RTVYDDGARRVWT-LMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR  3756
             R  +     ++++ ++ VLT++Y  YY      +  +  LI++  S +    T   F+  
Sbjct  3438  R--FLQTPNKIFSYVVAVLTVLYTYYY------STDVLGLILTSMSGF----TNYWFIGT  3485

Query  3757  GIVFMCVEYCP--IFFITGNTLQCIMLVYCFLGYFCTC-YFGLFCLLNRYFRLTLGVYDY  3813
                 +     P      + + ++ ++ +Y  LGY C C Y+G    +NR+ +LTLG Y++
Sbjct  3486  ATYKLATYVLPHTSLLDSFDAIKAVVFLYLLLGY-CNCVYYGSLYWINRFCKLTLGCYEF  3544

Query  3814  LVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLL  3873
              VS  EF+YM + GL  P    DA  L++KL+GVGG+  IK+++VQSK++D+KCT+VVLL
Sbjct  3545  KVSAAEFKYMVANGLRAPTGVFDALILSLKLIGVGGRKTIKISSVQSKLTDLKCTNVVLL  3604

Query  3874  SVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEE  3933
               L  + + ++S+ WA CV LHN I L  D   A E +++LL+  LS   A  +++L + 
Sbjct  3605  GCLSNMNIAANSREWAYCVDLHNKINLCNDAEAAQEMLLALLAFFLSKNSAFGVDELLDS  3664

Query  3934  MLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDR  3993
               ++ + LQ++A+ + +LPSY A+ TA+++YE A+ANG    ++K+L+ ++NVAKSEFDR
Sbjct  3665  YFNDSSVLQSVAATYVNLPSYLAYETARQSYEDALANGSPPQLVKQLRHAMNVAKSEFDR  3724

Query  3994  DAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNAR  4053
             +A+ QRKL++MA+QA +QMYK+AR+ ++++KV SAM ++LF MLR+LD  +++ I++ A+
Sbjct  3725  EASTQRKLDRMAEQAASQMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMSSVDTILSLAK  3784

Query  4054  DGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSE  4113
             DG VPL+IIP  +A KL +V+ D  +Y          YA  +W +  + D D K V   E
Sbjct  3785  DGVVPLSIIPAVSATKLNIVVSDIESYSKIQREGCVHYAGVIWSVVDIKDNDGKPVHAKE  3844

Query  4114  ISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYN  4173
             +   N  +LAWPL +   R    +KLQNNE+ P  ++Q    A   +    D NAL  Y+
Sbjct  3845  VVTSNVESLAWPLFLNCER---IIKLQNNEIIPSKIKQRPIKA-EGEGVVADGNAL--YS  3898

Query  4174  TTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKG  4233
                G  F+ A +SD  DLK  ++    G+  I  ELEPPC+F+ + P GP VKYLYF++ 
Sbjct  3899  NEGGRTFMYAFISDKPDLKVVKWEFDGGSNAI--ELEPPCKFLVEAPSGPVVKYLYFVRN  3956

Query  4234  LNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITN  4293
             LNNL RG VLG + ATVRLQAG  TE   NS++L+ CAFAVD  K Y D + SG +P+ N
Sbjct  3957  LNNLRRGAVLGFIGATVRLQAGKQTEQATNSSLLTLCAFAVDPPKTYLDAVKSGHRPVGN  4016

Query  4294  CVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIP  4353
             CVKML   +G GQAIT   EA+ +Q+S+GGAS CLYCR H++HP+  GFC L+GKYVQ+P
Sbjct  4017  CVKMLANGSGNGQAITNGVEASTNQDSYGGASVCLYCRAHVEHPDMDGFCKLRGKYVQVP  4076

Query  4354  TTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
                  DP+ F L+NTVC VCG W+  GC+CD+    ++QS D+  +LN
Sbjct  4077  LGTL-DPIRFVLENTVCKVCGCWQANGCTCDR---AVIQSVDS-GYLN  4119


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 95/209 (45%), Gaps = 16/209 (8%)

Query  1052  VKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA  1111
             V    VVNAAN  L HGGG+A AL+  T   +QV S+ Y++ NG +KVG   ++      
Sbjct  1318  VNHDFVVNAANEQLSHGGGIAKALDDLTKGELQVLSNQYVSRNGSIKVGSGVLIKCKE--  1375

Query  1112  KHCLHVVGPNVNKGEDIQLLKSAYE-NFNQHEVLLAPLLSAGIFGADPIHSLR---VCVD  1167
                L+VVGP   K    +LL  AY   F Q  V L PLLS GIF      SL     CV 
Sbjct  1376  HSILNVVGPRKGK-HAAELLTKAYTFVFKQKGVPLMPLLSVGIFKVPITESLAAFLACVG  1434

Query  1168  TVRTNVYLAVFDKNL-YDKLVSSFLEMKSEKQVE-----QKIAEIPKEEVKPFITESKPS  1221
                   +     + L     V+SF   ++E+ VE     Q++  +  E+  P +    P 
Sbjct  1435  DRVCKCFCYTDKERLAIQNFVTSF---QTEQPVEPLPVIQEVKGVQLEKPVPDVKVENPC  1491

Query  1222  VEQRKQDDKKIKACVEEVTTTLEETKFLT  1250
                R + D K       +  +L+ T+ ++
Sbjct  1492  EPFRIEGDAKFYDLTPSMVQSLQVTRLVS  1520


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 87/206 (42%), Gaps = 12/206 (6%)

Query  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             +L E + ++V  T D  + HT  +  S TYGQQ G   ++   VT +KP +  +  +  V
Sbjct  1634  TLFEAKPVQVVVTQDQRSFHTVELSTSQTYGQQLGDCVVEDKKVTNLKPVSKDKVVS--V  1691

Query  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTK-KWKYPQVNGLTSIKWADNNCYLATA  1679
             +PN     V+  ++Y   D          L+HT   +    VNG   ++ +DNNC++   
Sbjct  1692  VPN-----VDWDKHYGFVDAGIF----HTLDHTMFVFDNNVVNGKRVLRTSDNNCWINAV  1742

Query  1680  LLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHA  1739
              L LQ    KF P  LQ  +     G+ A F   +        GE  D   T++ + +  
Sbjct  1743  CLQLQFANAKFKPKGLQQLWESYCTGDVAMFVHWLYWITGVEKGEPSDAENTLNIISRFL  1802

Query  1740  NLDSCKRVLNVVCKTCGQQQTTLKGV  1765
                    +L     TC    +T + V
Sbjct  1803  KPQGSVEMLRATSTTCDGTCSTKRVV  1828


> sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavirus 
NL63 OX=277944 GN=1a PE=1 SV=1
Length=4060

 Score = 1192 bits (3085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 771/2183 (35%), Positives = 1161/2183 (53%), Gaps = 174/2183 (8%)

Query  2263  CTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS-FKWDLTAF  2321
             C     GY  ST      YC  S+ C +CL      +       +   I       L  F
Sbjct  1999  CGDIVSGYEKST-FNKDIYCGNSMVCKMCLFSYQEFNDLDHTSLVWKHIRDPILISLQPF  2057

Query  2322  GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMV  2381
              ++    +   ++ RF  +  +A  +  F S+   H     W +          P   + 
Sbjct  2058  VILVILLIFGNMYLRFGLLYFVAQFISTFGSFLGFH--QKQWFL-------HFVPFDVLC  2108

Query  2382  RMYIFFASFYYVWKSYV---HVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYA  2438
                 F A+F  V K  +   H++ GCN++ C+ C K  R  RV   TI+NG+ +SFYV A
Sbjct  2109  NE--FLATFI-VCKIVLFVRHIIVGCNNADCVACSKSARLKRVPLQTIINGMHKSFYVNA  2165

Query  2439  NGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKN  2498
             NGG  FC  HN+ CVNCD+F  G+TFI+ ++AR+L    K  + PT  +  I+D V   N
Sbjct  2166  NGGTCFCNKHNFFCVNCDSFGPGNTFINGDIARELGNVVKTAVQPTAPAYVIIDKVDFVN  2225

Query  2499  GSIHLY---------FDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKC  2549
             G   LY         FD    K   +  L +   L+N    N  GS   N+         
Sbjct  2226  GFYRLYSGDTFWRYDFDITESKYSCKEVLKNCNVLENFIVYNNSGS---NI---------  2273

Query  2550  EESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKL  2609
               +  K+A VY+SQL+C+PI L++  L+S +  S +    +  AYV+   ++F       
Sbjct  2274  --TQIKNACVYFSQLLCEPIKLVNSELLSTL--SVDFNGVLHKAYVDVLCNSF-------  2322

Query  2610  KTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDS  2669
                      EL  N+S+    +T       G   SD    D V  +  +H+ D+ ++  S
Sbjct  2323  -------FKELTANMSMAECKATL------GLTVSD---DDFVSAVANAHRYDVLLSDLS  2366

Query  2670  CNNYMLTYNKVEN-MTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQ  2728
              NN+ ++Y K E+ ++  D+  C+   ++ +N  V    +I ++W VKDF +LS++ +K 
Sbjct  2367  FNNFFISYAKPEDKLSVYDIACCMRAGSKVVNHNVLIKESIPIVWGVKDFNTLSQEGKKY  2426

Query  2729  IRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG---KIVNNWLKQLIKVTLVFLFVAA  2785
             +    K   L F LT    + +  V  T I  K G   K   N+L        V LFV A
Sbjct  2427  LVKTTKAKGLTFLLTFNDNQAITQVPATSIVAKQGAGFKRTYNFL------WYVCLFVVA  2480

Query  2786  IFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSY  2845
             +F  ++ +   +  T F      +K I+ G  +   +   C  N   +F+ W   + G  
Sbjct  2481  LFIGVSFIDYTTTVTSFHG--YDFKYIENGQLKVFEAPLHCVRNVFDNFNQWHEAKFGVV  2538

Query  2846  T-NDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGN--ICYTPSKL  2902
             T N   CP++  V  R    VVPG+P  +     G  L F  +  +A GN  +CY     
Sbjct  2539  TTNSDKCPIVVGVSERIN--VVPGVPTNVYLV--GKTLVFTLQ--AAFGNTGVCY-----  2587

Query  2903  IEYTDFATS-ACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI  2961
              ++    TS  C+  + CT  +   G  V YCY+T+++EGS  Y +L+P+  Y     + 
Sbjct  2588  -DFDGVTTSDKCIFNSACTRLEGLGGDNV-YCYNTDLIEGSKPYSTLQPNAYYKYDAKNY  2645

Query  2962  IQFPNTYLEG-SVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCG  3020
             ++FP     G  +R + T  + YCR G C  S  GVC     +W +N+   R   G  CG
Sbjct  2646  VRFPEILARGFGLRTIRTLATRYCRVGECRDSHKGVCFGFD-KWYVNDG--RVDDGYICG  2702

Query  3021  VDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAF  3080
                ++LL N+ +        + +S  ++   + A  +T L +   +F+R FG+ S+ V  
Sbjct  2703  DGLIDLLVNVLSIFSSSFSVVAMSGHMLFNFLFAAFITFLCFLVTKFKRVFGDLSYGV--  2760

Query  3081  NTLLFLMSFTVLCLTPVYS---------FLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVM  3131
                     FTV+C T + +         F   +Y++  LY  F  T   +++ HI ++V 
Sbjct  2761  --------FTVVCATLINNISYVVTQNLFFMLLYAI--LYFVFTRTVRYAWIWHIAYIVA  2810

Query  3132  FTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNK  3187
             +  L+P+W+   +    S   F     N  K ++   +F G  F  TFE AA  TF+L+ 
Sbjct  2811  YFLLIPWWLLTWF----SFAAFLELLPNVFKLKISTQLFEGDKFIGTFESAAAGTFVLDM  2866

Query  3188  EMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSD  3247
               Y +L + +     +   Y A YNKYKY+SG+     YR A   HLAKA+ D++   +D
Sbjct  2867  RSYERLINTI--SPEKLKNYAASYNKYKYYSGSASEADYRCACYAHLAKAMLDYAKDHND  2924

Query  3248  VLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC  3307
             +LY PP  S  S  LQSG +KMA PSG VE C+V+V  G+T LNG+WL D V CPRHVI 
Sbjct  2925  MLYSPPTISYNST-LQSGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIA  2983

Query  3308  TSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFV  3367
              S  +L  +Y+        HNF V    V L V+G +M   VL++KV  +N  TPK+ F 
Sbjct  2984  PSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFK  3042

Query  3368  RIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMH  3426
              ++PG +F++LACY G  SGV+   +R NFTIKGSF+NG+CGS G+N+  D  V FCY+H
Sbjct  3043  TLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLH  3102

Query  3427  HMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRF  3486
              +EL +G H G+D  G+ YG F D+ + Q    +  ++ NV+A+LYAA++NG RW+L   
Sbjct  3103  QIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCST  3162

Query  3487  TTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILG  3546
                ++ FN  AM   Y  ++   V+    L+A+TG++V  + AS++ L   G  G+ ILG
Sbjct  3163  RVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQHL-HEGFGGKNILG  3219

Query  3547  SALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFL  3606
              + L DEFT  +VV+Q  GV  QS   + I G     L ++  ++        W+  F +
Sbjct  3220  YSSLCDEFTLAEVVKQMYGVNLQSG--KVIFGLKTMFLFSVFFTMF-------WAELF-I  3269

Query  3607  YENA-------FLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASW  3659
             Y N          P    ++ +S    MF+KHK  FL +FLLP++   A +N V     +
Sbjct  3270  YTNTIWINPVILTPIFCLLLFLSLVLTMFLKHKFLFLQVFLLPTVIATALYNCVL--DYY  3327

Query  3660  VMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVY  3719
             +++ +      + S+    ++  V     + ++ L T R   +        + +++ + Y
Sbjct  3328  IVKFLADHFNYNVSVLQMDVQGLVNVLVCLFVVFLHTWRFSKERFTHWFTYVCSLIAVAY  3387

Query  3720  KVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCI  3779
               +Y       + M+   IS +  Y G +  V  L+R IVF   E   +F + G+ ++  
Sbjct  3388  TYFYSGDFLSLLVMFLCAIS-SDWYIGAI--VFRLSRLIVFFSPE--SVFSVFGD-VKLT  3441

Query  3780  MLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFK  3839
             ++VY   GY    Y+G+    NR+F+ T+GVYD+ VS  EF+YM + GL  P    DA  
Sbjct  3442  LVVYLICGYLVCTYWGILYWFNRFFKCTMGVYDFKVSAAEFKYMVANGLHAPHGPFDALW  3501

Query  3840  LNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDIL  3899
             L+ KLLG+GG  CIK++TVQSK++D+KCT+VVLL  L  + + ++S  WA CV LHN I 
Sbjct  3502  LSFKLLGIGGDRCIKISTVQSKLTDLKCTNVVLLGCLSSMNIAANSSEWAYCVDLHNKIN  3561

Query  3900  LAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFAT  3959
             L  D  +A   +++LL+  LS      ++ L +   DN +TLQ++AS F S+PSY A+  
Sbjct  3562  LCDDPEKAQSMLLALLAFFLSKHSDFGLDGLIDSYFDNSSTLQSVASSFVSMPSYIAYEN  3621

Query  3960  AQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSE  4019
             A++AYE A+ANG S  ++K+LK+++N+AKSEFD + ++Q+K+ +MA+QA TQMYK+ARS 
Sbjct  3622  ARQAYEDAIANGSSSQLIKQLKRAMNIAKSEFDHEISVQKKINRMAEQAATQMYKEARSV  3681

Query  4020  DKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT  4079
             ++++KV SAM ++LF MLR+LD  ++  ++N ARDG VPL++IP T+A+KL +V PD  +
Sbjct  3682  NRKSKVISAMHSLLFGMLRRLDMSSVETVLNLARDGVVPLSVIPATSASKLTIVSPDLES  3741

Query  4080  Y-KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK  4138
             Y K  CDG+   YA  +W +  V D D + V + EI+ +N   L WPLI+   R    VK
Sbjct  3742  YSKIVCDGSV-HYAGVVWTLNDVKDNDGRPVHVKEITKENVETLTWPLILNCER---VVK  3797

Query  4139  LQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPK  4198
             LQNNE+ P  L+Q    A        D NAL  YNT  G  F+ A +S+  DLK+ ++  
Sbjct  3798  LQNNEIMPGKLKQKPMKAEGDGGVLGDGNAL--YNTEGGKTFMYAYISNKADLKFVKWEY  3855

Query  4199  SDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNAT  4258
               G  TI  EL+ PCRF+ +TP GP+VKYLYF+K LN L RG VLG + AT+RLQAG  T
Sbjct  3856  EGGCNTI--ELDSPCRFMVETPNGPQVKYLYFVKNLNTLRRGAVLGFIGATIRLQAGKQT  3913

Query  4259  EVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQ  4318
             E+  NS +L+ CAF+VD A  Y + +  G +P++NC+KML    G GQAIT + +AN +Q
Sbjct  3914  ELAVNSGLLTACAFSVDPATTYLEAVKHGAKPVSNCIKMLSNGAGNGQAITTSVDANTNQ  3973

Query  4319  ESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKG  4378
             +S+GGAS CLYCR H+ HP+  G+C  KGK VQ+P  C  DP+ F L+N VC VCG W G
Sbjct  3974  DSYGGASICLYCRAHVPHPSMDGYCKFKGKCVQVPIGCL-DPIRFCLENNVCNVCGCWLG  4032

Query  4379  YGCSCDQLREPMLQSADAQSFLN  4401
             +GC+CD+     +QS D  S+LN
Sbjct  4033  HGCACDR---TTIQSVDI-SYLN  4051


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 84/171 (49%), Gaps = 9/171 (5%)

Query  993   GSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKV  1052
             G  D + +++ T+  V        +  ++  EV  F+ Y     NV     DI      V
Sbjct  1228  GVFDIKNSSVNTVCFVDVDFH---SVEIEAGEVKPFAVY----KNVKFYLGDISHLVNCV  1280

Query  1053  KPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK  1112
                 VVNAAN  L HGGGVA A++  T   +Q  S DYI++NGPLKVG   +L       
Sbjct  1281  SFDFVVNAANENLLHGGGVARAIDILTEGQLQSLSKDYISSNGPLKVGAGVMLECEKF--  1338

Query  1113  HCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLR  1163
             +  +VVGP   K E   L+++      ++ + L PLLS GIFG    +SL+
Sbjct  1339  NVFNVVGPRTGKHEHSLLVEAYNSILFENGIPLMPLLSCGIFGVRIENSLK  1389


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 72/174 (41%), Gaps = 16/174 (9%)

Query  1573  TVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLP-NDDTLRVEA  1631
             T D IN+   VV+ S + G+Q G    DG D        S EG    VLP N DT+   A
Sbjct  1587  TEDGINVKDVVVESSKSLGKQLGVVS-DGVD--------SFEG----VLPINTDTVLSVA  1633

Query  1632  FEYYHTTDPSFLGRYMSALNHTKKWKYPQ--VNGLTSIKWADNNCYLATALLTLQQIELK  1689
              E        F    + A    K + YP   V G   +   DNNC++    + LQ ++  
Sbjct  1634  PEVDWVAFYGFEKAALFASLDVKPYGYPNDFVGGFRVLGTTDNNCWVNATCIILQYLKPT  1693

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS  1743
             F    L   + +   G+   F + I      + G+ GD  E +S L ++   DS
Sbjct  1694  FKSKGLNVLWNKFVTGDVGPFVSFIYFITMSSKGQKGDAEEALSKLSEYLISDS  1747


 Score = 38.1 bits (87),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 72/176 (41%), Gaps = 13/176 (7%)

Query  1663  GLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTV  1722
             G+  +  +DNNC+++T L+ LQ  +L  +   +Q      + G+  +         +   
Sbjct  1051  GVRVLDQSDNNCWISTTLVQLQLTKLLDDSIEMQ----LFKVGKVDSIVQKCYELSHLIS  1106

Query  1723  GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKG  1782
             G LGD  + +S L +     +C     + C  CG++     G    ++      + F+KG
Sbjct  1107  GSLGDSGKLLSELLKEKY--TCSITFEMSCD-CGKKFDDQVG---CLFWIMPYTKLFQKG  1160

Query  1783  VQIPCTCGKQATKYLVQQESPFVMMSAP-PAQYELKHGTFTCASEYTGNYQCGHYK  1837
                 C C K  T  LV  +   V +  P P   +       C+S Y G    GHY+
Sbjct  1161  E--CCICHKMQTYKLVSMKGTGVFVQDPAPIDIDAFPVKPICSSVYLGVKGSGHYQ  1214


> sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus 
NL63 OX=277944 GN=rep PE=1 SV=1
Length=6729

 Score = 1192 bits (3085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 771/2183 (35%), Positives = 1161/2183 (53%), Gaps = 174/2183 (8%)

Query  2263  CTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISS-FKWDLTAF  2321
             C     GY  ST      YC  S+ C +CL      +       +   I       L  F
Sbjct  1999  CGDIVSGYEKST-FNKDIYCGNSMVCKMCLFSYQEFNDLDHTSLVWKHIRDPILISLQPF  2057

Query  2322  GLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMV  2381
              ++    +   ++ RF  +  +A  +  F S+   H     W +          P   + 
Sbjct  2058  VILVILLIFGNMYLRFGLLYFVAQFISTFGSFLGFH--QKQWFL-------HFVPFDVLC  2108

Query  2382  RMYIFFASFYYVWKSYV---HVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYA  2438
                 F A+F  V K  +   H++ GCN++ C+ C K  R  RV   TI+NG+ +SFYV A
Sbjct  2109  NE--FLATFI-VCKIVLFVRHIIVGCNNADCVACSKSARLKRVPLQTIINGMHKSFYVNA  2165

Query  2439  NGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKN  2498
             NGG  FC  HN+ CVNCD+F  G+TFI+ ++AR+L    K  + PT  +  I+D V   N
Sbjct  2166  NGGTCFCNKHNFFCVNCDSFGPGNTFINGDIARELGNVVKTAVQPTAPAYVIIDKVDFVN  2225

Query  2499  GSIHLY---------FDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKC  2549
             G   LY         FD    K   +  L +   L+N    N  GS   N+         
Sbjct  2226  GFYRLYSGDTFWRYDFDITESKYSCKEVLKNCNVLENFIVYNNSGS---NI---------  2273

Query  2550  EESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKL  2609
               +  K+A VY+SQL+C+PI L++  L+S +  S +    +  AYV+   ++F       
Sbjct  2274  --TQIKNACVYFSQLLCEPIKLVNSELLSTL--SVDFNGVLHKAYVDVLCNSF-------  2322

Query  2610  KTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDS  2669
                      EL  N+S+    +T       G   SD    D V  +  +H+ D+ ++  S
Sbjct  2323  -------FKELTANMSMAECKATL------GLTVSD---DDFVSAVANAHRYDVLLSDLS  2366

Query  2670  CNNYMLTYNKVEN-MTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQ  2728
              NN+ ++Y K E+ ++  D+  C+   ++ +N  V    +I ++W VKDF +LS++ +K 
Sbjct  2367  FNNFFISYAKPEDKLSVYDIACCMRAGSKVVNHNVLIKESIPIVWGVKDFNTLSQEGKKY  2426

Query  2729  IRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG---KIVNNWLKQLIKVTLVFLFVAA  2785
             +    K   L F LT    + +  V  T I  K G   K   N+L        V LFV A
Sbjct  2427  LVKTTKAKGLTFLLTFNDNQAITQVPATSIVAKQGAGFKRTYNFL------WYVCLFVVA  2480

Query  2786  IFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSY  2845
             +F  ++ +   +  T F      +K I+ G  +   +   C  N   +F+ W   + G  
Sbjct  2481  LFIGVSFIDYTTTVTSFHG--YDFKYIENGQLKVFEAPLHCVRNVFDNFNQWHEAKFGVV  2538

Query  2846  T-NDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGN--ICYTPSKL  2902
             T N   CP++  V  R    VVPG+P  +     G  L F  +  +A GN  +CY     
Sbjct  2539  TTNSDKCPIVVGVSERIN--VVPGVPTNVYLV--GKTLVFTLQ--AAFGNTGVCY-----  2587

Query  2903  IEYTDFATS-ACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSI  2961
              ++    TS  C+  + CT  +   G  V YCY+T+++EGS  Y +L+P+  Y     + 
Sbjct  2588  -DFDGVTTSDKCIFNSACTRLEGLGGDNV-YCYNTDLIEGSKPYSTLQPNAYYKYDAKNY  2645

Query  2962  IQFPNTYLEG-SVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCG  3020
             ++FP     G  +R + T  + YCR G C  S  GVC     +W +N+   R   G  CG
Sbjct  2646  VRFPEILARGFGLRTIRTLATRYCRVGECRDSHKGVCFGFD-KWYVNDG--RVDDGYICG  2702

Query  3021  VDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAF  3080
                ++LL N+ +        + +S  ++   + A  +T L +   +F+R FG+ S+ V  
Sbjct  2703  DGLIDLLVNVLSIFSSSFSVVAMSGHMLFNFLFAAFITFLCFLVTKFKRVFGDLSYGV--  2760

Query  3081  NTLLFLMSFTVLCLTPVYS---------FLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVM  3131
                     FTV+C T + +         F   +Y++  LY  F  T   +++ HI ++V 
Sbjct  2761  --------FTVVCATLINNISYVVTQNLFFMLLYAI--LYFVFTRTVRYAWIWHIAYIVA  2810

Query  3132  FTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNK  3187
             +  L+P+W+   +    S   F     N  K ++   +F G  F  TFE AA  TF+L+ 
Sbjct  2811  YFLLIPWWLLTWF----SFAAFLELLPNVFKLKISTQLFEGDKFIGTFESAAAGTFVLDM  2866

Query  3188  EMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSD  3247
               Y +L + +     +   Y A YNKYKY+SG+     YR A   HLAKA+ D++   +D
Sbjct  2867  RSYERLINTI--SPEKLKNYAASYNKYKYYSGSASEADYRCACYAHLAKAMLDYAKDHND  2924

Query  3248  VLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVIC  3307
             +LY PP  S  S  LQSG +KMA PSG VE C+V+V  G+T LNG+WL D V CPRHVI 
Sbjct  2925  MLYSPPTISYNST-LQSGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIA  2983

Query  3308  TSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFV  3367
              S  +L  +Y+        HNF V    V L V+G +M   VL++KV  +N  TPK+ F 
Sbjct  2984  PSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPKHVFK  3042

Query  3368  RIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMH  3426
              ++PG +F++LACY G  SGV+   +R NFTIKGSF+NG+CGS G+N+  D  V FCY+H
Sbjct  3043  TLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLH  3102

Query  3427  HMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRF  3486
              +EL +G H G+D  G+ YG F D+ + Q    +  ++ NV+A+LYAA++NG RW+L   
Sbjct  3103  QIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLMLSDNVVAFLYAALLNGCRWWLCST  3162

Query  3487  TTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILG  3546
                ++ FN  AM   Y  ++   V+    L+A+TG++V  + AS++ L   G  G+ ILG
Sbjct  3163  RVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQHL-HEGFGGKNILG  3219

Query  3547  SALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFL  3606
              + L DEFT  +VV+Q  GV  QS   + I G     L ++  ++        W+  F +
Sbjct  3220  YSSLCDEFTLAEVVKQMYGVNLQSG--KVIFGLKTMFLFSVFFTMF-------WAELF-I  3269

Query  3607  YENA-------FLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASW  3659
             Y N          P    ++ +S    MF+KHK  FL +FLLP++   A +N V     +
Sbjct  3270  YTNTIWINPVILTPIFCLLLFLSLVLTMFLKHKFLFLQVFLLPTVIATALYNCVL--DYY  3327

Query  3660  VMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVY  3719
             +++ +      + S+    ++  V     + ++ L T R   +        + +++ + Y
Sbjct  3328  IVKFLADHFNYNVSVLQMDVQGLVNVLVCLFVVFLHTWRFSKERFTHWFTYVCSLIAVAY  3387

Query  3720  KVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCI  3779
               +Y       + M+   IS +  Y G +  V  L+R IVF   E   +F + G+ ++  
Sbjct  3388  TYFYSGDFLSLLVMFLCAIS-SDWYIGAI--VFRLSRLIVFFSPE--SVFSVFGD-VKLT  3441

Query  3780  MLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFK  3839
             ++VY   GY    Y+G+    NR+F+ T+GVYD+ VS  EF+YM + GL  P    DA  
Sbjct  3442  LVVYLICGYLVCTYWGILYWFNRFFKCTMGVYDFKVSAAEFKYMVANGLHAPHGPFDALW  3501

Query  3840  LNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDIL  3899
             L+ KLLG+GG  CIK++TVQSK++D+KCT+VVLL  L  + + ++S  WA CV LHN I 
Sbjct  3502  LSFKLLGIGGDRCIKISTVQSKLTDLKCTNVVLLGCLSSMNIAANSSEWAYCVDLHNKIN  3561

Query  3900  LAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFAT  3959
             L  D  +A   +++LL+  LS      ++ L +   DN +TLQ++AS F S+PSY A+  
Sbjct  3562  LCDDPEKAQSMLLALLAFFLSKHSDFGLDGLIDSYFDNSSTLQSVASSFVSMPSYIAYEN  3621

Query  3960  AQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSE  4019
             A++AYE A+ANG S  ++K+LK+++N+AKSEFD + ++Q+K+ +MA+QA TQMYK+ARS 
Sbjct  3622  ARQAYEDAIANGSSSQLIKQLKRAMNIAKSEFDHEISVQKKINRMAEQAATQMYKEARSV  3681

Query  4020  DKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT  4079
             ++++KV SAM ++LF MLR+LD  ++  ++N ARDG VPL++IP T+A+KL +V PD  +
Sbjct  3682  NRKSKVISAMHSLLFGMLRRLDMSSVETVLNLARDGVVPLSVIPATSASKLTIVSPDLES  3741

Query  4080  Y-KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVK  4138
             Y K  CDG+   YA  +W +  V D D + V + EI+ +N   L WPLI+   R    VK
Sbjct  3742  YSKIVCDGSV-HYAGVVWTLNDVKDNDGRPVHVKEITKENVETLTWPLILNCER---VVK  3797

Query  4139  LQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPK  4198
             LQNNE+ P  L+Q    A        D NAL  YNT  G  F+ A +S+  DLK+ ++  
Sbjct  3798  LQNNEIMPGKLKQKPMKAEGDGGVLGDGNAL--YNTEGGKTFMYAYISNKADLKFVKWEY  3855

Query  4199  SDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNAT  4258
               G  TI  EL+ PCRF+ +TP GP+VKYLYF+K LN L RG VLG + AT+RLQAG  T
Sbjct  3856  EGGCNTI--ELDSPCRFMVETPNGPQVKYLYFVKNLNTLRRGAVLGFIGATIRLQAGKQT  3913

Query  4259  EVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQ  4318
             E+  NS +L+ CAF+VD A  Y + +  G +P++NC+KML    G GQAIT + +AN +Q
Sbjct  3914  ELAVNSGLLTACAFSVDPATTYLEAVKHGAKPVSNCIKMLSNGAGNGQAITTSVDANTNQ  3973

Query  4319  ESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKG  4378
             +S+GGAS CLYCR H+ HP+  G+C  KGK VQ+P  C  DP+ F L+N VC VCG W G
Sbjct  3974  DSYGGASICLYCRAHVPHPSMDGYCKFKGKCVQVPIGCL-DPIRFCLENNVCNVCGCWLG  4032

Query  4379  YGCSCDQLREPMLQSADAQSFLN  4401
             +GC+CD+     +QS D  S+LN
Sbjct  4033  HGCACDR---TTIQSVDI-SYLN  4051


 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 84/171 (49%), Gaps = 9/171 (5%)

Query  993   GSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKV  1052
             G  D + +++ T+  V        +  ++  EV  F+ Y     NV     DI      V
Sbjct  1228  GVFDIKNSSVNTVCFVDVDFH---SVEIEAGEVKPFAVY----KNVKFYLGDISHLVNCV  1280

Query  1053  KPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK  1112
                 VVNAAN  L HGGGVA A++  T   +Q  S DYI++NGPLKVG   +L       
Sbjct  1281  SFDFVVNAANENLLHGGGVARAIDILTEGQLQSLSKDYISSNGPLKVGAGVMLECEKF--  1338

Query  1113  HCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLR  1163
             +  +VVGP   K E   L+++      ++ + L PLLS GIFG    +SL+
Sbjct  1339  NVFNVVGPRTGKHEHSLLVEAYNSILFENGIPLMPLLSCGIFGVRIENSLK  1389


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 72/174 (41%), Gaps = 16/174 (9%)

Query  1573  TVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLP-NDDTLRVEA  1631
             T D IN+   VV+ S + G+Q G    DG D        S EG    VLP N DT+   A
Sbjct  1587  TEDGINVKDVVVESSKSLGKQLG-VVSDGVD--------SFEG----VLPINTDTVLSVA  1633

Query  1632  FEYYHTTDPSFLGRYMSALNHTKKWKYPQ--VNGLTSIKWADNNCYLATALLTLQQIELK  1689
              E        F    + A    K + YP   V G   +   DNNC++    + LQ ++  
Sbjct  1634  PEVDWVAFYGFEKAALFASLDVKPYGYPNDFVGGFRVLGTTDNNCWVNATCIILQYLKPT  1693

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS  1743
             F    L   + +   G+   F + I      + G+ GD  E +S L ++   DS
Sbjct  1694  FKSKGLNVLWNKFVTGDVGPFVSFIYFITMSSKGQKGDAEEALSKLSEYLISDS  1747


 Score = 37.7 bits (86),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 72/176 (41%), Gaps = 13/176 (7%)

Query  1663  GLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTV  1722
             G+  +  +DNNC+++T L+ LQ  +L  +   +Q      + G+  +         +   
Sbjct  1051  GVRVLDQSDNNCWISTTLVQLQLTKLLDDSIEMQ----LFKVGKVDSIVQKCYELSHLIS  1106

Query  1723  GELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKG  1782
             G LGD  + +S L +     +C     + C  CG++     G    ++      + F+KG
Sbjct  1107  GSLGDSGKLLSELLKEKY--TCSITFEMSCD-CGKKFDDQVG---CLFWIMPYTKLFQKG  1160

Query  1783  VQIPCTCGKQATKYLVQQESPFVMMSAP-PAQYELKHGTFTCASEYTGNYQCGHYK  1837
                 C C K  T  LV  +   V +  P P   +       C+S Y G    GHY+
Sbjct  1161  E--CCICHKMQTYKLVSMKGTGVFVQDPAPIDIDAFPVKPICSSVYLGVKGSGHYQ  1214


> sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=1a PE=1 SV=1
Length=4117

 Score = 1189 bits (3075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 757/2212 (34%), Positives = 1174/2212 (53%), Gaps = 157/2212 (7%)

Query  2230  IIWFLLLS-VCLG-SLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIP  2287
             + WF +L    LG   +Y+   + +  + +G P  C     GY NS+      YC  S+ 
Sbjct  2020  LYWFKVLGKFSLGIYALYALLFMTIRFTPIGSP-VCDDVVAGYANSS-FDKNEYCN-SVI  2076

Query  2288  CSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIM  2347
             C VCL G   L  +   + +        W      L+            FFY+  LA   
Sbjct  2077  CKVCLYGYQELSDFSHTQVV--------WQHLRDPLIGN-------VMPFFYLAFLAIFG  2121

Query  2348  QLFFSYFAVHFIS---NSWLMWL----IINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
              ++     ++FI    NS  ++L     I  +Q+ P        + F     V     HV
Sbjct  2122  GVYVKAITLYFIFQYLNSLGVFLGLQQSIWFLQLVPFDVFGDEIVVFFIVTRVLMFIKHV  2181

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
               GC+ ++C+ C K  R  RV   TI  G  +SFYV+ANGG  FCK HN+ C+NCD++  
Sbjct  2182  CLGCDKASCVACSKSARLKRVPVQTIFQGTSKSFYVHANGGSKFCKKHNFFCLNCDSYGP  2241

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             G TFI+D +A ++    K  + PT  ++ ++D V   NG  +LY      K     + S 
Sbjct  2242  GCTFINDVIATEVGNVVKLNVQPTGPATILIDKVEFSNGFYYLYSGDTFWKYNFDITDSK  2301

Query  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580
             +   + L+      S+  + IVF+       +  K+A VY+SQ++C+P+ L+D AL++ +
Sbjct  2302  YTCKEALK----NCSIITDFIVFNNNGS-NVNQVKNACVYFSQMLCKPVKLVDSALLASL  2356

Query  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNV-LSTFISAARQ  2639
               S +    +  A+V+  S++F   +     +      +    +  D+V L TF +A  +
Sbjct  2357  --SVDFGASLHSAFVSVLSNSFGKDLSSCNDM-----QDCKSTLGFDDVPLDTFNAAVAE  2409

Query  2640  GFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTP-RDLGACIDCSARH  2698
                               +H+ D+ +T  S NN+  +Y K E   P  D+  C+   A+ 
Sbjct  2410  ------------------AHRYDVLLTDMSFNNFTTSYAKPEEKFPVHDIATCMRVGAKI  2451

Query  2699  INAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKI  2758
             +N  V    +I ++W V+DF++LSE+ RK I    K   + F LT    R    + T  I
Sbjct  2452  VNHNVLVKDSIPVVWLVRDFIALSEETRKYIIRTTKVKGITFMLTFNDCRMHTTIPTVCI  2511

Query  2759  ALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEI-----IGYKAID  2813
             A K G  + ++ K       + LF+ A F+ ++         DFS+++       +K I+
Sbjct  2512  ANKKGAGLPSFSKVKKFFWFLCLFIVAAFFALS-------FLDFSTQVSSDSDYDFKYIE  2564

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGG-SYTNDKACPLIAAVITREVGFVVPGLPGT  2872
              G  +   +  +C  N   +FD W   + G +  N+ +CP++  V   +    VPG+P  
Sbjct  2565  SGQLKTFDNPLSCVHNVFINFDQWHDAKFGFTPVNNPSCPIVVGV--SDEARTVPGIPAG  2622

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +     G  L F          +C+  S + +       AC+  + CT      G  V Y
Sbjct  2623  VYLA--GKTLVFAINTIFGTSGLCFDASGVAD-----KGACIFNSACTTLSGLGGTAV-Y  2674

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVRVVTTFDSEYCRHGTCER  2991
             CY   ++EG+  Y  L P + Y ++DG+ +  P     G  +R + T    YCR G C +
Sbjct  2675  CYKNGLVEGAKLYSELAPHSYYKMVDGNAVSLPEIISRGFGIRTIRTKAMTYCRVGQCVQ  2734

Query  2992  SEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGG  3051
             S  GVC      +V N +   S     CG     LL N+ +   + +    +S  I+   
Sbjct  2735  SAEGVCFGADRFFVYNAE---SGSDFVCGTGLFTLLMNVISVFSKTVPVTVLSGQILFNC  2791

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYS---HVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVI  3108
             I+A V   + + F +F+R FG+ S     V   TLL  +S+ V   T        +  + 
Sbjct  2792  IIAFVAVAVCFLFTKFKRMFGDMSVGVFTVGACTLLNNVSYIVTQNT--------LGMLG  2843

Query  3109  YLYLTFYLTNDVSFLA--HIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV-  3165
             Y  L F  T  V ++   H+ +++ +  + P+W+ + Y    +    + F  N  K +V 
Sbjct  2844  YATLYFLCTKGVRYMWIWHLGFLISYILIAPWWVLMVY----AFSAIFEFMPNLFKLKVS  2899

Query  3166  --VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMD  3222
               +F G  F  +FE AA  TF+L+   Y +L + +     +  +Y + YNKYKY+SG+  
Sbjct  2900  TQLFEGDKFVGSFENAAAGTFVLDMHAYERLANSI--STEKLRQYASTYNKYKYYSGSAS  2957

Query  3223  TTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQ  3282
                YR A   HLAKA+ D++++ +D LY PP  S  S  LQ+G RKMA PSG VE C+V+
Sbjct  2958  EADYRLACFAHLAKAMMDYASNHNDTLYTPPTVSYNST-LQAGLRKMAQPSGVVEKCIVR  3016

Query  3283  VTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVI  3341
             V  G   LNGLWL D+V CPRHVI +S    ++ +Y   ++R   HNF + +GNV L V+
Sbjct  3017  VCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVV  3074

Query  3342  GHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKG  3401
               +M+  +L++KV+  N  TPKY +  ++PG++F++LACY+G+ +GVY   MR N+TI+G
Sbjct  3075  SATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRG  3134

Query  3402  SFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDT  3461
             SF+NG+CGS G+NI+   V FCY+H +EL +G H G+DL+G  YG + D+ T Q  G  +
Sbjct  3135  SFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASS  3194

Query  3462  TITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTG  3521
               T NVLA+LYAA+ING  W+L+     ++ FN  A+       T  + D    L+A+TG
Sbjct  3195  LFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT--TVGNTDCFSILAAKTG  3252

Query  3522  IAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSA-VKRTIKGTH  3580
             + V  + AS++ L +N   G+ ILG   L DEFT  +VVRQ  GV  Q   V R  +   
Sbjct  3253  VDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQMYGVNLQGGYVSRACRN--  3309

Query  3581  HWLLLTILTSLLVLVQS--TQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCL  3638
                 + ++ S L    S    ++ FF++      P    +  +S+  M  +KHK  F  +
Sbjct  3310  ----VLLVGSFLTFFWSELVSYTKFFWVNPGYVTPMFACLSLLSSLLMFTLKHKTLFFQV  3365

Query  3639  FLLPSLATVAYFNMVYMPASWVMRIMTWL-DMVD--TSLSGFKLKDCVMYASAVVLLILM  3695
             FL+P+L   +  N+ +      + +  +L +  D   SL GF  +  V      V+ IL 
Sbjct  3366  FLIPALIVTSCINLAFD-----VEVYNYLAEHFDYHVSLMGFNAQGLVNIFVCFVVTILH  3420

Query  3696  TART--VYDDGARRVWTLMNVLTLVYKVYYG-NALDQAISMWALIISVTSNYSGVVTTVM  3752
                T   ++  A  V  ++ +LT  Y  +Y  + L  A++++A   SVT N+   V  V 
Sbjct  3421  GTYTWRFFNTPASSVTYVVALLTAAYNYFYASDILSCAMTLFA---SVTGNW--FVGAVC  3475

Query  3753  FLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYD  3812
             +  +  V+M + + P F      ++ +M  Y  LGYF  C++G+    NR+F++++GVYD
Sbjct  3476  Y--KVAVYMALRF-PTFVAIFGDIKSVMFCYLVLGYFTCCFYGILYWFNRFFKVSVGVYD  3532

Query  3813  YLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL  3872
             Y VS  EF+YM + GL  P  ++D+  L+ KL+G+GG+  IK+++VQSK++D+KC++VVL
Sbjct  3533  YTVSAAEFKYMVANGLRAPTGTLDSLLLSAKLIGIGGERNIKISSVQSKLTDIKCSNVVL  3592

Query  3873  LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCE  3932
             L  L  + V ++S  WA CV LHN I L  D  +A E +++LL+  LS   A  ++ L E
Sbjct  3593  LGCLSSMNVSANSTEWAYCVDLHNKINLCNDPEKAQEMLLALLAFFLSKNSAFGLDDLLE  3652

Query  3933  EMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFD  3992
                ++ + LQ++AS +  LPSY  +  A++ YE AV NG    ++K+L+ ++NVAKSEFD
Sbjct  3653  SYFNDNSMLQSVASTYVGLPSYVIYENARQQYEDAVNNGSPPQLVKQLRHAMNVAKSEFD  3712

Query  3993  RDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNA  4052
             R+A+ QRKL++MA+QA  QMYK+AR+ ++++KV SAM ++LF MLR+LD  +++ I+N A
Sbjct  3713  REASTQRKLDRMAEQAAAQMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMSSVDTILNLA  3772

Query  4053  RDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLS  4112
             +DG VPL++IP  +A KL +V  D ++Y          YA  +W I  + D D K+V + 
Sbjct  3773  KDGVVPLSVIPAVSATKLNIVTSDIDSYNRIQREGCVHYAGTIWNIIDIKDNDGKVVHVK  3832

Query  4113  EISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYY  4172
             E++  N+ +L+WPL++   R    VKLQNNE+ P  L+Q S  A             A Y
Sbjct  3833  EVTAQNAESLSWPLVLGCER---IVKLQNNEIIPGKLKQRSIKAEGDGIV---GEGKALY  3886

Query  4173  NTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIK  4232
             N   G  F+ A +SD  DL+  ++    G  TI  ELEPP +F+ D+P G ++KYLYF++
Sbjct  3887  NNEGGRTFMYAFISDKPDLRVVKWEFDGGCNTI--ELEPPRKFLVDSPNGAQIKYLYFVR  3944

Query  4233  GLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPIT  4292
              LN L RG VLG + ATVRLQAG  TE   NS++L+ CAFAVD AK Y D + SG +P+ 
Sbjct  3945  NLNTLRRGAVLGYIGATVRLQAGKQTEQAINSSLLTLCAFAVDPAKTYIDAVKSGHKPVG  4004

Query  4293  NCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI  4352
             NCVKML   +G GQA+T   EA+ +Q+S+GGAS CLYCR H++HP+  GFC LKGKYVQ+
Sbjct  4005  NCVKMLANGSGNGQAVTNGVEASTNQDSYGGASVCLYCRAHVEHPSMDGFCRLKGKYVQV  4064

Query  4353  PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFA  4404
             P     DP+ F L+N VC VCG W   GC+CD+    ++QS D  ++LN + 
Sbjct  4065  PLGTV-DPIRFVLENDVCKVCGCWLSNGCTCDR---SIMQSTD-MAYLNEYG  4111


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 74/165 (45%), Gaps = 10/165 (6%)

Query  993   GSEDNQTTTIQTIVEVQPQLEMELTPVVQTIE---VNSFSGYLKLTDNVYIKNADIVEEA  1049
             G    +  T+ TI          L P V ++    V  F  Y     NV     D   + 
Sbjct  1255  GRHQIKYDTLNTICVKDVNWTAPLVPAVDSVVEPVVKPFYSY----KNVDFYQGDF-SDL  1309

Query  1050  KKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHN  1109
              K+    VVNAAN  L HGGG+A A++  T   +Q  S+DYI  +GP+KVG   +L    
Sbjct  1310  VKLPCDFVVNAANEKLSHGGGIAKAIDVYTKGMLQKCSNDYIKAHGPIKVGRGVMLEA--  1367

Query  1110  LAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIF  1154
             L     +VVGP   K     L+K+    F    V L PL+S GIF
Sbjct  1368  LGLKVFNVVGPRKGKHAPELLVKAYKSVFANSGVALTPLISVGIF  1412


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 85/344 (25%), Positives = 138/344 (40%), Gaps = 38/344 (11%)

Query  1548  GEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKI  1607
             G V T D+++   + + V  IKV  T D  ++    V+ + TYGQQ GP  ++   VT  
Sbjct  1616  GFVSTPDDVERFYANKSV-VIKV--TEDTRSVKAVKVESTATYGQQIGPCLVNDTVVTDN  1672

Query  1608  KPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQ--VNGLT  1665
             KP  +       V+PN +      ++ ++  D +  G +   L+HT  + +P   VNG  
Sbjct  1673  KPVVADVVAK--VVPNAN------WDSHYGFDKA--GEF-HMLDHTG-FTFPSEVVNGRR  1720

Query  1666  SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGEL  1725
              IK  DNNC++    L LQ    +F    LQ  +     G+ A F   +        G+ 
Sbjct  1721  VIKTTDNNCWVNVTCLQLQFARFRFKSAGLQAMWESYCTGDVAMFVHWLYWLTGVDKGQP  1780

Query  1726  GDVRETMSYLFQH---ANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKG  1782
              D    ++ L ++   A   + +RV +  C  C ++  T   V A +          K G
Sbjct  1781  SDSENALNMLSKYIVPAGSVTIERVTHDGC-CCSKRVVTAPVVNASV---------LKLG  1830

Query  1783  VQ---IPCTCGKQATKYLVQQESPFVMMSAP---PAQYELKHGTFTCASEYTGNYQCGHY  1836
             V+    P          +V+  +  V +  P   P+   LK  ++T   +  GN   GHY
Sbjct  1831  VEDGLCPHGLNYIGKVVVVKGTTIVVNVGKPVVAPSHLFLKGVSYTTFLD-NGNGVVGHY  1889

Query  1837  KHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPV  1880
               +    T    DG           P+T+V   E +      PV
Sbjct  1890  T-VFDHGTGMVHDGDAFVPGDLNVSPVTNVVVSEQTAVVIKDPV  1932


> sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1
Length=6781

 Score = 1187 bits (3070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 757/2209 (34%), Positives = 1173/2209 (53%), Gaps = 157/2209 (7%)

Query  2230  IIWFLLLS-VCLG-SLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIP  2287
             + WF +L    LG   +Y+   + +  + +G P  C     GY NS+      YC  S+ 
Sbjct  2020  LYWFKVLGKFSLGIYALYALLFMTIRFTPIGSP-VCDDVVAGYANSS-FDKNEYCN-SVI  2076

Query  2288  CSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIM  2347
             C VCL G   L  +   + +        W      L+            FFY+  LA   
Sbjct  2077  CKVCLYGYQELSDFSHTQVV--------WQHLRDPLIGN-------VMPFFYLAFLAIFG  2121

Query  2348  QLFFSYFAVHFIS---NSWLMWL----IINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
              ++     ++FI    NS  ++L     I  +Q+ P        + F     V     HV
Sbjct  2122  GVYVKAITLYFIFQYLNSLGVFLGLQQSIWFLQLVPFDVFGDEIVVFFIVTRVLMFIKHV  2181

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
               GC+ ++C+ C K  R  RV   TI  G  +SFYV+ANGG  FCK HN+ C+NCD++  
Sbjct  2182  CLGCDKASCVACSKSARLKRVPVQTIFQGTSKSFYVHANGGSKFCKKHNFFCLNCDSYGP  2241

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             G TFI+D +A ++    K  + PT  ++ ++D V   NG  +LY      K     + S 
Sbjct  2242  GCTFINDVIATEVGNVVKLNVQPTGPATILIDKVEFSNGFYYLYSGDTFWKYNFDITDSK  2301

Query  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580
             +   + L+      S+  + IVF+       +  K+A VY+SQ++C+P+ L+D AL++ +
Sbjct  2302  YTCKEALK----NCSIITDFIVFNNNGS-NVNQVKNACVYFSQMLCKPVKLVDSALLASL  2356

Query  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNV-LSTFISAARQ  2639
               S +    +  A+V+  S++F   +     +      +    +  D+V L TF +A  +
Sbjct  2357  --SVDFGASLHSAFVSVLSNSFGKDLSSCNDM-----QDCKSTLGFDDVPLDTFNAAVAE  2409

Query  2640  GFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTP-RDLGACIDCSARH  2698
                               +H+ D+ +T  S NN+  +Y K E   P  D+  C+   A+ 
Sbjct  2410  ------------------AHRYDVLLTDMSFNNFTTSYAKPEEKFPVHDIATCMRVGAKI  2451

Query  2699  INAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKI  2758
             +N  V    +I ++W V+DF++LSE+ RK I    K   + F LT    R    + T  I
Sbjct  2452  VNHNVLVKDSIPVVWLVRDFIALSEETRKYIIRTTKVKGITFMLTFNDCRMHTTIPTVCI  2511

Query  2759  ALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEI-----IGYKAID  2813
             A K G  + ++ K       + LF+ A F+ ++         DFS+++       +K I+
Sbjct  2512  ANKKGAGLPSFSKVKKFFWFLCLFIVAAFFALS-------FLDFSTQVSSDSDYDFKYIE  2564

Query  2814  GGVTRDIASTDTCFANKHADFDTWFSQRGG-SYTNDKACPLIAAVITREVGFVVPGLPGT  2872
              G  +   +  +C  N   +FD W   + G +  N+ +CP++  V   +    VPG+P  
Sbjct  2565  SGQLKTFDNPLSCVHNVFINFDQWHDAKFGFTPVNNPSCPIVVGV--SDEARTVPGIPAG  2622

Query  2873  ILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPY  2932
             +     G  L F          +C+  S + +       AC+  + CT      G  V Y
Sbjct  2623  VYLA--GKTLVFAINTIFGTSGLCFDASGVAD-----KGACIFNSACTTLSGLGGTAV-Y  2674

Query  2933  CYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVRVVTTFDSEYCRHGTCER  2991
             CY   ++EG+  Y  L P + Y ++DG+ +  P     G  +R + T    YCR G C +
Sbjct  2675  CYKNGLVEGAKLYSELAPHSYYKMVDGNAVSLPEIISRGFGIRTIRTKAMTYCRVGQCVQ  2734

Query  2992  SEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGG  3051
             S  GVC      +V N +   S     CG     LL N+ +   + +    +S  I+   
Sbjct  2735  SAEGVCFGADRFFVYNAE---SGSDFVCGTGLFTLLMNVISVFSKTVPVTVLSGQILFNC  2791

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYS---HVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVI  3108
             I+A V   + + F +F+R FG+ S     V   TLL  +S+ V   T        +  + 
Sbjct  2792  IIAFVAVAVCFLFTKFKRMFGDMSVGVFTVGACTLLNNVSYIVTQNT--------LGMLG  2843

Query  3109  YLYLTFYLTNDVSFLA--HIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRV-  3165
             Y  L F  T  V ++   H+ +++ +  + P+W+ + Y    +    + F  N  K +V 
Sbjct  2844  YATLYFLCTKGVRYMWIWHLGFLISYILIAPWWVLMVY----AFSAIFEFMPNLFKLKVS  2899

Query  3166  --VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMD  3222
               +F G  F  +FE AA  TF+L+   Y +L + +     +  +Y + YNKYKY+SG+  
Sbjct  2900  TQLFEGDKFVGSFENAAAGTFVLDMHAYERLANSI--STEKLRQYASTYNKYKYYSGSAS  2957

Query  3223  TTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQ  3282
                YR A   HLAKA+ D++++ +D LY PP  S  S  LQ+G RKMA PSG VE C+V+
Sbjct  2958  EADYRLACFAHLAKAMMDYASNHNDTLYTPPTVSYNST-LQAGLRKMAQPSGVVEKCIVR  3016

Query  3283  VTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVI  3341
             V  G   LNGLWL D+V CPRHVI +S    ++ +Y   ++R   HNF + +GNV L V+
Sbjct  3017  VCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVV  3074

Query  3342  GHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKG  3401
               +M+  +L++KV+  N  TPKY +  ++PG++F++LACY+G+ +GVY   MR N+TI+G
Sbjct  3075  SATMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRG  3134

Query  3402  SFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDT  3461
             SF+NG+CGS G+NI+   V FCY+H +EL +G H G+DL+G  YG + D+ T Q  G  +
Sbjct  3135  SFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASS  3194

Query  3462  TITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTG  3521
               T NVLA+LYAA+ING  W+L+     ++ FN  A+       T  + D    L+A+TG
Sbjct  3195  LFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT--TVGNTDCFSILAAKTG  3252

Query  3522  IAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSA-VKRTIKGTH  3580
             + V  + AS++ L +N   G+ ILG   L DEFT  +VVRQ  GV  Q   V R  +   
Sbjct  3253  VDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQMYGVNLQGGYVSRACRN--  3309

Query  3581  HWLLLTILTSLLVLVQS--TQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCL  3638
                 + ++ S L    S    ++ FF++      P    +  +S+  M  +KHK  F  +
Sbjct  3310  ----VLLVGSFLTFFWSELVSYTKFFWVNPGYVTPMFACLSLLSSLLMFTLKHKTLFFQV  3365

Query  3639  FLLPSLATVAYFNMVYMPASWVMRIMTWL-DMVD--TSLSGFKLKDCVMYASAVVLLILM  3695
             FL+P+L   +  N+ +      + +  +L +  D   SL GF  +  V      V+ IL 
Sbjct  3366  FLIPALIVTSCINLAFD-----VEVYNYLAEHFDYHVSLMGFNAQGLVNIFVCFVVTILH  3420

Query  3696  TART--VYDDGARRVWTLMNVLTLVYKVYYG-NALDQAISMWALIISVTSNYSGVVTTVM  3752
                T   ++  A  V  ++ +LT  Y  +Y  + L  A++++A   SVT N+   V  V 
Sbjct  3421  GTYTWRFFNTPASSVTYVVALLTAAYNYFYASDILSCAMTLFA---SVTGNW--FVGAVC  3475

Query  3753  FLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYD  3812
             +  +  V+M + + P F      ++ +M  Y  LGYF  C++G+    NR+F++++GVYD
Sbjct  3476  Y--KVAVYMALRF-PTFVAIFGDIKSVMFCYLVLGYFTCCFYGILYWFNRFFKVSVGVYD  3532

Query  3813  YLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL  3872
             Y VS  EF+YM + GL  P  ++D+  L+ KL+G+GG+  IK+++VQSK++D+KC++VVL
Sbjct  3533  YTVSAAEFKYMVANGLRAPTGTLDSLLLSAKLIGIGGERNIKISSVQSKLTDIKCSNVVL  3592

Query  3873  LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCE  3932
             L  L  + V ++S  WA CV LHN I L  D  +A E +++LL+  LS   A  ++ L E
Sbjct  3593  LGCLSSMNVSANSTEWAYCVDLHNKINLCNDPEKAQEMLLALLAFFLSKNSAFGLDDLLE  3652

Query  3933  EMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFD  3992
                ++ + LQ++AS +  LPSY  +  A++ YE AV NG    ++K+L+ ++NVAKSEFD
Sbjct  3653  SYFNDNSMLQSVASTYVGLPSYVIYENARQQYEDAVNNGSPPQLVKQLRHAMNVAKSEFD  3712

Query  3993  RDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNA  4052
             R+A+ QRKL++MA+QA  QMYK+AR+ ++++KV SAM ++LF MLR+LD  +++ I+N A
Sbjct  3713  REASTQRKLDRMAEQAAAQMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMSSVDTILNLA  3772

Query  4053  RDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLS  4112
             +DG VPL++IP  +A KL +V  D ++Y          YA  +W I  + D D K+V + 
Sbjct  3773  KDGVVPLSVIPAVSATKLNIVTSDIDSYNRIQREGCVHYAGTIWNIIDIKDNDGKVVHVK  3832

Query  4113  EISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYY  4172
             E++  N+ +L+WPL++   R    VKLQNNE+ P  L+Q S  A             A Y
Sbjct  3833  EVTAQNAESLSWPLVLGCER---IVKLQNNEIIPGKLKQRSIKAEGDGIV---GEGKALY  3886

Query  4173  NTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIK  4232
             N   G  F+ A +SD  DL+  ++    G  TI  ELEPP +F+ D+P G ++KYLYF++
Sbjct  3887  NNEGGRTFMYAFISDKPDLRVVKWEFDGGCNTI--ELEPPRKFLVDSPNGAQIKYLYFVR  3944

Query  4233  GLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPIT  4292
              LN L RG VLG + ATVRLQAG  TE   NS++L+ CAFAVD AK Y D + SG +P+ 
Sbjct  3945  NLNTLRRGAVLGYIGATVRLQAGKQTEQAINSSLLTLCAFAVDPAKTYIDAVKSGHKPVG  4004

Query  4293  NCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI  4352
             NCVKML   +G GQA+T   EA+ +Q+S+GGAS CLYCR H++HP+  GFC LKGKYVQ+
Sbjct  4005  NCVKMLANGSGNGQAVTNGVEASTNQDSYGGASVCLYCRAHVEHPSMDGFCRLKGKYVQV  4064

Query  4353  PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             P     DP+ F L+N VC VCG W   GC+CD+    ++QS D  ++LN
Sbjct  4065  PLGTV-DPIRFVLENDVCKVCGCWLSNGCTCDR---SIMQSTD-MAYLN  4108


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 74/165 (45%), Gaps = 10/165 (6%)

Query  993   GSEDNQTTTIQTIVEVQPQLEMELTPVVQTIE---VNSFSGYLKLTDNVYIKNADIVEEA  1049
             G    +  T+ TI          L P V ++    V  F  Y     NV     D   + 
Sbjct  1255  GRHQIKYDTLNTICVKDVNWTAPLVPAVDSVVEPVVKPFYSY----KNVDFYQGDF-SDL  1309

Query  1050  KKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHN  1109
              K+    VVNAAN  L HGGG+A A++  T   +Q  S+DYI  +GP+KVG   +L    
Sbjct  1310  VKLPCDFVVNAANEKLSHGGGIAKAIDVYTKGMLQKCSNDYIKAHGPIKVGRGVMLEA--  1367

Query  1110  LAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIF  1154
             L     +VVGP   K     L+K+    F    V L PL+S GIF
Sbjct  1368  LGLKVFNVVGPRKGKHAPELLVKAYKSVFANSGVALTPLISVGIF  1412


 Score = 48.9 bits (115),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 85/344 (25%), Positives = 138/344 (40%), Gaps = 38/344 (11%)

Query  1548  GEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKI  1607
             G V T D+++   + + V  IKV  T D  ++    V+ + TYGQQ GP  ++   VT  
Sbjct  1616  GFVSTPDDVERFYANKSV-VIKV--TEDTRSVKAVKVESTATYGQQIGPCLVNDTVVTDN  1672

Query  1608  KPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQ--VNGLT  1665
             KP  +       V+PN +      ++ ++  D +  G +   L+HT  + +P   VNG  
Sbjct  1673  KPVVADVVAK--VVPNAN------WDSHYGFDKA--GEF-HMLDHTG-FTFPSEVVNGRR  1720

Query  1666  SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGEL  1725
              IK  DNNC++    L LQ    +F    LQ  +     G+ A F   +        G+ 
Sbjct  1721  VIKTTDNNCWVNVTCLQLQFARFRFKSAGLQAMWESYCTGDVAMFVHWLYWLTGVDKGQP  1780

Query  1726  GDVRETMSYLFQH---ANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKG  1782
              D    ++ L ++   A   + +RV +  C  C ++  T   V A +          K G
Sbjct  1781  SDSENALNMLSKYIVPAGSVTIERVTHDGC-CCSKRVVTAPVVNASV---------LKLG  1830

Query  1783  VQ---IPCTCGKQATKYLVQQESPFVMMSAP---PAQYELKHGTFTCASEYTGNYQCGHY  1836
             V+    P          +V+  +  V +  P   P+   LK  ++T   +  GN   GHY
Sbjct  1831  VEDGLCPHGLNYIGKVVVVKGTTIVVNVGKPVVAPSHLFLKGVSYTTFLD-NGNGVVGHY  1889

Query  1837  KHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPV  1880
               +    T    DG           P+T+V   E +      PV
Sbjct  1890  T-VFDHGTGMVHDGDAFVPGDLNVSPVTNVVVSEQTAVVIKDPV  1932


> sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 
229E OX=11137 GN=rep PE=1 SV=1
Length=6758

 Score = 1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/2279 (34%), Positives = 1201/2279 (53%), Gaps = 187/2279 (8%)

Query  2172  FFTLLLQLCTFTRST----NSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLI  2227
             FFT LL + T  ++     + +I A  P        +S+ K+ L+AS   LKS       
Sbjct  1936  FFTWLLSMFTLCKTAVTTGDVKIMAKAPQRTGVVLKRSL-KYNLKASAAVLKSK------  1988

Query  2228  NIIIWFLLLSVC-LGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSI  2286
                 W+LL     L  LIY+  ++ +L    G  ++C+    GY  S N     YC GS+
Sbjct  1989  ----WWLLAKFTKLLLLIYTLYSVVLLCVRFGPFNFCSETVNGYAKS-NFVKDDYCDGSL  2043

Query  2287  PCSVCLSGLDSLDTYPSLETI--QITISSFKWDLTAFGLVAEWFL---AYILFTRFFYVL  2341
              C +CL G   L  +  L+ +   IT   F  ++  F ++    +    Y+     ++V 
Sbjct  2044  GCKMCLFGYQELSQFSHLDVVWKHITDPLFS-NMQPFIVMVLLLIFGDNYLRCFLLYFVA  2102

Query  2342  GLAAIMQLFFSY----FAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY  2397
              + + + +F  Y    + +HFI    +   ++  V +  + + VR               
Sbjct  2103  QMISTVGVFLGYKETNWFLHFIPFDVICDELLVTVIVIKVISFVR---------------  2147

Query  2398  VHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDT  2457
              HV+ GC +  C+ C K  R  R    TIVNGV+RSFYV ANGG  FCK H + CV+CD+
Sbjct  2148  -HVLFGCENPDCIACSKSARLKRFPVNTIVNGVQRSFYVNANGGSKFCKKHRFFCVDCDS  2206

Query  2458  FCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLY---------FDKA  2508
             +  GSTFI+ EV+R+L    K  + PT  +  ++D V  +NG   LY         FD  
Sbjct  2207  YGYGSTFITPEVSRELGNITKTNVQPTGPAYVMIDKVEFENGFYRLYSCETFWRYNFDIT  2266

Query  2509  GQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQP  2568
               K   +    +   LD+    N  G+   NV           +  K+ASVY+SQL+C+P
Sbjct  2267  ESKYSCKEVFKNCNVLDDFIVFNNNGT---NV-----------TQVKNASVYFSQLLCRP  2312

Query  2569  ILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSL-D  2627
             I L+D  L+S +  S +    +  AY++   ++F    + L   ++ AE + A  +S+ D
Sbjct  2313  IKLVDSELLSTL--SVDFNGVLHKAYIDVLRNSFG---KDLNANMSLAECKRALGLSISD  2367

Query  2628  NVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVE-NMTPR  2686
             +  ++ IS A                     H+ D+ ++  S NN++ +Y K E  ++  
Sbjct  2368  HEFTSAISNA---------------------HRCDVLLSDLSFNNFVSSYAKPEEKLSAY  2406

Query  2687  DLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCAT  2746
             DL  C+   A+ +NA V       ++W+ KDF SLS + RK I   +K   L F LT   
Sbjct  2407  DLACCMRAGAKVVNANVLTKDQTPIVWHAKDFNSLSAEGRKYIVKTSKAKGLTFLLTINE  2466

Query  2747  TRQVVNVVTTKIALKGGKIVNN----WLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDF  2802
              + V  +  T I  K G         WL  L  +  +  F    F       ++S     
Sbjct  2467  NQAVTQIPATSIVAKQGAGDAGHSLTWLWLLCGLVCLIQFYLCFFMPYFMYDIVS-----  2521

Query  2803  SSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTW-FSQRGGSYTNDKACPLIAAVITRE  2861
             S E   +K I+ G  ++  +   C  N   +F+ W +++ G +  N ++CP++  V   E
Sbjct  2522  SFEGYDFKYIENGQLKNFEAPLKCVRNVFENFEDWHYAKFGFTPLNKQSCPIVVGV--SE  2579

Query  2862  VGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICY------TPSKLIEYTDFATSACVL  2915
             +   V G+P  +     G  L F  +       +CY      TP K           C+ 
Sbjct  2580  IVNTVAGIPSNVYLV--GKTLIFTLQAAFGNAGVCYDIFGVTTPEK-----------CIF  2626

Query  2916  AAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVR  2974
              + CT  +   G  V YCY+T ++EGS+ Y S++ +  Y   +G+ I+ P    +G   R
Sbjct  2627  TSACTRLEGLGGNNV-YCYNTALMEGSLPYSSIQANAYYKYDNGNFIKLPEVIAQGFGFR  2685

Query  2975  VVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPL  3034
              V T  ++YCR G C  S AGVC     +W +N+   R   G  CG    NL+ N+ +  
Sbjct  2686  TVRTIATKYCRVGECVESNAGVCFGFD-KWFVNDG--RVANGYVCGTGLWNLVFNILSMF  2742

Query  3035  IQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCL  3094
                     +S  I+    +        +   +FRR FG+ S  V    +  L++     +
Sbjct  2743  SSSFSVAAMSGQILLNCALGAFAIFCCFLVTKFRRMFGDLSVGVCTVVVAVLLNNVSYIV  2802

Query  3095  TPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFY  3154
             T     +   Y+++Y + T  L    +++    +++ +    P+W+   Y + + T    
Sbjct  2803  TQNLVTMIA-YAILYFFATRSLR--YAWIWCAAYLIAYISFAPWWLCAWYFLAMLTG---  2856

Query  3155  WFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLAL  3210
                 + LK +V   +F G  F  TFE AA  TF+++   Y KL + +     +   Y A 
Sbjct  2857  -LLPSLLKLKVSTNLFEGDKFVGTFESAAAGTFVIDMRSYEKLANSI--SPEKLKSYAAS  2913

Query  3211  YNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMA  3270
             YN+YKY+SG  +   YR A   +LAKA+ DFS   +D+LY PP  S  S  LQ+G RKMA
Sbjct  2914  YNRYKYYSGNANEADYRCACYAYLAKAMLDFSRDHNDILYTPPTVSYGST-LQAGLRKMA  2972

Query  3271  FPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNF  3329
              PSG VE C+V+V  G T LNGLWL D+VYCPRHVI + +   ++ ++E  ++R   HNF
Sbjct  2973  QPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNF  3030

Query  3330  LVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVY  3389
              + +G   L V+G +M    LK+KV   N  TP++ F  ++ G+ F++LACY+G   GV+
Sbjct  3031  SIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYDGCAQGVF  3090

Query  3390  QCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFV  3449
                MR N+TI+GSF+NG+CGS G+N+    V F YMH +EL +G H G+  +G  YG F 
Sbjct  3091  GVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFE  3150

Query  3450  DRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH  3509
             D+   Q    +  +TVNV+A+LYAA++NG  W+L      +  +N  A    +  +  + 
Sbjct  3151  DQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE-  3209

Query  3510  VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ  3569
              D    L+A+TG+ V  +  ++ ++L NG  G+ ILG + L DEF+  +VV+Q  GV  Q
Sbjct  3210  -DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQMFGVNLQ  3267

Query  3570  SAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYEN-AFL-PFAMGIIAMSAFAMM  3627
             S      K T  +  +++     V+  +  +     ++ N  FL PF + ++A+S     
Sbjct  3268  SG-----KTTSMFKSISLFAGFFVMFWAELFVYTTTIWVNPGFLTPFMILLVALSLCLTF  3322

Query  3628  FVKHKHAFLCLFLLPSLATVAYFNMVYMPASW---VMRIMTWLDMVDTSLSGFKLKDCVM  3684
              VKHK  FL +FLLPS+   A  N      +W   V +++      + S+    ++  V 
Sbjct  3323  VVKHKVLFLQVFLLPSIIVAAIQN-----CAWDYHVTKVLAEKFDYNVSVMQMDIQGFVN  3377

Query  3685  YASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                 + + +L T R   +        L +++ ++Y   Y       +S+  +++   SN 
Sbjct  3378  IFICLFVALLHTWRFAKERCTHWCTYLFSLIAVLYTALYSY---DYVSLLVMLLCAISNE  3434

Query  3745  SGVVTTVMFLAR-GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
               +   +  + R G+ F+ VEY   F    + ++ ++L Y  LG+    Y+GL   +NR+
Sbjct  3435  WYIGAIIFRICRFGVAFLPVEYVSYF----DGVKTVLLFYMLLGFVSCMYYGLLYWINRF  3490

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
              + TLGVYD+ VS  EF+YM + GL  P    DA  L+ KL+G+GG   IKV+TVQSK++
Sbjct  3491  CKCTLGVYDFCVSPAEFKYMVANGLNAPNGPFDALFLSFKLMGIGGPRTIKVSTVQSKLT  3550

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             D+KCT+VVL+ +L  + + S+SK WA CV++HN I L  D   A E +++LL+  LS   
Sbjct  3551  DLKCTNVVLMGILSNMNIASNSKEWAYCVEMHNKINLCDDPETAQELLLALLAFFLSKHS  3610

Query  3924  AVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKS  3983
                +  L +   +N + LQ++AS F  +PS+ A+ TA++ YE AVANG S  ++K+LKK+
Sbjct  3611  DFGLGDLVDSYFENDSILQSVASSFVGMPSFVAYETARQEYENAVANGSSPQIIKQLKKA  3670

Query  3984  LNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND  4043
             +NVAK+EFDR++++Q+K+ +MA+QA   MYK+AR+ ++++KV SAM ++LF MLR+LD  
Sbjct  3671  MNVAKAEFDRESSVQKKINRMAEQAAAAMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMS  3730

Query  4044  ALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY-KNTCDGTTFTYASALWEIQQVV  4102
             +++ I+N AR+G VPL++IP T+AA+L+VV+PD++++ K   DG    YA  +W +Q+V 
Sbjct  3731  SVDTILNMARNGVVPLSVIPATSAARLVVVVPDHDSFVKMMVDGFVH-YAGVVWTLQEVK  3789

Query  4103  DADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA  4162
             D D K V L +++ +N   L WPLI+T  R    VKLQNNE+ P  ++  +         
Sbjct  3790  DNDGKNVHLKDVTKENQEILVWPLILTCER---VVKLQNNEIMPGKMKVKATKGEGDGGI  3846

Query  4163  CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKG  4222
              ++ NAL  YN   G  F+ A ++    +K+ ++    G  T+  ELEPPCRFV DTP G
Sbjct  3847  TSEGNAL--YNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTV--ELEPPCRFVIDTPTG  3902

Query  4223  PKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKD  4282
             P++KYLYF+K LNNL RG VLG + ATVRLQAG  TE  +NS +L+ C+FAVD A AY D
Sbjct  3903  PQIKYLYFVKNLNNLRRGAVLGYIGATVRLQAGKQTEFVSNSHLLTHCSFAVDPAAAYLD  3962

Query  4283  YLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGF  4342
              +  G +P+ NCVKML   +G+GQAIT T ++N  Q+++GGAS C+YCR H+ HP   GF
Sbjct  3963  AVKQGAKPVGNCVKMLTNGSGSGQAITCTIDSNTTQDTYGGASVCIYCRAHVAHPTMDGF  4022

Query  4343  CDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             C  KGK+VQ+P    NDP+ F L+NTVC VCG W  +GC+CD+     +QS D  S+LN
Sbjct  4023  CQYKGKWVQVPIG-TNDPIRFCLENTVCKVCGCWLNHGCTCDR---TAIQSFD-NSYLN  4076


 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 110/245 (45%), Gaps = 16/245 (7%)

Query  991   QDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYL---KLT-----DNVYIKN  1042
             Q  + D   T      +   ++E+ +TP+  T++      ++   KL      DNV    
Sbjct  1226  QPWTNDALNTICIKDADYNAKVEISVTPIKNTVDTTPKEEFVVKEKLNAFLVHDNVAFYQ  1285

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
              D+      V    +VNAAN  L HGGG+A AL+  T   +Q  S ++I   G +KVG  
Sbjct  1286  GDVDTVVNGVDFDFIVNAANENLAHGGGLAKALDVYTKGKLQRLSKEHIGLAGKVKVGTG  1345

Query  1103  CVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSL  1162
              ++   +L     +VVGP   K E   L+K+     N+    L P+LS GIFG     SL
Sbjct  1346  VMVECDSL--RIFNVVGPRKGKHERDLLIKAYNTINNEQGTPLTPILSCGIFGIKLETSL  1403

Query  1163  RVCVDTVRTN-VYLAVFDKNLYDKL---VSSFLEMKSEKQ--VEQKIAEIPKEEVKPFIT  1216
              V +D   T  V + V+      K+   VS  + ++  +Q  +E K   + K   KP+  
Sbjct  1404  EVLLDVCNTKEVKVFVYTDTEVCKVKDFVSGLVNVQKVEQPKIEPKPVSVIKVAPKPYRV  1463

Query  1217  ESKPS  1221
             + K S
Sbjct  1464  DGKFS  1468


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 74/339 (22%), Positives = 137/339 (40%), Gaps = 30/339 (9%)

Query  1560  LSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFY  1619
             L   E + I +  T D +N+H   V    ++ QQ G       D++   P + +  +   
Sbjct  1595  LKAAEAKVITIKVTEDGVNVHDVTVTTDKSFEQQVGVIADKDKDLSGAVPSDLNTSELL-  1653

Query  1620  VLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTK-KWKYPQVNGLTSIKWADNNCYLAT  1678
                    + V+  E+Y   D        + ++H+   ++   VNG+  +K +DNNC++  
Sbjct  1654  ----TKAIDVDWVEFYGFKD----AVTFATVDHSAFAYESAVVNGIRVLKTSDNNCWVNA  1705

Query  1679  ALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH  1738
               + LQ  +  F    L  A+ +   G+   F A +        G+ GD  +T++ L ++
Sbjct  1706  VCIALQYSKPHFISQGLDAAWNKFVLGDVEIFVAFVYYVARLMKGDKGDAEDTLTKLSKY  1765

Query  1739  -ANLDSCKRVLNVVCKTCGQQ-QTTLKGVEAVMYMGTLSYEQFKKGVQIP-CTCGKQATK  1795
              AN    +      C  C  + + ++  + + +   ++     + GVQ+  C  G +   
Sbjct  1766  LANEAQVQLEHYSSCVECDAKFKNSVASINSAIVCASVK----RDGVQVGYCVHGIKYYS  1821

Query  1796  YLVQQESPFVMMSA----PPAQYELKHGTFTCASEYTGNYQCGHYK-HITSKETLYCIDG  1850
              +       +++S     P AQ  L  G    A  ++G    GHY  + T+K+++Y  DG
Sbjct  1822  RVRSVRGRAIIVSVEQLEPCAQSRLLSGVAYTA--FSGPVDKGHYTVYDTAKKSMY--DG  1877

Query  1851  ALLTKSSEYKGPITDVF----YKENSYTTTIKPVTYKLD  1885
                 K       +T V     Y     T   KPV  +LD
Sbjct  1878  DRFVKHDLSLLSVTSVVMVGGYVAPVNTVKPKPVINQLD  1916


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 110/267 (41%), Gaps = 18/267 (7%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             + ++NGL  +K  DNNC++ + +L +Q   +     A+Q  +   R  +    C      
Sbjct  1038  FEELNGLKILKQLDNNCWVNSVMLQIQLTGILDGDYAMQ-FFKMGRVAKMIERC-YTAEQ  1095

Query  1718  CNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYE  1777
             C +  G +GDV   M  L +  +L +   V++  C +C   +    G  AV++  T + +
Sbjct  1096  CIR--GAMGDVGLCMYRLLK--DLHTGFMVMDYKC-SCTSGRLEESG--AVLFC-TPTKK  1147

Query  1778  QFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYK  1837
              F  G  + C   +  T   +Q    FV     P           C+S + G   CGHY+
Sbjct  1148  AFPYGTCLNCNAPRMCTIRQLQGTIIFVQQKPEPVNPVSFVVKPVCSSIFRGAVSCGHYQ  1207

Query  1838  HITSKETLYCIDGALLTKSSEY-KGPITDVFYKENSYTT----TIKPVTYKLDGVVCTE-  1891
                  + L C+DG  + K   +    +  +  K+  Y      ++ P+   +D     E 
Sbjct  1208  TNIYSQNL-CVDGFGVNKIQPWTNDALNTICIKDADYNAKVEISVTPIKNTVDTTPKEEF  1266

Query  1892  -IDPKLDNYYKKDNSYFTEQPIDLVPN  1917
              +  KL+ +   DN  F +  +D V N
Sbjct  1267  VVKEKLNAFLVHDNVAFYQGDVDTVVN  1293


 Score = 38.5 bits (88),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 61/267 (23%), Positives = 106/267 (40%), Gaps = 27/267 (10%)

Query  662  GQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCV  721
            G + TCAK  K  +    +  N FL     ++ IGG   K     + ++     + +   
Sbjct  749  GLLGTCAKRFKRWLGILLEAYNAFLDTVVSTVKIGGLTFKTYAFDKPYIVIRDIVCKVEN  808

Query  722  KSREETGLLMPLKAP-KEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
            K+  E   L P     K     E   +P    T        D++ +E   +E VE    G
Sbjct  809  KTEAEWIELFPHNDRIKSFSTFESAYMPIADPTHF------DIEEVELLDAEFVEPGCGG  862

Query  781  TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDT-VIEVQGYKSV  839
                I+  +  + KD   Y +   N++     FT   G   KV+F DD  V +++    V
Sbjct  863  ILAVIDEHVFYK-KDGVYYPSNGTNILPV--AFTKAAGG--KVSFSDDVEVKDIEPVYRV  917

Query  840  NITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDE  899
             + FE +   D+ L + C      +G ++        D+  KT+Q    +++        
Sbjct  918  KLCFEFE---DEKLVDVCEK---AIGKKIKHEG--DWDSFCKTIQSALSVVSCY------  963

Query  900  WSMATYYLFDESGEFKLASHMYCSFYP  926
             ++ TYY++DE G   L+  +  S +P
Sbjct  964  VNLPTYYIYDEEGGNDLSLPVMISEWP  990


> sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavirus 
229E OX=11137 GN=1a PE=1 SV=1
Length=4085

 Score = 1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/2279 (34%), Positives = 1201/2279 (53%), Gaps = 187/2279 (8%)

Query  2172  FFTLLLQLCTFTRST----NSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLI  2227
             FFT LL + T  ++     + +I A  P        +S+ K+ L+AS   LKS       
Sbjct  1936  FFTWLLSMFTLCKTAVTTGDVKIMAKAPQRTGVVLKRSL-KYNLKASAAVLKSK------  1988

Query  2228  NIIIWFLLLSVC-LGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSI  2286
                 W+LL     L  LIY+  ++ +L    G  ++C+    GY  S N     YC GS+
Sbjct  1989  ----WWLLAKFTKLLLLIYTLYSVVLLCVRFGPFNFCSETVNGYAKS-NFVKDDYCDGSL  2043

Query  2287  PCSVCLSGLDSLDTYPSLETI--QITISSFKWDLTAFGLVAEWFL---AYILFTRFFYVL  2341
              C +CL G   L  +  L+ +   IT   F  ++  F ++    +    Y+     ++V 
Sbjct  2044  GCKMCLFGYQELSQFSHLDVVWKHITDPLFS-NMQPFIVMVLLLIFGDNYLRCFLLYFVA  2102

Query  2342  GLAAIMQLFFSY----FAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY  2397
              + + + +F  Y    + +HFI    +   ++  V +  + + VR               
Sbjct  2103  QMISTVGVFLGYKETNWFLHFIPFDVICDELLVTVIVIKVISFVR---------------  2147

Query  2398  VHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDT  2457
              HV+ GC +  C+ C K  R  R    TIVNGV+RSFYV ANGG  FCK H + CV+CD+
Sbjct  2148  -HVLFGCENPDCIACSKSARLKRFPVNTIVNGVQRSFYVNANGGSKFCKKHRFFCVDCDS  2206

Query  2458  FCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLY---------FDKA  2508
             +  GSTFI+ EV+R+L    K  + PT  +  ++D V  +NG   LY         FD  
Sbjct  2207  YGYGSTFITPEVSRELGNITKTNVQPTGPAYVMIDKVEFENGFYRLYSCETFWRYNFDIT  2266

Query  2509  GQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQP  2568
               K   +    +   LD+    N  G+   NV           +  K+ASVY+SQL+C+P
Sbjct  2267  ESKYSCKEVFKNCNVLDDFIVFNNNGT---NV-----------TQVKNASVYFSQLLCRP  2312

Query  2569  ILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSL-D  2627
             I L+D  L+S +  S +    +  AY++   ++F    + L   ++ AE + A  +S+ D
Sbjct  2313  IKLVDSELLSTL--SVDFNGVLHKAYIDVLRNSFG---KDLNANMSLAECKRALGLSISD  2367

Query  2628  NVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVE-NMTPR  2686
             +  ++ IS A                     H+ D+ ++  S NN++ +Y K E  ++  
Sbjct  2368  HEFTSAISNA---------------------HRCDVLLSDLSFNNFVSSYAKPEEKLSAY  2406

Query  2687  DLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCAT  2746
             DL  C+   A+ +NA V       ++W+ KDF SLS + RK I   +K   L F LT   
Sbjct  2407  DLACCMRAGAKVVNANVLTKDQTPIVWHAKDFNSLSAEGRKYIVKTSKAKGLTFLLTINE  2466

Query  2747  TRQVVNVVTTKIALKGGKIVNN----WLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDF  2802
              + V  +  T I  K G         WL  L  +  +  F    F       ++S     
Sbjct  2467  NQAVTQIPATSIVAKQGAGDAGHSLTWLWLLCGLVCLIQFYLCFFMPYFMYDIVS-----  2521

Query  2803  SSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTW-FSQRGGSYTNDKACPLIAAVITRE  2861
             S E   +K I+ G  ++  +   C  N   +F+ W +++ G +  N ++CP++  V   E
Sbjct  2522  SFEGYDFKYIENGQLKNFEAPLKCVRNVFENFEDWHYAKFGFTPLNKQSCPIVVGV--SE  2579

Query  2862  VGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICY------TPSKLIEYTDFATSACVL  2915
             +   V G+P  +     G  L F  +       +CY      TP K           C+ 
Sbjct  2580  IVNTVAGIPSNVYLV--GKTLIFTLQAAFGNAGVCYDIFGVTTPEK-----------CIF  2626

Query  2916  AAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG-SVR  2974
              + CT  +   G  V YCY+T ++EGS+ Y S++ +  Y   +G+ I+ P    +G   R
Sbjct  2627  TSACTRLEGLGGNNV-YCYNTALMEGSLPYSSIQANAYYKYDNGNFIKLPEVIAQGFGFR  2685

Query  2975  VVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPL  3034
              V T  ++YCR G C  S AGVC     +W +N+   R   G  CG    NL+ N+ +  
Sbjct  2686  TVRTIATKYCRVGECVESNAGVCFGFD-KWFVNDG--RVANGYVCGTGLWNLVFNILSMF  2742

Query  3035  IQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCL  3094
                     +S  I+    +        +   +FRR FG+ S  V    +  L++     +
Sbjct  2743  SSSFSVAAMSGQILLNCALGAFAIFCCFLVTKFRRMFGDLSVGVCTVVVAVLLNNVSYIV  2802

Query  3095  TPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFY  3154
             T     +   Y+++Y + T  L    +++    +++ +    P+W+   Y + + T    
Sbjct  2803  TQNLVTMIA-YAILYFFATRSLR--YAWIWCAAYLIAYISFAPWWLCAWYFLAMLTG---  2856

Query  3155  WFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLAL  3210
                 + LK +V   +F G  F  TFE AA  TF+++   Y KL + +     +   Y A 
Sbjct  2857  -LLPSLLKLKVSTNLFEGDKFVGTFESAAAGTFVIDMRSYEKLANSI--SPEKLKSYAAS  2913

Query  3211  YNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMA  3270
             YN+YKY+SG  +   YR A   +LAKA+ DFS   +D+LY PP  S  S  LQ+G RKMA
Sbjct  2914  YNRYKYYSGNANEADYRCACYAYLAKAMLDFSRDHNDILYTPPTVSYGST-LQAGLRKMA  2972

Query  3271  FPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNF  3329
              PSG VE C+V+V  G T LNGLWL D+VYCPRHVI + +   ++ ++E  ++R   HNF
Sbjct  2973  QPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNF  3030

Query  3330  LVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVY  3389
              + +G   L V+G +M    LK+KV   N  TP++ F  ++ G+ F++LACY+G   GV+
Sbjct  3031  SIISGTAFLGVVGATMHGVTLKIKVSQTNMHTPRHSFRTLKSGEGFNILACYDGCAQGVF  3090

Query  3390  QCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFV  3449
                MR N+TI+GSF+NG+CGS G+N+    V F YMH +EL +G H G+  +G  YG F 
Sbjct  3091  GVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFE  3150

Query  3450  DRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDH  3509
             D+   Q    +  +TVNV+A+LYAA++NG  W+L      +  +N  A    +  +  + 
Sbjct  3151  DQPNLQVESANQMLTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE-  3209

Query  3510  VDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ  3569
              D    L+A+TG+ V  +  ++ ++L NG  G+ ILG + L DEF+  +VV+Q  GV  Q
Sbjct  3210  -DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQMFGVNLQ  3267

Query  3570  SAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYEN-AFL-PFAMGIIAMSAFAMM  3627
             S      K T  +  +++     V+  +  +     ++ N  FL PF + ++A+S     
Sbjct  3268  SG-----KTTSMFKSISLFAGFFVMFWAELFVYTTTIWVNPGFLTPFMILLVALSLCLTF  3322

Query  3628  FVKHKHAFLCLFLLPSLATVAYFNMVYMPASW---VMRIMTWLDMVDTSLSGFKLKDCVM  3684
              VKHK  FL +FLLPS+   A  N      +W   V +++      + S+    ++  V 
Sbjct  3323  VVKHKVLFLQVFLLPSIIVAAIQN-----CAWDYHVTKVLAEKFDYNVSVMQMDIQGFVN  3377

Query  3685  YASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNY  3744
                 + + +L T R   +        L +++ ++Y   Y       +S+  +++   SN 
Sbjct  3378  IFICLFVALLHTWRFAKERCTHWCTYLFSLIAVLYTALYSY---DYVSLLVMLLCAISNE  3434

Query  3745  SGVVTTVMFLAR-GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRY  3803
               +   +  + R G+ F+ VEY   F    + ++ ++L Y  LG+    Y+GL   +NR+
Sbjct  3435  WYIGAIIFRICRFGVAFLPVEYVSYF----DGVKTVLLFYMLLGFVSCMYYGLLYWINRF  3490

Query  3804  FRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMS  3863
              + TLGVYD+ VS  EF+YM + GL  P    DA  L+ KL+G+GG   IKV+TVQSK++
Sbjct  3491  CKCTLGVYDFCVSPAEFKYMVANGLNAPNGPFDALFLSFKLMGIGGPRTIKVSTVQSKLT  3550

Query  3864  DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG  3923
             D+KCT+VVL+ +L  + + S+SK WA CV++HN I L  D   A E +++LL+  LS   
Sbjct  3551  DLKCTNVVLMGILSNMNIASNSKEWAYCVEMHNKINLCDDPETAQELLLALLAFFLSKHS  3610

Query  3924  AVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKS  3983
                +  L +   +N + LQ++AS F  +PS+ A+ TA++ YE AVANG S  ++K+LKK+
Sbjct  3611  DFGLGDLVDSYFENDSILQSVASSFVGMPSFVAYETARQEYENAVANGSSPQIIKQLKKA  3670

Query  3984  LNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND  4043
             +NVAK+EFDR++++Q+K+ +MA+QA   MYK+AR+ ++++KV SAM ++LF MLR+LD  
Sbjct  3671  MNVAKAEFDRESSVQKKINRMAEQAAAAMYKEARAVNRKSKVVSAMHSLLFGMLRRLDMS  3730

Query  4044  ALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY-KNTCDGTTFTYASALWEIQQVV  4102
             +++ I+N AR+G VPL++IP T+AA+L+VV+PD++++ K   DG    YA  +W +Q+V 
Sbjct  3731  SVDTILNMARNGVVPLSVIPATSAARLVVVVPDHDSFVKMMVDGFVH-YAGVVWTLQEVK  3789

Query  4103  DADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA  4162
             D D K V L +++ +N   L WPLI+T  R    VKLQNNE+ P  ++  +         
Sbjct  3790  DNDGKNVHLKDVTKENQEILVWPLILTCER---VVKLQNNEIMPGKMKVKATKGEGDGGI  3846

Query  4163  CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKG  4222
              ++ NAL  YN   G  F+ A ++    +K+ ++    G  T+  ELEPPCRFV DTP G
Sbjct  3847  TSEGNAL--YNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTV--ELEPPCRFVIDTPTG  3902

Query  4223  PKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKD  4282
             P++KYLYF+K LNNL RG VLG + ATVRLQAG  TE  +NS +L+ C+FAVD A AY D
Sbjct  3903  PQIKYLYFVKNLNNLRRGAVLGYIGATVRLQAGKQTEFVSNSHLLTHCSFAVDPAAAYLD  3962

Query  4283  YLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGF  4342
              +  G +P+ NCVKML   +G+GQAIT T ++N  Q+++GGAS C+YCR H+ HP   GF
Sbjct  3963  AVKQGAKPVGNCVKMLTNGSGSGQAITCTIDSNTTQDTYGGASVCIYCRAHVAHPTMDGF  4022

Query  4343  CDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             C  KGK+VQ+P    NDP+ F L+NTVC VCG W  +GC+CD+     +QS D  S+LN
Sbjct  4023  CQYKGKWVQVPIG-TNDPIRFCLENTVCKVCGCWLNHGCTCDR---TAIQSFD-NSYLN  4076


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 110/245 (45%), Gaps = 16/245 (7%)

Query  991   QDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYL---KLT-----DNVYIKN  1042
             Q  + D   T      +   ++E+ +TP+  T++      ++   KL      DNV    
Sbjct  1226  QPWTNDALNTICIKDADYNAKVEISVTPIKNTVDTTPKEEFVVKEKLNAFLVHDNVAFYQ  1285

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
              D+      V    +VNAAN  L HGGG+A AL+  T   +Q  S ++I   G +KVG  
Sbjct  1286  GDVDTVVNGVDFDFIVNAANENLAHGGGLAKALDVYTKGKLQRLSKEHIGLAGKVKVGTG  1345

Query  1103  CVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSL  1162
              ++   +L     +VVGP   K E   L+K+     N+    L P+LS GIFG     SL
Sbjct  1346  VMVECDSL--RIFNVVGPRKGKHERDLLIKAYNTINNEQGTPLTPILSCGIFGIKLETSL  1403

Query  1163  RVCVDTVRTN-VYLAVFDKNLYDKL---VSSFLEMKSEKQ--VEQKIAEIPKEEVKPFIT  1216
              V +D   T  V + V+      K+   VS  + ++  +Q  +E K   + K   KP+  
Sbjct  1404  EVLLDVCNTKEVKVFVYTDTEVCKVKDFVSGLVNVQKVEQPKIEPKPVSVIKVAPKPYRV  1463

Query  1217  ESKPS  1221
             + K S
Sbjct  1464  DGKFS  1468


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 74/339 (22%), Positives = 137/339 (40%), Gaps = 30/339 (9%)

Query  1560  LSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFY  1619
             L   E + I +  T D +N+H   V    ++ QQ G       D++   P + +  +   
Sbjct  1595  LKAAEAKVITIKVTEDGVNVHDVTVTTDKSFEQQVGVIADKDKDLSGAVPSDLNTSELL-  1653

Query  1620  VLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTK-KWKYPQVNGLTSIKWADNNCYLAT  1678
                    + V+  E+Y   D        + ++H+   ++   VNG+  +K +DNNC++  
Sbjct  1654  ----TKAIDVDWVEFYGFKD----AVTFATVDHSAFAYESAVVNGIRVLKTSDNNCWVNA  1705

Query  1679  ALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQH  1738
               + LQ  +  F    L  A+ +   G+   F A +        G+ GD  +T++ L ++
Sbjct  1706  VCIALQYSKPHFISQGLDAAWNKFVLGDVEIFVAFVYYVARLMKGDKGDAEDTLTKLSKY  1765

Query  1739  -ANLDSCKRVLNVVCKTCGQQ-QTTLKGVEAVMYMGTLSYEQFKKGVQIP-CTCGKQATK  1795
              AN    +      C  C  + + ++  + + +   ++     + GVQ+  C  G +   
Sbjct  1766  LANEAQVQLEHYSSCVECDAKFKNSVASINSAIVCASVK----RDGVQVGYCVHGIKYYS  1821

Query  1796  YLVQQESPFVMMSA----PPAQYELKHGTFTCASEYTGNYQCGHYK-HITSKETLYCIDG  1850
              +       +++S     P AQ  L  G    A  ++G    GHY  + T+K+++Y  DG
Sbjct  1822  RVRSVRGRAIIVSVEQLEPCAQSRLLSGVAYTA--FSGPVDKGHYTVYDTAKKSMY--DG  1877

Query  1851  ALLTKSSEYKGPITDVF----YKENSYTTTIKPVTYKLD  1885
                 K       +T V     Y     T   KPV  +LD
Sbjct  1878  DRFVKHDLSLLSVTSVVMVGGYVAPVNTVKPKPVINQLD  1916


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 110/267 (41%), Gaps = 18/267 (7%)

Query  1658  YPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAY  1717
             + ++NGL  +K  DNNC++ + +L +Q   +     A+Q  +   R  +    C      
Sbjct  1038  FEELNGLKILKQLDNNCWVNSVMLQIQLTGILDGDYAMQ-FFKMGRVAKMIERC-YTAEQ  1095

Query  1718  CNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYE  1777
             C +  G +GDV   M  L +  +L +   V++  C +C   +    G  AV++  T + +
Sbjct  1096  CIR--GAMGDVGLCMYRLLK--DLHTGFMVMDYKC-SCTSGRLEESG--AVLFC-TPTKK  1147

Query  1778  QFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYK  1837
              F  G  + C   +  T   +Q    FV     P           C+S + G   CGHY+
Sbjct  1148  AFPYGTCLNCNAPRMCTIRQLQGTIIFVQQKPEPVNPVSFVVKPVCSSIFRGAVSCGHYQ  1207

Query  1838  HITSKETLYCIDGALLTKSSEY-KGPITDVFYKENSYTT----TIKPVTYKLDGVVCTE-  1891
                  + L C+DG  + K   +    +  +  K+  Y      ++ P+   +D     E 
Sbjct  1208  TNIYSQNL-CVDGFGVNKIQPWTNDALNTICIKDADYNAKVEISVTPIKNTVDTTPKEEF  1266

Query  1892  -IDPKLDNYYKKDNSYFTEQPIDLVPN  1917
              +  KL+ +   DN  F +  +D V N
Sbjct  1267  VVKEKLNAFLVHDNVAFYQGDVDTVVN  1293


 Score = 37.4 bits (85),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 61/268 (23%), Positives = 103/268 (38%), Gaps = 29/268 (11%)

Query  662  GQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCV  721
            G + TCAK  K  +    +  N FL     ++ IGG   K     + ++     + +   
Sbjct  749  GLLGTCAKRFKRWLGILLEAYNAFLDTVVSTVKIGGLTFKTYAFDKPYIVIRDIVCKVEN  808

Query  722  KSREETGLLMPLKAP-KEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
            K+  E   L P     K     E   +P    T        D++ +E   +E VE    G
Sbjct  809  KTEAEWIELFPHNDRIKSFSTFESAYMPIADPTHF------DIEEVELLDAEFVEPGCGG  862

Query  781  TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDT-VIEVQGYKSV  839
                I+  +  + KD   Y +   N++     FT   G   KV+F DD  V +++    V
Sbjct  863  ILAVIDEHVFYK-KDGVYYPSNGTNILPV--AFTKAAGG--KVSFSDDVEVKDIEPVYRV  917

Query  840  NITFEL-DERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLD  898
             + FE  DE++  V  +         G           D+  KT+Q    +++       
Sbjct  918  KLCFEFEDEKLVDVCEKAIGKKIKHEGD---------WDSFCKTIQSALSVVSCYV----  964

Query  899  EWSMATYYLFDESGEFKLASHMYCSFYP  926
              ++ TYY++DE G   L+  +  S +P
Sbjct  965  --NLPTYYIYDEEGGNDLSLPVMISEWP  990


> sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=1a PE=1 SV=1
Length=4017

 Score = 1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/2189 (33%), Positives = 1123/2189 (51%), Gaps = 151/2189 (7%)

Query  2263  CTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWD----L  2318
             C G  + Y NS+ +  A  C  SI C  CL+  D L  +  L+      S   W+    L
Sbjct  1921  CNGAVQAYKNSSFIKSAV-CGNSILCKACLASYDELADFQHLQVTWDFKSDPLWNRLVQL  1979

Query  2319  TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPIS  2378
             + F  +A +   Y+   R F +  ++  + L+ SYF   ++  SW +    ++V    IS
Sbjct  1980  SYFAFLAVFGNNYV---RCFLMYFVSQYLNLWLSYFG--YVEYSWFL----HVVNFESIS  2030

Query  2379  AMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYA  2438
             A   + +         K   H+V  C++ +C  C +  R TR+    +VNG  ++ YV+A
Sbjct  2031  AEFVIVVIVVKAVLALK---HIVFACSNPSCKTCSRTARQTRIPIQVVVNGSMKTVYVHA  2087

Query  2439  NGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKN  2498
             NG   FCK HN+ C NCD++   +TFI DE+ RDLS   K+ +  TD+S   V  V   +
Sbjct  2088  NGTGKFCKKHNFYCKNCDSYGFENTFICDEIVRDLSNSVKQTVYATDRSHQEVTKVECSD  2147

Query  2499  GSIHLY---------FDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKC  2549
             G    Y         +D   +K   +  L   + LD+    +  GS   NV         
Sbjct  2148  GFYRFYVGDEFTSYDYDVKHKKYSSQEVLKSMLLLDDFIVYSPSGSALANV---------  2198

Query  2550  EESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKL  2609
                  ++A VY+SQL+ +PI +++  L+ D+  S +    +F+A  N   ++FNV + + 
Sbjct  2199  -----RNACVYFSQLIGKPIKIVNSDLLEDL--SVDFKGALFNAKKNVIKNSFNVDVSEC  2251

Query  2610  KTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDS  2669
             K L      E  +  +L+   STF  A                     +H+  I +T  S
Sbjct  2252  KNL-----DECYRACNLNVSFSTFEMAVNN------------------AHRFGILITDRS  2288

Query  2670  CNNYMLTYNK--VENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRK  2727
              NN+  +  K     ++  D+G C+   A+ +NA+V      +++W  +DF +LS   +K
Sbjct  2289  FNNFWPSKVKPGSSGVSAMDIGKCMTSDAKIVNAKVLTQRGKSVVWLSQDFAALSSTAQK  2348

Query  2728  QIRSAAKKNNLPFKLTCATTRQVVNV----VTTKIALKGGK---IVNNWLKQLIKVTLVF  2780
              +     +  + F LT        ++     T  ++ K G     V   LKQ++ +  VF
Sbjct  2349  VLVKTFVEEGVNFSLTFNAVGSDDDLPYERFTESVSPKSGSGFFDVITQLKQIVILVFVF  2408

Query  2781  LFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQ  2840
             +F+     L +   V ++    S+E   Y  I  G+ +    T +C  N +  F  WF  
Sbjct  2409  IFICG---LCSVYSVATQSYIESAEGYDYMVIKNGIVQPFDDTISCVHNTYKGFGDWFKA  2465

Query  2841  RGGSY-TNDKACPLIAA-VITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYT  2898
             + G   T  K+CP++   V   E    +P +P  +  +  G  L F       V N+CY 
Sbjct  2466  KYGFIPTFGKSCPIVVGTVFDLENMRPIPDVPAYV--SIVGRSLVFAINAAFGVTNMCYD  2523

Query  2899  PSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMD  2958
              +      D     CV    CT      G  V YC    ++EG+  Y  L PD  Y    
Sbjct  2524  HTGNAVSKDSYFDTCVFNTACTTLTGLGGTIV-YCAKQGLVEGAKLYSDLMPDYYYEHAS  2582

Query  2959  GSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVF  3018
             G++++ P       +R V T  + YCR G C  S+AG C      +V +N++     G  
Sbjct  2583  GNMVKLPAIIRGLGLRFVKTQATTYCRVGECIDSKAGFCFGGDNWFVYDNEFGN---GYI  2639

Query  3019  CGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVV  3078
             CG   +    N+F      +  +  S +++   I+A +   + Y  ++F++ FG+     
Sbjct  2640  CGNSVLGFFKNVFKLFNSNMSVVATSGAMLVNIIIACLAIAMCYGVLKFKKIFGDC----  2695

Query  3079  AFNTLLFLMSFTVLCLTPVYSFLPG--VYSVIYLYLTFYLTNDVSF--LAHIQWMVMFTP  3134
                T L +M    L +  V  F+     + +IY  + +++T  +++  +    +++ +  
Sbjct  2696  ---TFLIVMIIVTLVVNNVSYFVTQNTFFMIIYAIVYYFITRKLAYPGILDAGFIIAYIN  2752

Query  3135  LVPFWITIAYIICISTKHFYWFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNKEMY  3190
             + P+++  AYI+       Y    +  K +V   +F G  F   FE AA+ TF+++   Y
Sbjct  2753  MAPWYVITAYILVF----LYDSLPSLFKLKVSTNLFEGDKFVGNFESAAMGTFVIDMRSY  2808

Query  3191  LKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLY  3250
               + +     + +   Y   +NKYKY++G+M    YR A   HL KAL D+S + +D+LY
Sbjct  2809  ETIVNST--SIARIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVNRTDMLY  2866

Query  3251  QPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE  3310
              PP  S+ S  LQSG RKMA PSG VE C+V+V+ G   LNGLWL D V CPRHVI  S+
Sbjct  2867  TPPTVSVNST-LQSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVI-ASD  2924

Query  3311  DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQ  3370
                  NYE+ +     HNF V   NV L V+    +   L LKV+  NP TP++KF  I+
Sbjct  2925  TTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIK  2984

Query  3371  PGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMEL  3430
              G++F++LACY G P  VY   MR   TIKGSF+ G+CGSVG+ ++   + F YMHH+EL
Sbjct  2985  AGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLEL  3044

Query  3431  PTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTL  3490
               G H G++ EG  YG + D+ + Q  GT+   + NV+A+LYAA+ING+RWF+   + +L
Sbjct  3045  GNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSL  3104

Query  3491  NDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALL  3550
               +N  A   ++  L+    D    L+A+TG +V  +  S+  L   G  GRTIL    L
Sbjct  3105  ESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVRL-NKGFGGRTILSYGSL  3161

Query  3551  EDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLY---  3607
              DEFTP +V+RQ  GV  Q+   ++      + ++T +T L        W L FF+Y   
Sbjct  3162  CDEFTPTEVIRQMYGVNLQAGKVKSF----FYPIMTAMTILFAF-----W-LEFFMYTPF  3211

Query  3608  ---ENAFLPFAMGIIAM-SAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRI  3663
                   F+   + +  + S   +  +KHK  F   F+LPS+  V   N+ +   S+   +
Sbjct  3212  TWINPTFVSIVLAVTTLISTVFVSGIKHKMLFFMSFVLPSVILVTAHNL-FWDFSYYESL  3270

Query  3664  MTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYY  3723
              + ++  +T      ++  ++     ++ +  + R      +     +  +L +   V  
Sbjct  3271  QSIVENTNTMFLPVDMQGVMLTVFCFIVFVTYSVRFFTCKQSWFSLAVTTILVIFNMVKI  3330

Query  3724  GNALDQA----------ISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITG  3773
                 D+           ++M  +I+S+T+    VV     +A  IV +CV   P  F++ 
Sbjct  3331  FGTSDEPWTENQIAFCFVNMLTMIVSLTTKDWMVVIASYRIAYYIV-VCV--MPSAFVSD  3387

Query  3774  -NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
                ++CI +VY   GY   CY+G+   +NR+  +T GVY + VS  E +YM +  L  PK
Sbjct  3388  FGFMKCISIVYMACGYLFCCYYGILYWVNRFTCMTCGVYQFTVSAAELKYMTANNLSAPK  3447

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             N+ DA  L+ KL+GVGGK  IK++TVQSK++++KCT+VVLL +L ++ VES+SK W  CV
Sbjct  3448  NAYDAMILSAKLIGVGGKRNIKISTVQSKLTEMKCTNVVLLGLLSKMHVESNSKEWNYCV  3507

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
              LHN+I L  D     EK+++L++  LS     D+++L E   +N   LQ++AS +++LP
Sbjct  3508  GLHNEINLCDDPEIVLEKLLALIAFFLSKHNTCDLSELIESYFENTTILQSVASAYAALP  3567

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             S+ A   A+   E+A  N  S  +LK+L K+ N+AKS+F+R+A++Q+KL+KMA+QA   M
Sbjct  3568  SWIALEKARADLEEAKKNDVSPQILKQLTKAFNIAKSDFEREASVQKKLDKMAEQAAASM  3627

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YK+AR+ D+++K+ SAM ++LF ML+KLD  ++N II+ AR+G +PL+IIP  +A +L+V
Sbjct  3628  YKEARAVDRKSKIVSAMHSLLFGMLKKLDMSSVNTIIDQARNGVLPLSIIPAASATRLVV  3687

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             + P    +          YA A+W I +V DA+   V L E++  N  NL WPL +T  R
Sbjct  3688  ITPSLEVFSKIRQENNVHYAGAIWTIVEVKDANGSHVHLKEVTAANELNLTWPLSITCER  3747

Query  4133  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLK  4192
                  KLQNNE+ P  L++ +  A  T       +  A   +  G  F+ A ++   +LK
Sbjct  3748  ---TTKLQNNEIMPGKLKERAVRASATLDGEAFGSGKALMASESGKSFMYAFIASDNNLK  3804

Query  4193  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL  4252
             + ++  ++    I  ELE P RF  D   GP+VKYLYF+K LN L RG VLG + ATVRL
Sbjct  3805  YVKWESNN--DIIPIELEAPLRFYVDGANGPEVKYLYFVKNLNTLRRGAVLGYIGATVRL  3862

Query  4253  QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4312
             QAG  TE P+NS++L+ CAF+ D AKAY D +  G QP+ NCVKML    G G A+T   
Sbjct  3863  QAGKPTEHPSNSSLLTLCAFSPDPAKAYVDAVKRGMQPVNNCVKMLSNGAGNGMAVTNGV  3922

Query  4313  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV  4372
             EAN  Q+S+GGAS C+YCRCH++HP   G C  KGK+VQIPT    DP+ F ++N VC V
Sbjct  3923  EANTQQDSYGGASVCIYCRCHVEHPAIDGLCRYKGKFVQIPTG-TQDPIRFCIENEVCVV  3981

Query  4373  CGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             CG W   GC CD  R  M      QS+LN
Sbjct  3982  CGCWLNNGCMCD--RTSMQSFTVDQSYLN  4008


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/288 (24%), Positives = 123/288 (43%), Gaps = 38/288 (13%)

Query  986   QTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADI  1045
             + V QQ   E+N+++  +  ++  P+ +  + P  +  +++ + G L +  N        
Sbjct  1293  EKVEQQPIVEENKSSIEKEEIQ-SPKNDDLILPFYKAGKLSFYQGALDVLINF-------  1344

Query  1046  VEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVL  1105
                   ++P V+VNAAN  LKH GGVA A++  T   +   S DY+  N  +  G +   
Sbjct  1345  ------LEPDVIVNAANGDLKHMGGVARAIDVFTGGKLTERSKDYLKKNKSIAPGNAVFF  1398

Query  1106  SGHNLAKH--CLHVVGPNVNKGEDIQLLKSAYENFNQHE-VLLAPLLSAGIFGADPIHSL  1162
                N+ +H   L+ VGP          L + Y+   + E  +L PL+S GIF        
Sbjct  1399  --ENVIEHLSVLNAVGPRNGDSRVEAKLCNVYKAIAKCEGKILTPLISVGIF--------  1448

Query  1163  RVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKI--AEIPKEEVKPFITESKP  1220
                   VR    L    K + D+ ++ F+    E+Q  +      IP    +  +   + 
Sbjct  1449  -----NVRLETSLQCLLKTVNDRGLNVFVYTDQERQTIENFFSCSIPVNVTEDNVNHERV  1503

Query  1221  SVEQRKQDDKKIKACV----EEVTTTLEETKFLTENLLLYIDINGNLH  1264
             SV   K   +++K  V    ++VT  L     + + ++  IDI+   H
Sbjct  1504  SVSFDKTYGEQLKGTVVIKDKDVTNQLPSAFDVGQKVIKAIDIDWQAH  1551


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 95/235 (40%), Gaps = 34/235 (14%)

Query  1656  WKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALIL  1715
             +K   +NG   +K  DNNC++      LQ  +  FN     +A+ + + G+  +F  L  
Sbjct  1075  FKTTNLNGKIILKQGDNNCWINACCYQLQAFDF-FN----NEAWEKFKKGDVMDFVNLCY  1129

Query  1716  AYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
             A      G  GD    +  +    +  + K VL   C  CG+++  L+   AV  +  L 
Sbjct  1130  AATTLARGHSGDAEYLLELMLN--DYSTAKIVLAAKCG-CGEKEIVLE--RAVFKLTPLK  1184

Query  1776  YEQFKKGVQIPC----TCGKQATKY-------LVQQESPFVMMSAPPAQYELKHGTFTCA  1824
              E F  GV   C    TC   + +        ++ +++P  M    P  + +        
Sbjct  1185  -ESFNYGVCGDCMQVNTCRFLSVEGSGVFVHDILSKQTPEAMFVVKPVMHAV--------  1235

Query  1825  SEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKP  1879
               YTG  Q GHY  +   E  YC+DG +  K  + +   + +F   N  T   KP
Sbjct  1236  --YTGTTQNGHY-MVDDIEHGYCVDG-MGIKPLKKRCYTSTLFINANVMTRAEKP  1286


 Score = 40.4 bits (93),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 97/407 (24%), Positives = 133/407 (33%), Gaps = 95/407 (23%)

Query  144  DLGDELGTDPYEDFQENWNTKHSSGVTREL-MRELNGGAYTRYVDNNFCGPDGYPL--EC  200
            DL   L T+P    Q      + +GV  +  ++    G    YVD   CG DG P+    
Sbjct  71   DLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKIARTGRGAIYVDQYMCGADGKPVIEGD  130

Query  201  IKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLA  260
             KD                D I+ +   Y C       AW T R EK    QT F I+  
Sbjct  131  FKDYFGDE-----------DIIEFEGEEYHC-------AWTTVRDEKPLNQQTLFTIQEI  172

Query  261  KKFDTFNGECPNFVFPLNSIIKTIQPRVEK----------KKLDGFMGRIRSVYPVASPN  310
            +    +N + P+   P N   + + P V+K          KKL    G      P     
Sbjct  173  Q----YNLDIPH-KLP-NCATRHVAPPVKKNSKIVLSEDYKKLYDIFGS-----PFMGNG  221

Query  311  ECNQMCLSTL------MKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNA  364
            +C   C  TL      ++C  CG  S   GD+       CG     K G T     P +A
Sbjct  222  DCLSKCFDTLHFIAATLRCP-CGSESSGVGDWTGFKTACCGLSGKVK-GVTLGDIKPGDA  279

Query  365  VVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWV  424
            VV                            T +  G     F  CV  Y G     + W 
Sbjct  280  VV----------------------------TSMSAGKGVKFFANCVLQYAGDVEGVSIW-  310

Query  425  PRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNIN-----IVGDFKLNEEIAIILAS  479
             +       + T V   G EG  ++ ++   K  V  +     I GD        II   
Sbjct  311  -KVIKTFTVDET-VCTPGFEGELNDFIKPESKSLVACSVKRAFITGDIDDAVHDCIITGK  368

Query  480  FSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQ  526
               ST+ F     GL +K     V+ CG   V        AW + E+
Sbjct  369  LDLSTNLFGNV--GLLFKKTPWFVQKCGALFVD-------AWKVVEE  406


 Score = 37.7 bits (86),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 107/286 (37%), Gaps = 29/286 (10%)

Query  1567  TIKVFTTVDNINLHTQVVDMSMTYGQQF-GPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             +I V  T DN+N     V    TYG+Q  G   +   DVT   P     G+         
Sbjct  1488  SIPVNVTEDNVNHERVSVSFDKTYGEQLKGTVVIKDKDVTNQLPSAFDVGQKVI-----K  1542

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI--KWADNNCYLATALLTL  1683
              + ++   +Y   D +      SA +H   +K+  V     I  K  DNNC++    L L
Sbjct  1543  AIDIDWQAHYGFRDAA----AFSASSH-DAYKFEVVTHSNFIVHKQTDNNCWINAICLAL  1597

Query  1684  QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS  1743
             Q+++ ++  P ++  +      +   F  ++        GE GD  E M +       + 
Sbjct  1598  QRLKPQWKFPGVRGLWNEFLERKTQGFVHMLYHISGVKKGEPGDA-ELMLHKLGDLMDND  1656

Query  1744  CKRVL--NVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE  1801
             C+ ++     C  C + +  +  V A      L+      G    C  G      + Q +
Sbjct  1657  CEIIVTHTTACDKCAKVEKFVGPVVA----APLAIH----GTDETCVHGVSVNVKVTQIK  1708

Query  1802  SPFVMMS--APPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETL  1845
                 + S   P     L+   + C   Y+G+ + GHY +  ++  L
Sbjct  1709  GTVAITSLIGPIIGEVLEATGYIC---YSGSNRNGHYTYYDNRNGL  1751


> sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=rep PE=1 SV=1
Length=6684

 Score = 1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 723/2189 (33%), Positives = 1123/2189 (51%), Gaps = 151/2189 (7%)

Query  2263  CTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWD----L  2318
             C G  + Y NS+ +  A  C  SI C  CL+  D L  +  L+      S   W+    L
Sbjct  1921  CNGAVQAYKNSSFIKSAV-CGNSILCKACLASYDELADFQHLQVTWDFKSDPLWNRLVQL  1979

Query  2319  TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPIS  2378
             + F  +A +   Y+   R F +  ++  + L+ SYF   ++  SW +    ++V    IS
Sbjct  1980  SYFAFLAVFGNNYV---RCFLMYFVSQYLNLWLSYFG--YVEYSWFL----HVVNFESIS  2030

Query  2379  AMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYA  2438
             A   + +         K   H+V  C++ +C  C +  R TR+    +VNG  ++ YV+A
Sbjct  2031  AEFVIVVIVVKAVLALK---HIVFACSNPSCKTCSRTARQTRIPIQVVVNGSMKTVYVHA  2087

Query  2439  NGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKN  2498
             NG   FCK HN+ C NCD++   +TFI DE+ RDLS   K+ +  TD+S   V  V   +
Sbjct  2088  NGTGKFCKKHNFYCKNCDSYGFENTFICDEIVRDLSNSVKQTVYATDRSHQEVTKVECSD  2147

Query  2499  GSIHLY---------FDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKC  2549
             G    Y         +D   +K   +  L   + LD+    +  GS   NV         
Sbjct  2148  GFYRFYVGDEFTSYDYDVKHKKYSSQEVLKSMLLLDDFIVYSPSGSALANV---------  2198

Query  2550  EESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKL  2609
                  ++A VY+SQL+ +PI +++  L+ D+  S +    +F+A  N   ++FNV + + 
Sbjct  2199  -----RNACVYFSQLIGKPIKIVNSDLLEDL--SVDFKGALFNAKKNVIKNSFNVDVSEC  2251

Query  2610  KTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDS  2669
             K L      E  +  +L+   STF  A                     +H+  I +T  S
Sbjct  2252  KNL-----DECYRACNLNVSFSTFEMAVNN------------------AHRFGILITDRS  2288

Query  2670  CNNYMLTYNK--VENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRK  2727
              NN+  +  K     ++  D+G C+   A+ +NA+V      +++W  +DF +LS   +K
Sbjct  2289  FNNFWPSKVKPGSSGVSAMDIGKCMTSDAKIVNAKVLTQRGKSVVWLSQDFAALSSTAQK  2348

Query  2728  QIRSAAKKNNLPFKLTCATTRQVVNV----VTTKIALKGGK---IVNNWLKQLIKVTLVF  2780
              +     +  + F LT        ++     T  ++ K G     V   LKQ++ +  VF
Sbjct  2349  VLVKTFVEEGVNFSLTFNAVGSDDDLPYERFTESVSPKSGSGFFDVITQLKQIVILVFVF  2408

Query  2781  LFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQ  2840
             +F+     L +   V ++    S+E   Y  I  G+ +    T +C  N +  F  WF  
Sbjct  2409  IFICG---LCSVYSVATQSYIESAEGYDYMVIKNGIVQPFDDTISCVHNTYKGFGDWFKA  2465

Query  2841  RGGSY-TNDKACPLIAA-VITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYT  2898
             + G   T  K+CP++   V   E    +P +P  +  +  G  L F       V N+CY 
Sbjct  2466  KYGFIPTFGKSCPIVVGTVFDLENMRPIPDVPAYV--SIVGRSLVFAINAAFGVTNMCYD  2523

Query  2899  PSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMD  2958
              +      D     CV    CT      G  V YC    ++EG+  Y  L PD  Y    
Sbjct  2524  HTGNAVSKDSYFDTCVFNTACTTLTGLGGTIV-YCAKQGLVEGAKLYSDLMPDYYYEHAS  2582

Query  2959  GSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVF  3018
             G++++ P       +R V T  + YCR G C  S+AG C      +V +N++     G  
Sbjct  2583  GNMVKLPAIIRGLGLRFVKTQATTYCRVGECIDSKAGFCFGGDNWFVYDNEFGN---GYI  2639

Query  3019  CGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVV  3078
             CG   +    N+F      +  +  S +++   I+A +   + Y  ++F++ FG+     
Sbjct  2640  CGNSVLGFFKNVFKLFNSNMSVVATSGAMLVNIIIACLAIAMCYGVLKFKKIFGDC----  2695

Query  3079  AFNTLLFLMSFTVLCLTPVYSFLPG--VYSVIYLYLTFYLTNDVSF--LAHIQWMVMFTP  3134
                T L +M    L +  V  F+     + +IY  + +++T  +++  +    +++ +  
Sbjct  2696  ---TFLIVMIIVTLVVNNVSYFVTQNTFFMIIYAIVYYFITRKLAYPGILDAGFIIAYIN  2752

Query  3135  LVPFWITIAYIICISTKHFYWFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNKEMY  3190
             + P+++  AYI+       Y    +  K +V   +F G  F   FE AA+ TF+++   Y
Sbjct  2753  MAPWYVITAYILVF----LYDSLPSLFKLKVSTNLFEGDKFVGNFESAAMGTFVIDMRSY  2808

Query  3191  LKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLY  3250
               + +     + +   Y   +NKYKY++G+M    YR A   HL KAL D+S + +D+LY
Sbjct  2809  ETIVNST--SIARIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVNRTDMLY  2866

Query  3251  QPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE  3310
              PP  S+ S  LQSG RKMA PSG VE C+V+V+ G   LNGLWL D V CPRHVI  S+
Sbjct  2867  TPPTVSVNST-LQSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVI-ASD  2924

Query  3311  DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQ  3370
                  NYE+ +     HNF V   NV L V+    +   L LKV+  NP TP++KF  I+
Sbjct  2925  TTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIK  2984

Query  3371  PGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMEL  3430
              G++F++LACY G P  VY   MR   TIKGSF+ G+CGSVG+ ++   + F YMHH+EL
Sbjct  2985  AGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLEL  3044

Query  3431  PTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTL  3490
               G H G++ EG  YG + D+ + Q  GT+   + NV+A+LYAA+ING+RWF+   + +L
Sbjct  3045  GNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSL  3104

Query  3491  NDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALL  3550
               +N  A   ++  L+    D    L+A+TG +V  +  S+  L   G  GRTIL    L
Sbjct  3105  ESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVRL-NKGFGGRTILSYGSL  3161

Query  3551  EDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLY---  3607
              DEFTP +V+RQ  GV  Q+   ++           I+T++ +L     + L FF+Y   
Sbjct  3162  CDEFTPTEVIRQMYGVNLQAGKVKS-------FFYPIMTAMTILFA---FWLEFFMYTPF  3211

Query  3608  ---ENAFLPFAMGIIAM-SAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRI  3663
                   F+   + +  + S   +  +KHK  F   F+LPS+  V   N+ +   S+   +
Sbjct  3212  TWINPTFVSIVLAVTTLISTVFVSGIKHKMLFFMSFVLPSVILVTAHNL-FWDFSYYESL  3270

Query  3664  MTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYY  3723
              + ++  +T      ++  ++     ++ +  + R      +     +  +L +   V  
Sbjct  3271  QSIVENTNTMFLPVDMQGVMLTVFCFIVFVTYSVRFFTCKQSWFSLAVTTILVIFNMVKI  3330

Query  3724  GNALDQA----------ISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITG  3773
                 D+           ++M  +I+S+T+    VV     +A  IV +CV   P  F++ 
Sbjct  3331  FGTSDEPWTENQIAFCFVNMLTMIVSLTTKDWMVVIASYRIAYYIV-VCV--MPSAFVSD  3387

Query  3774  -NTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPK  3832
                ++CI +VY   GY   CY+G+   +NR+  +T GVY + VS  E +YM +  L  PK
Sbjct  3388  FGFMKCISIVYMACGYLFCCYYGILYWVNRFTCMTCGVYQFTVSAAELKYMTANNLSAPK  3447

Query  3833  NSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCV  3892
             N+ DA  L+ KL+GVGGK  IK++TVQSK++++KCT+VVLL +L ++ VES+SK W  CV
Sbjct  3448  NAYDAMILSAKLIGVGGKRNIKISTVQSKLTEMKCTNVVLLGLLSKMHVESNSKEWNYCV  3507

Query  3893  QLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLP  3952
              LHN+I L  D     EK+++L++  LS     D+++L E   +N   LQ++AS +++LP
Sbjct  3508  GLHNEINLCDDPEIVLEKLLALIAFFLSKHNTCDLSELIESYFENTTILQSVASAYAALP  3567

Query  3953  SYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQM  4012
             S+ A   A+   E+A  N  S  +LK+L K+ N+AKS+F+R+A++Q+KL+KMA+QA   M
Sbjct  3568  SWIALEKARADLEEAKKNDVSPQILKQLTKAFNIAKSDFEREASVQKKLDKMAEQAAASM  3627

Query  4013  YKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMV  4072
             YK+AR+ D+++K+ SAM ++LF ML+KLD  ++N II+ AR+G +PL+IIP  +A +L+V
Sbjct  3628  YKEARAVDRKSKIVSAMHSLLFGMLKKLDMSSVNTIIDQARNGVLPLSIIPAASATRLVV  3687

Query  4073  VIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALR  4132
             + P    +          YA A+W I +V DA+   V L E++  N  NL WPL +T  R
Sbjct  3688  ITPSLEVFSKIRQENNVHYAGAIWTIVEVKDANGSHVHLKEVTAANELNLTWPLSITCER  3747

Query  4133  ANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLK  4192
                  KLQNNE+ P  L++ +  A  T       +  A   +  G  F+ A ++   +LK
Sbjct  3748  ---TTKLQNNEIMPGKLKERAVRASATLDGEAFGSGKALMASESGKSFMYAFIASDNNLK  3804

Query  4193  WARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL  4252
             + ++  ++    I  ELE P RF  D   GP+VKYLYF+K LN L RG VLG + ATVRL
Sbjct  3805  YVKWESNN--DIIPIELEAPLRFYVDGANGPEVKYLYFVKNLNTLRRGAVLGYIGATVRL  3862

Query  4253  QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTP  4312
             QAG  TE P+NS++L+ CAF+ D AKAY D +  G QP+ NCVKML    G G A+T   
Sbjct  3863  QAGKPTEHPSNSSLLTLCAFSPDPAKAYVDAVKRGMQPVNNCVKMLSNGAGNGMAVTNGV  3922

Query  4313  EANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTV  4372
             EAN  Q+S+GGAS C+YCRCH++HP   G C  KGK+VQIPT    DP+ F ++N VC V
Sbjct  3923  EANTQQDSYGGASVCIYCRCHVEHPAIDGLCRYKGKFVQIPTG-TQDPIRFCIENEVCVV  3981

Query  4373  CGMWKGYGCSCDQLREPMLQSADAQSFLN  4401
             CG W   GC CD  R  M      QS+LN
Sbjct  3982  CGCWLNNGCMCD--RTSMQSFTVDQSYLN  4008


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/288 (24%), Positives = 123/288 (43%), Gaps = 38/288 (13%)

Query  986   QTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADI  1045
             + V QQ   E+N+++  +  ++  P+ +  + P  +  +++ + G L +  N        
Sbjct  1293  EKVEQQPIVEENKSSIEKEEIQ-SPKNDDLILPFYKAGKLSFYQGALDVLINF-------  1344

Query  1046  VEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVL  1105
                   ++P V+VNAAN  LKH GGVA A++  T   +   S DY+  N  +  G +   
Sbjct  1345  ------LEPDVIVNAANGDLKHMGGVARAIDVFTGGKLTERSKDYLKKNKSIAPGNAVFF  1398

Query  1106  SGHNLAKH--CLHVVGPNVNKGEDIQLLKSAYENFNQHE-VLLAPLLSAGIFGADPIHSL  1162
                N+ +H   L+ VGP          L + Y+   + E  +L PL+S GIF        
Sbjct  1399  --ENVIEHLSVLNAVGPRNGDSRVEAKLCNVYKAIAKCEGKILTPLISVGIF--------  1448

Query  1163  RVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKI--AEIPKEEVKPFITESKP  1220
                   VR    L    K + D+ ++ F+    E+Q  +      IP    +  +   + 
Sbjct  1449  -----NVRLETSLQCLLKTVNDRGLNVFVYTDQERQTIENFFSCSIPVNVTEDNVNHERV  1503

Query  1221  SVEQRKQDDKKIKACV----EEVTTTLEETKFLTENLLLYIDINGNLH  1264
             SV   K   +++K  V    ++VT  L     + + ++  IDI+   H
Sbjct  1504  SVSFDKTYGEQLKGTVVIKDKDVTNQLPSAFDVGQKVIKAIDIDWQAH  1551


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 95/235 (40%), Gaps = 34/235 (14%)

Query  1656  WKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALIL  1715
             +K   +NG   +K  DNNC++      LQ  +  FN     +A+ + + G+  +F  L  
Sbjct  1075  FKTTNLNGKIILKQGDNNCWINACCYQLQAFDF-FN----NEAWEKFKKGDVMDFVNLCY  1129

Query  1716  AYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
             A      G  GD    +  +    +  + K VL   C  CG+++  L+   AV  +  L 
Sbjct  1130  AATTLARGHSGDAEYLLELMLN--DYSTAKIVLAAKCG-CGEKEIVLE--RAVFKLTPLK  1184

Query  1776  YEQFKKGVQIPC----TCGKQATKY-------LVQQESPFVMMSAPPAQYELKHGTFTCA  1824
              E F  GV   C    TC   + +        ++ +++P  M    P  + +        
Sbjct  1185  -ESFNYGVCGDCMQVNTCRFLSVEGSGVFVHDILSKQTPEAMFVVKPVMHAV--------  1235

Query  1825  SEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKP  1879
               YTG  Q GHY  +   E  YC+DG +  K  + +   + +F   N  T   KP
Sbjct  1236  --YTGTTQNGHY-MVDDIEHGYCVDG-MGIKPLKKRCYTSTLFINANVMTRAEKP  1286


 Score = 40.8 bits (94),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 103/455 (23%), Positives = 149/455 (33%), Gaps = 96/455 (21%)

Query  144  DLGDELGTDPYEDFQENWNTKHSSGVTREL-MRELNGGAYTRYVDNNFCGPDGYPL--EC  200
            DL   L T+P    Q      + +GV  +  ++    G    YVD   CG DG P+    
Sbjct  71   DLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKIARTGRGAIYVDQYMCGADGKPVIEGD  130

Query  201  IKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLA  260
             KD                D I+ +   Y C       AW T R EK    QT F I+  
Sbjct  131  FKDYFGDE-----------DIIEFEGEEYHC-------AWTTVRDEKPLNQQTLFTIQEI  172

Query  261  KKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVY-----PVASPNECNQM  315
            +    +N + P+   P N   + + P V+K          + +Y     P     +C   
Sbjct  173  Q----YNLDIPH-KLP-NCATRHVAPPVKKNSKIVLSEDYKKLYDIFGSPFMGNGDCLSK  226

Query  316  CLSTL------MKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIY  369
            C  TL      ++C  CG  S   GD+       CG     K G T     P +AVV   
Sbjct  227  CFDTLHFIAATLRCP-CGSESSGVGDWTGFKTACCGLSGKVK-GVTLGDIKPGDAVV---  281

Query  370  CPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASA  429
                                     T +  G     F  CV  Y G     + W  +   
Sbjct  282  -------------------------TSMSAGKGVKFFANCVLQYAGDVEGVSIW--KVIK  314

Query  430  NIGCNHTGVVGEGSEGLNDNLLEILQKEKVNIN-----IVGDFKLNEEIAIILASFSAST  484
                + T V   G EG  ++ ++   K  V  +     I GD        II      ST
Sbjct  315  TFTVDET-VCTPGFEGELNDFIKPESKSLVACSVKRAFITGDIDDAVHDCIITGKLDLST  373

Query  485  SAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQ---------KSILSPLYA  535
            + F     GL +K     V+ CG   V        AW + E+         K I   + +
Sbjct  374  NLFGNV--GLLFKKTPWFVQKCGALFVD-------AWKVVEELCGSLTLTYKQIYEVVAS  424

Query  536  FASEAARVVRSIFSRTLETAQNSVRVLQKAAITIL  570
              + A  +V   +  T     N V+ L    + +L
Sbjct  425  LCTSAFTIVN--YKPTFVVPDNRVKDLVDKCVKVL  457


 Score = 37.0 bits (84),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 107/286 (37%), Gaps = 29/286 (10%)

Query  1567  TIKVFTTVDNINLHTQVVDMSMTYGQQF-GPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             +I V  T DN+N     V    TYG+Q  G   +   DVT   P     G+         
Sbjct  1488  SIPVNVTEDNVNHERVSVSFDKTYGEQLKGTVVIKDKDVTNQLPSAFDVGQKVI-----K  1542

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSI--KWADNNCYLATALLTL  1683
              + ++   +Y   D +      SA +H   +K+  V     I  K  DNNC++    L L
Sbjct  1543  AIDIDWQAHYGFRDAAAF----SASSH-DAYKFEVVTHSNFIVHKQTDNNCWINAICLAL  1597

Query  1684  QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS  1743
             Q+++ ++  P ++  +      +   F  ++        GE GD  E M +       + 
Sbjct  1598  QRLKPQWKFPGVRGLWNEFLERKTQGFVHMLYHISGVKKGEPGDA-ELMLHKLGDLMDND  1656

Query  1744  CKRVL--NVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQE  1801
             C+ ++     C  C + +  +  V A      L+      G    C  G      + Q +
Sbjct  1657  CEIIVTHTTACDKCAKVEKFVGPVVA----APLAIH----GTDETCVHGVSVNVKVTQIK  1708

Query  1802  SPFVMMS--APPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETL  1845
                 + S   P     L+   + C   Y+G+ + GHY +  ++  L
Sbjct  1709  GTVAITSLIGPIIGEVLEATGYIC---YSGSNRNGHYTYYDNRNGL  1751


> sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus 
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2
Length=6709

 Score = 1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/2235 (33%), Positives = 1139/2235 (51%), Gaps = 151/2235 (7%)

Query  2214  SFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNS  2273
             + NY++  N   L   I   LLL + L    Y   ++ V+         C+G  + Y NS
Sbjct  1903  TLNYVRQLNKPALWRYIKLVLLL-IALYHFFYLFVSIPVVHK-----LACSGSVQAYSNS  1956

Query  2274  TNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWD----LTAFGLVAEWFL  2329
             + V  +  C  SI C  CL+  D L  +  L+      S   W+    L+ F  +A +  
Sbjct  1957  SFVK-SEVCGNSILCKACLASYDELADFDHLQVSWDYKSDPLWNRVIQLSYFIFLAVFGN  2015

Query  2330  AYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFAS  2389
              Y+     ++V   +  + L+ SYF   ++  SW +    ++V    IS    + +    
Sbjct  2016  NYVRCLLMYFV---SQYLNLWLSYFG--YVKYSWFL----HVVNFESISVEFVIIVVVFK  2066

Query  2390  FYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHN  2449
                  K   H+   CN+ +C  C K  R TR+    +VNG  ++ YV+ANG    CK HN
Sbjct  2067  AVLALK---HIFLPCNNPSCKTCSKIARQTRIPIQVVVNGSMKTVYVHANGTGKLCKKHN  2123

Query  2450  WNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLY-----  2504
             + C NCD++    TFI DE+ RDLS   K+ +  TD+S   V  V   +G    Y     
Sbjct  2124  FYCKNCDSYGFDHTFICDEIVRDLSNSIKQTVYATDRSYQEVTKVECTDGFYRFYVGEEF  2183

Query  2505  ----FDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVY  2560
                 +D   +K   +  L     LD+    N  GS                +S ++  VY
Sbjct  2184  TAYDYDVKHKKYSSQEVLKTMFLLDDFIVYNPSGS--------------SLASVRNVCVY  2229

Query  2561  YSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAEL  2620
             +SQL+ +PI +++  L+ D+  S +    +F+A  N   ++FNV + + K L      E 
Sbjct  2230  FSQLIGRPIKIVNSELLEDL--SVDFKGALFNAKKNVIKNSFNVDVSECKNL-----EEC  2282

Query  2621  AKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNK-  2679
              K  +LD   STF  A                     +H+  I +T  S NN+  +  K 
Sbjct  2283  YKLCNLDVTFSTFEMAINN------------------AHRFGILITDRSFNNFWPSKIKP  2324

Query  2680  -VENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNL  2738
                 ++  D+G C+   A+ +NA+V      +++W  +DF +LS   +K +     +  +
Sbjct  2325  GSSGVSAMDIGKCMTFDAKIVNAKVLTQRGKSVVWLSQDFSTLSSTAQKVLVKTFVEEGV  2384

Query  2739  PFKLTCATTRQVVNV----VTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVH  2794
              F LT        ++     T  ++ K G    + LKQL ++    +    ++ L +   
Sbjct  2385  NFSLTFNAVGSDEDLPYERFTESVSAKSGSGFFDVLKQLKQLFWCLVLFITLYGLCSVYS  2444

Query  2795  VMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSY-TNDKACPL  2853
             V ++    S+E   Y  I  GV +    +  C  N +  F  WF  + G   T DK+CP+
Sbjct  2445  VATQSYIDSAEGYDYMVIKNGVVQSFDDSINCVHNTYKGFAVWFKAKHGFVPTFDKSCPI  2504

Query  2854  IAAVITREVGFV--VPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATS  2911
             +   +  ++G +  +P +P  +     G  L F       V N+CY  +      +    
Sbjct  2505  VLGTVF-DLGNMRPIPDVPAYVALV--GRSLVFAINAAFGVTNVCYDHTGAAVSKNSYFD  2561

Query  2912  ACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEG  2971
              CV  + CT      G  V YC    ++EG+  Y  L PD  Y    G++++ P      
Sbjct  2562  TCVFNSACTTLTGIGGTVV-YCAKQGLVEGAKLYSELLPDYYYEHASGNMVKIPAIIRSF  2620

Query  2972  SVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMF  3031
              +R V T  + YCR G C  S+AG C      +V + ++     G  CG   +    N+F
Sbjct  2621  GLRFVKTQATTYCRVGECTESQAGFCFGGDNWFVYDKEFG---DGYICGSSTLGFFKNVF  2677

Query  3032  TPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTV  3091
                   +  +  S +++A  ++A +   + Y  ++F++ FG+        TLL +M    
Sbjct  2678  ALFNSNMSVVATSGAMLANIVIACLAIAVCYGVLKFKKIFGDC-------TLLVVMIIVT  2730

Query  3092  LCLTPVYSFLPG--VYSVIYLYLTFYLTNDVSFLAHIQ--WMVMFTPLVPFWITIAYIIC  3147
             L +  V  F+     + ++Y  + ++ T  +++   +   +++ +  + P+++ + YI+ 
Sbjct  2731  LVVNNVSYFVTQNTFFMIVYAIIYYFTTRKLAYPGVLDAGFIIAYLNMAPWYVLVLYIMV  2790

Query  3148  ISTKHFYWFFSNYLKRRV---VFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQ  3203
                   Y    +  K +V   +F G  F  +FE AA+ TF+++   Y  L +     L +
Sbjct  2791  F----LYDSLPSLFKLKVTTNLFEGDKFVGSFESAAMGTFVIDMRSYETLVNST--SLDR  2844

Query  3204  YNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ  3263
                Y   +NKYKY++G+M    YR A   HL KAL D+S S +D+LY PP  S+ S  LQ
Sbjct  2845  IKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVSRNDMLYTPPTVSVNST-LQ  2903

Query  3264  SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR  3323
             SG RKMA PSG VE C+V+V  G   LNGLWL D V CPRHVI +    +  NYE+ L  
Sbjct  2904  SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSS  2962

Query  3324  KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG  3383
                HNF +   N  L V+    +   L LKV+  NP TP++KF  ++PG++F++LACY G
Sbjct  2963  VRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEG  3022

Query  3384  SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN  3443
              P  VY   MR   TIKGSF+ G+CGSVG+ ++   + F YMHH+EL  G H G++LEG 
Sbjct  3023  CPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGE  3082

Query  3444  FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE  3503
              YG + D+ + Q  GT+   + NV+A+LYAA+ING+RWF+   + TL  +N  A   ++ 
Sbjct  3083  MYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFT  3142

Query  3504  PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC  3563
              +     D    L+A+TG +V  +   +  L   G  GRTIL    L DEFTP +V+RQ 
Sbjct  3143  EIVS--TDAFNMLAAKTGYSVEKLLECIVRL-NKGFGGRTILSYGSLCDEFTPTEVIRQM  3199

Query  3564  SGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLY------ENAFLPFAMG  3617
              GV  QS   ++I          ++T++ +L     + L FF+Y         F+   + 
Sbjct  3200  YGVNLQSGKVKSI-------FYPMMTAIAILFA---FWLEFFMYTPFTWINPTFVSVVLA  3249

Query  3618  IIAM-SAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSG  3676
             I  + S   +  +KHK  F   F++PS+      N+V+   ++   +   ++ V+T+   
Sbjct  3250  ITTLVSVLLVAGIKHKMLFFMSFVMPSVILATAHNVVW-DMTYYESLQVLVENVNTTFLP  3308

Query  3677  FKLKDCVMYASAVVLLILMTAR------TVYDDGARRVWTLMNVLTLVYKVYYGNALDQ-  3729
               ++  ++    VV+ ++ T R      + +   A  ++ + N++ L+  +      D  
Sbjct  3309  VDMQGVMLALFCVVVFVICTIRFFTCKQSWFSLFATTIFVMFNIVKLLGMIGEPWTDDHF  3368

Query  3730  ---AISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFL  3786
                 ++M  ++IS+T+    VV     +A  IV   ++  P F      ++C+ ++Y   
Sbjct  3369  LLCLVNMLTMLISLTTKDWFVVFASYKVAYYIVVYVMQ--PAFVQDFGFVKCVSIIYMAC  3426

Query  3787  GYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLG  3846
             GY   CY+G+   +NR+  +T GVY + VS  E +YM +  L  PK + DA  L+ KL+G
Sbjct  3427  GYLFCCYYGILYWVNRFTCMTCGVYQFTVSPAELKYMTANNLSAPKTAYDAMILSFKLMG  3486

Query  3847  VGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTE  3906
             +GG   IK++TVQSK++++KCT+VVLL +L ++ VES+SK W  CV LHN+I L  D   
Sbjct  3487  IGGGRNIKISTVQSKLTEMKCTNVVLLGLLSKMHVESNSKEWNYCVGLHNEINLCDDPDA  3546

Query  3907  AFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQ  3966
               EK+++L++  LS     D++ L E   +N   LQ++AS +++LPS+ A+  A+   E+
Sbjct  3547  VLEKLLALIAFFLSKHNTCDLSDLIESYFENTTILQSVASAYAALPSWIAYEKARADLEE  3606

Query  3967  AVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVT  4026
             A  N  S  +LK+L K+ N+AKSEF+R+A++Q+KL+KMA+QA   MYK+AR+ D+++K+ 
Sbjct  3607  AKKNDVSPQLLKQLTKACNIAKSEFEREASVQKKLDKMAEQAAASMYKEARAVDRKSKIV  3666

Query  4027  SAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDG  4086
             SAM ++LF ML+KLD  ++N II  AR+G +PL+IIP  +A +L+VV P+          
Sbjct  3667  SAMHSLLFGMLKKLDMSSVNTIIEQARNGVLPLSIIPAASATRLIVVTPNLEVLSKVRQE  3726

Query  4087  TTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSP  4146
                 YA A+W I +V DA+   V L E++  N  N+ WPL +T  R     KLQNNE+ P
Sbjct  3727  NNVHYAGAIWSIVEVKDANGAQVHLKEVTAANELNITWPLSITCER---TTKLQNNEILP  3783

Query  4147  VALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIY  4206
               L++ +  A  T       +  A   +  G  F+ A ++   +LK+ ++  ++    I 
Sbjct  3784  GKLKEKAVKASATIDGDAYGSGKALMASEGGKSFIYAFIASDSNLKYVKWESNN--DVIP  3841

Query  4207  TELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTV  4266
              ELE P RF  D   GP+VKYLYF+K LN L RG VLG + ATVRLQAG  TE P+NS +
Sbjct  3842  IELEAPLRFYVDGVNGPEVKYLYFVKSLNTLRRGAVLGYIGATVRLQAGKPTEHPSNSGL  3901

Query  4267  LSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASC  4326
             L+ CAFA D AKAY D +  G QP+TNCVKML    G G AIT   E+N  Q+S+GGAS 
Sbjct  3902  LTLCAFAPDPAKAYVDAVKRGMQPVTNCVKMLSNGAGNGMAITNGVESNTQQDSYGGASV  3961

Query  4327  CLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQL  4386
             C+YCRCH++HP   G C  KGK+VQ+PT    DP+ F ++N VC VCG W   GC CD  
Sbjct  3962  CIYCRCHVEHPAIDGLCRFKGKFVQVPTG-TQDPIRFCIENEVCVVCGCWLTNGCMCD--  4018

Query  4387  REPMLQSADAQSFLN  4401
             R  +  +   QS+LN
Sbjct  4019  RTSIQGTTIDQSYLN  4033


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/231 (24%), Positives = 105/231 (45%), Gaps = 27/231 (12%)

Query  1052  VKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA  1111
             ++P V+VNAAN  L+H GGVA A++  T   +   S +Y+ ++  +  G + +    N+ 
Sbjct  1356  LEPDVLVNAANGDLRHVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLF--ENVL  1413

Query  1112  KH--CLHVVGPNVNKGEDIQLLKSAYENFNQHE-VLLAPLLSAGIFGADPIHSLRVCVDT  1168
             +H   L+ VGP          L + Y+   + +  +L PL+S GIF              
Sbjct  1414  EHLSVLNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIF-------------K  1460

Query  1169  VRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKI--AEIPKEEVKPFITESKPSVEQRK  1226
             V+  V L    K + D+ ++ F+    E+   +      IP +  +  + + + SV   K
Sbjct  1461  VKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNGTIPIKVTEDTVNQKRVSVALDK  1520

Query  1227  QDDKKIKACV----EEVTTTLEETKFLTENLLLYIDINGNLH---PDSATL  1270
                +++K  V    ++VT  L     + E ++  +D++ N +   P++A  
Sbjct  1521  TYGEQLKGTVVIKDKDVTNQLPSVSDVGEKVVKALDVDWNAYYGFPNAAAF  1571


 Score = 44.7 bits (104),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 80/198 (40%), Gaps = 14/198 (7%)

Query  1567  TIKVFTTVDNINLHTQVVDMSMTYGQQF-GPTYLDGADVTKIKPHNSHEGKTFYVLPNDD  1625
             TI +  T D +N     V +  TYG+Q  G   +   DVT   P  S  G+         
Sbjct  1499  TIPIKVTEDTVNQKRVSVALDKTYGEQLKGTVVIKDKDVTNQLPSVSDVGEKVV-----K  1553

Query  1626  TLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQV--NGLTSIKWADNNCYLATALLTL  1683
              L V+   YY   + +      SA +H   +++  V  N     K  DNNC++    L L
Sbjct  1554  ALDVDWNAYYGFPNAAAF----SASSH-DAYEFDVVTHNNFIVHKQTDNNCWVNAICLAL  1608

Query  1684  QQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDS  1743
             Q+++  +  P ++  +      + A F  ++      T G+ GD   T+  L    + DS
Sbjct  1609  QRLKPTWKFPGVKSLWDAFLTRKTAGFVHMLYHISGLTKGQPGDAELTLHKLVDLMSSDS  1668

Query  1744  CKRVLN-VVCKTCGQQQT  1760
                V +   C  C + +T
Sbjct  1669  AVTVTHTTACDKCAKVET  1686


 Score = 42.4 bits (98),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 71/277 (26%), Positives = 109/277 (39%), Gaps = 26/277 (9%)

Query  1656  WKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALIL  1715
             +K   +NG   +K  DNNC++      LQ  +  FN   L D + +       +FC   L
Sbjct  1099  FKTTNLNGKIILKQQDNNCWINACCYQLQAFDF-FNHD-LWDGFKKDDVMPFVDFCYAAL  1156

Query  1716  AYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLS  1775
                    G+   + ETM   +  A     K  L+  C  CG ++  L   E  ++  T  
Sbjct  1157  TLKQGDSGDAEYLLETMLNDYSTA-----KVTLSAKCG-CGVKEIVL---ERTVFKLTPL  1207

Query  1776  YEQFKKGVQIPCTCGKQATKYLVQQESPFVM----MSAPPAQYELKHGTFTCASEYTGNY  1831
               +FK GV   C          V+    FV        P +Q+ +   T T  + YTG  
Sbjct  1208  RNEFKYGVCGDCKQINMCKFASVEGSGVFVHDRIEKQTPVSQFIV---TPTMHAVYTGTT  1264

Query  1832  QCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYT----TTIKPVTYKLDGV  1887
             Q GHY  I      YC+DG +  K  ++K   + +F   N  T    T ++P     D  
Sbjct  1265  QSGHY-MIEDCIHDYCVDG-MGIKPRKHKFYTSTLFLNANVMTAKSKTMVEPPVPVEDKC  1322

Query  1888  VCTEIDPK--LDNYYKKDNSYFTEQPIDLVPNQPYPN  1922
             V     PK  +  +YK     F +  +D++ N   P+
Sbjct  1323  VEDCQSPKDLILPFYKAGKVSFYQGDLDVLINFLEPD  1359


 Score = 37.4 bits (85),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 83/234 (35%), Gaps = 34/234 (15%)

Query  144  DLGDELGTDPYEDFQENWNTKHSSGVTREL-MRELNGGAYTRYVDNNFCGPDGYPLECIK  202
            DL   L T+P    Q      + +GV  +  ++    G    YVD   CG DG P+    
Sbjct  71   DLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKFARTGNGAIYVDQYMCGADGKPV----  126

Query  203  DLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKK  262
                          E  D+   +  V      E+  AW T R EK    QT   I+  + 
Sbjct  127  -----------IEGEFKDYFGDE-DVIIYEGEEYHCAWLTVRDEKPLWQQTLLTIREIQ-  173

Query  263  FDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPV-ASPNECNQMCLSTLM  321
               +N + P+   P N  I+ + P V+K          R +Y +  SP   N   L+T  
Sbjct  174  ---YNLDIPH-KLP-NCAIREVAPPVKKNSKVVLSEEYRKLYDIFGSPFMGNGDSLNTCF  228

Query  322  KCDH---------CGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVV  366
               H         CG  S   GD+       CG     K G T     P +A+V
Sbjct  229  DSLHFIAATLKCPCGAESSGVGDWTGFKTACCGLHGKVK-GVTLGAVKPGDAIV  281


> sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=1a PE=3 
SV=1
Length=3951

 Score = 1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/2443 (32%), Positives = 1219/2443 (50%), Gaps = 239/2443 (10%)

Query  2080  ANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIA  2139
             A N +K+ +++G   +     ++    + KPN L R+  +   A  G + V +     I 
Sbjct  1626  AENFVKMGDKIGGVTMGLWRAEH----LNKPN-LERIFNIAKKAIVGSSVVTTQCGKLIG  1680

Query  2140  NYAKPFLNKVVSTTTNIVTRCLNRVC--------TNYMPYFF-TLLLQLCTFTRSTNSRI  2190
               A    +KV       +T  +  +C            P F  TL+  L  F +++   +
Sbjct  1681  KAATFIADKVGGGVVRNITDSIKGLCGITRGHFERKMSPQFLKTLMFFLFYFLKASVKSV  1740

Query  2191  KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL  2250
              AS  T + K  + ++                      +I+WF+  S     ++++   +
Sbjct  1741  VASYKTVLCKVVLATL----------------------LIVWFVYTS---NPVMFTGIRV  1775

Query  2251  GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQIT  2310
                +  L   S C  Y++   +S +V    YC     C VCL   DSL  Y    +++  
Sbjct  1776  ---LDFLFEGSLCGPYKDYGKDSFDVL--RYCADDFICRVCLHDKDSLHLYKHAYSVEQV  1830

Query  2311  ISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAIMQLFFSYFAVHFISNSWLMWLI  2368
                      A G +  W   Y++F   F   V G   I      Y   + + NS ++   
Sbjct  1831  YKD-----AASGFIFNWNWLYLVFLILFVKPVAGFVII-----CYCVKYLVLNSTVLQTG  1880

Query  2369  INLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVVDGCNSSTCMMCYKRNRATRVEC  2423
             +  +    +  +   + F  + +Y W  Y     VH +  C   TC +C +  R+ R E 
Sbjct  1881  VCFLDWF-VQTVFSHFNFMGAGFYFWLFYKIYIQVHHILYCKDVTCEVCKRVARSNRQEV  1939

Query  2424  TTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINP  2483
             + +V G ++  +VY N G  FCK HNW C NCD +   +TF+S EVA +LS + KR + P
Sbjct  1940  SVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQNTFMSPEVAGELSEKLKRHVKP  1999

Query  2484  TDQSSYIVDSVTVKNGSIHLYFDKAGQ-KTYERHSLSHFVNLDNLR-ANNTKGSLPINVI  2541
             T  + ++VD   + +  ++L +  A   K     ++  F   D L+ A   K +L    I
Sbjct  2000  TAYAYHVVDEACLVDDFVNLKYKAATPGKDSASSAVKCFSVTDFLKKAVFLKEALKCEQI  2059

Query  2542  VFDGKSKCEESSA------KSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYV  2595
               DG   C   SA      K+A++YY+Q +C+PIL+LDQAL        ++ V+      
Sbjct  2060  SNDGFIVCNTQSAHALEEAKNAAIYYAQYLCKPILILDQALYE------QLVVE------  2107

Query  2596  NTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECL  2655
                      P+ K  +++    + L+  +S+D     + +   +  + S  + ++ V+  
Sbjct  2108  ---------PVSK--SVIDKVCSILSSIISVDTAALNYKAGTLRDALLSITKDEEAVDMA  2156

Query  2656  KLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACIDCSARHINAQVAKSHNIALIWN  2714
                H  D++ TGD   N + +Y      +TPRD G  I+  A   N +V  +  +  +W 
Sbjct  2157  IFCHNHDVDYTGDGFTNVIPSYGIDTGKLTPRDRGFLINADASIANLRVKNAPPV--VWK  2214

Query  2715  VKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL--KGGKIVN---NW  2769
               + + LS+   K + SA  K+ + F +T +  +QV+   T K+ +  K G IV+     
Sbjct  2215  FSELIKLSDSCLKYLISATVKSGVRFFITKSGAKQVIACHTQKLLVEKKAGGIVSGTFKC  2274

Query  2770  LKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDFSS--EIIGYKAIDGGVTRDIAS  2822
              K   K  L+F  LF A     +Y+      +    D +S   + G+K ID GV R+I  
Sbjct  2275  FKSYFKWLLIFYILFTACCSGYYYMEVSKSFVHPMYDVNSTLHVEGFKVIDKGVLREIVP  2334

Query  2823  TDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNG-DF  2881
              DTCF+NK  +FD ++   G  Y N + CP++ AVI  + G V  G+PG +    +G  F
Sbjct  2335  EDTCFSNKFVNFDAFW---GRPYDNSRNCPIVTAVIDGD-GTVATGVPGFVSWVMDGVMF  2390

Query  2882  LH---------FLPRVFSA--VGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPV  2930
             +H         ++P  F+   VG   YT   +I    F TS  + +A C ++  AS  P 
Sbjct  2391  IHMTQTERKPWYIPTWFNREIVG---YTQDSIITEGSFYTSIALFSARC-LYLTASNTPQ  2446

Query  2931  PYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
              YC++  N   G++ + S+ P   Y   +G  +  P   L     V    DS YCR   C
Sbjct  2447  LYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQILHTPYVVKFVSDS-YCRGSVC  2505

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             E +  G CVS + +WVL ND Y S PGVFCG     L+ +M +     +   +I   +  
Sbjct  2506  EYTRPGYCVSLNPQWVLFNDEYTSKPGVFCGSTVRELMFSMVSTFFTGVNP-NIYMQLAT  2564

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
               ++ +VV  +    ++F+  F  Y+  V    L+++++  +LC+    S L  +  V+Y
Sbjct  2565  MFLILVVVVLIFAMVIKFQGVFKAYATTVFITMLVWVINAFILCVHSYNSVLAVILLVLY  2624

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAYIICISTKHFYWFFSNYLKRRVV  3166
              Y +   + +   + H   +  F  +VP W+    + +II + T  F W +      R +
Sbjct  2625  CYASLVTSRNTVIIMHCWLVFTFGLIVPTWLACCYLGFIIYMYTPLFLWCYGTTKNTRKL  2684

Query  3167  FNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTS  3225
             ++G  F   ++ AA  TF++    ++KL +++     ++  YL+ Y + KY+SG      
Sbjct  2685  YDGNEFVGNYDLAAKSTFVIRGSEFVKLTNEIG---DKFEAYLSAYARLKYYSGTGSEQD  2741

Query  3226  YREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTC  3285
             Y +A    LA AL+ + NSG +++Y PP+ SI  + LQSGF+K+  PS  VE C+V V+ 
Sbjct  2742  YLQACRAWLAYALDQYRNSGVEIVYTPPRYSIGVSRLQSGFKKLVSPSSAVEKCIVSVSY  2801

Query  3286  GTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGN-VQLRVIGH  3343
                 LNGLWL D +YCPRHV+   S D  N    D+L   +NH F V   + V L V+  
Sbjct  2802  RGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLNLANNHEFEVTTQHGVTLNVVSR  2857

Query  3344  SMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSF  3403
              ++  VL L+   AN +TPKYKF++   G +F++   Y G+  G+Y   MR N TI+ SF
Sbjct  2858  RLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYGGTVVGLYPVTMRSNGTIRASF  2917

Query  3404  LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI  3463
             L G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G FYG +VD + AQ    D  +
Sbjct  2918  LAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVDEEVAQRVPPDNLV  2977

Query  3464  TVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPL  3516
             T N++AWLYAA+I+         +W L   T +++D+N  A    + P +      +  L
Sbjct  2978  TNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYNKWAGDNGFTPFSTSTA--ITKL  3034

Query  3517  SAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
             SA TG+   D+C  L+ ++   +   G  ILG    EDE TP  V  Q  GV  QS+  R
Sbjct  3035  SAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFEDELTPESVFNQIGGVRLQSSFVR  3091

Query  3575  TIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKH  3631
                 +  W   +L   L  L  +V  T   L F++Y    L  A+  I+ +      VKH
Sbjct  3092  KAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFT------VKH  3144

Query  3632  KHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRIMTWLDMV--DTSL--------  3674
               A++  FLLP+L TV     A    +Y  + +  V+ +  W D V  DT +        
Sbjct  3145  VMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLV  3204

Query  3675  --SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAI  3731
               + FK ++ C M +    LL+L     +       ++T  N LT   +   GN      
Sbjct  3205  LYTAFKCVQGCYMNSFNTSLLMLYQFVKL----GFVIYTSSNTLTAYTE---GN------  3251

Query  3732  SMWALII-----SVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFL  3786
               W L       +V +N S      +F+ +   +M + YC   ++    L  +M V C +
Sbjct  3252  --WELFFELVHTTVLANVSSNSLIGLFVFKCAKWM-LYYCNATYLNNYVLMAVM-VNC-I  3306

Query  3787  GYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLG  3846
             G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM    + PPK   + F  NI + G
Sbjct  3307  GWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQG  3366

Query  3847  VGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTE  3906
             +GG   + +ATVQ+K+SDVKCT+VVL+ +L +L VE++SK+    V+LHN IL + D  E
Sbjct  3367  IGGDRVLPIATVQAKLSDVKCTTVVLMQLLTKLNVEANSKMHVYLVELHNKILASDDVGE  3426

Query  3907  AFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQ  3966
               + ++ +L  L  +   +D+++ C+++L     LQ++  EFS +PSYA +  A+  YE+
Sbjct  3427  CMDNLLGMLITLFCIDSTIDLSEYCDDILKRSTVLQSVTQEFSHIPSYAEYERAKNLYEK  3486

Query  3967  AVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKR  4022
              + +    G ++  L   +K+ N+AKS FDRD A+Q+KL+ MA++AMT MYK+AR  D+R
Sbjct  3487  VLVDSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLDSMAERAMTTMYKEARVTDRR  3546

Query  4023  AKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKN  4082
             AK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +P+  + KL +VIPD  T+  
Sbjct  3547  AKLVSSLHALLFSMLKKIDSEKLNVLFDQASSGVVPLATVPIVCSNKLTLVIPDPETWVK  3606

Query  4083  TCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----NSPNLAWPLIVTALRANS--  4135
               +G   TY++ +W I  V+DAD   +  +          +  N+AWPL V   R     
Sbjct  3607  CVEGVHVTYSTVVWNIDTVIDADGTELHPTSTGSGLTYCISGANIAWPLKVNLTRNGHNK  3666

Query  4136  -AVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
               V LQNNEL P  ++  +C AG  Q  C+ ++   YY    G   V A+ S   +LK A
Sbjct  3667  VDVVLQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTNISGNSVVAAITSSNPNLKVA  3725

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
              F    G   IY +L+PPC+F        +V YLYFIK   ++ RGMVLG+++  V LQ+
Sbjct  3726  SFLNEAGN-QIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQS  3784

Query  4255  -GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
              G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ NCVKML  H G+G AIT  P 
Sbjct  3785  KGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPS  3844

Query  4314  ANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
                DQ+S+GGAS CLYCR HI HP    N  G C  KG +VQIPTT   DPVGF L+N V
Sbjct  3845  PTPDQDSYGGASVCLYCRAHIAHPGSVGNLDGRCQFKGSFVQIPTT-EKDPVGFCLRNKV  3903

Query  4370  CTVCGMWKGYGCSCDQLREPM--LQSADAQS-----FLNGFAV  4405
             CTVC  W GYGC CD LR+P   +QS    S     +LNG+ V
Sbjct  3904  CTVCQCWIGYGCQCDSLRQPKSSVQSVAGASDFDKNYLNGYGV  3946


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 107/243 (44%), Gaps = 15/243 (6%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  Y     V      +  + +  YV   D ++  
Sbjct  1180  IYLTEDGVKYRSIVLKPGDSLGQ-FGQVYAKNKIV--FTADDVEDKEILYVPTTDKSI--  1234

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
                EYY      ++  Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1235  --LEYYGLDAQKYV-IYLQTL--AQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKIR  1289

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A C   VG+  D    ++ L +H + D     L 
Sbjct  1290  FK-GFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLK  1348

Query  1749  -NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM  1806
               V C  CG +   L+G+EA +  +   +   FK       TCG   T  +++   P+++
Sbjct  1349  KRVSC-NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLL  1407

Query  1807  MSA  1809
             + A
Sbjct  1408  LFA  1410


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query  985   QQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQ---TIEVNSFSGYLKLTDNVYIK  1041
             ++ V Q+DG++  Q    + I  V+PQ E +         T E   F  Y     ++ + 
Sbjct  971   EEVVSQKDGAQIKQ----EPIQVVKPQREKKAKKFKVKPATCEKPKFLEYKTCVGDLTVV  1026

Query  1042  NADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGG  1101
              A  ++E K+     +VNAAN ++ HG GVA A+            +DY+  +GP +   
Sbjct  1027  IAKALDEFKEF---CIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHGPQQ---  1080

Query  1102  SCVLSGHNLAKHCL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADP  1158
               V         C+ +VVGP        + L +AY+N     V+  + P+LS GIFG D 
Sbjct  1081  RLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVD-  1139

Query  1159  IHSLRVCVDTVR  1170
                 ++ +D +R
Sbjct  1140  ---FKMSIDAMR  1148


> sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=1a PE=1 SV=1
Length=3951

 Score = 1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/2443 (32%), Positives = 1219/2443 (50%), Gaps = 239/2443 (10%)

Query  2080  ANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIA  2139
             A N +K+ +++G   +     ++    + KPN L R+  +   A  G + V +     I 
Sbjct  1626  AENFVKMGDKIGGVTMGLWRAEH----LNKPN-LERIFNIAKKAIVGSSVVTTQCGKLIG  1680

Query  2140  NYAKPFLNKVVSTTTNIVTRCLNRVC--------TNYMPYFF-TLLLQLCTFTRSTNSRI  2190
               A    +KV       +T  +  +C            P F  TL+  L  F +++   +
Sbjct  1681  KAATFIADKVGGGVVRNITDSIKGLCGITRGHFERKMSPQFLKTLMFFLFYFLKASVKSV  1740

Query  2191  KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL  2250
              AS  T + K  + ++                      +I+WF+  S     ++++   +
Sbjct  1741  VASYKTVLCKVVLATL----------------------LIVWFVYTS---NPVMFTGIRV  1775

Query  2251  GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQIT  2310
                +  L   S C  Y++   +S +V    YC     C VCL   DSL  Y    +++  
Sbjct  1776  ---LDFLFEGSLCGPYKDYGKDSFDVL--RYCADDFICRVCLHDKDSLHLYKHAYSVEQV  1830

Query  2311  ISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAIMQLFFSYFAVHFISNSWLMWLI  2368
                      A G +  W   Y++F   F   V G   I      Y   + + NS ++   
Sbjct  1831  YKD-----AASGFIFNWNWLYLVFLILFVKPVAGFVII-----CYCVKYLVLNSTVLQTG  1880

Query  2369  INLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVVDGCNSSTCMMCYKRNRATRVEC  2423
             +  +    +  +   + F  + +Y W  Y     VH +  C   TC +C +  R+ R E 
Sbjct  1881  VCFLDWF-VQTVFSHFNFMGAGFYFWLFYKIYIQVHHILYCKDVTCEVCKRVARSNRQEV  1939

Query  2424  TTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINP  2483
             + +V G ++  +VY N G  FCK HNW C NCD +   +TF+S EVA +LS + KR + P
Sbjct  1940  SVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQNTFMSPEVAGELSEKLKRHVKP  1999

Query  2484  TDQSSYIVDSVTVKNGSIHLYFDKAGQ-KTYERHSLSHFVNLDNLR-ANNTKGSLPINVI  2541
             T  + ++VD   + +  ++L +  A   K     ++  F   D L+ A   K +L    I
Sbjct  2000  TAYAYHVVDEACLVDDFVNLKYKAATPGKDSASSAVKCFSVTDFLKKAVFLKEALKCEQI  2059

Query  2542  VFDGKSKCEESSA------KSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYV  2595
               DG   C   SA      K+A++YY+Q +C+PIL+LDQAL        ++ V+      
Sbjct  2060  SNDGFIVCNTQSAHALEEAKNAAIYYAQYLCKPILILDQALYE------QLVVE------  2107

Query  2596  NTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECL  2655
                      P+ K  +++    + L+  +S+D     + +   +  + S  + ++ V+  
Sbjct  2108  ---------PVSK--SVIDKVCSILSSIISVDTAALNYKAGTLRDALLSITKDEEAVDMA  2156

Query  2656  KLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACIDCSARHINAQVAKSHNIALIWN  2714
                H  D++ TGD   N + +Y      +TPRD G  I+  A   N +V  +  +  +W 
Sbjct  2157  IFCHNHDVDYTGDGFTNVIPSYGIDTGKLTPRDRGFLINADASIANLRVKNAPPV--VWK  2214

Query  2715  VKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL--KGGKIVN---NW  2769
               + + LS+   K + SA  K+ + F +T +  +QV+   T K+ +  K G IV+     
Sbjct  2215  FSELIKLSDSCLKYLISATVKSGVRFFITKSGAKQVIACHTQKLLVEKKAGGIVSGTFKC  2274

Query  2770  LKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDFSS--EIIGYKAIDGGVTRDIAS  2822
              K   K  L+F  LF A     +Y+      +    D +S   + G+K ID GV R+I  
Sbjct  2275  FKSYFKWLLIFYILFTACCSGYYYMEVSKSFVHPMYDVNSTLHVEGFKVIDKGVLREIVP  2334

Query  2823  TDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNG-DF  2881
              DTCF+NK  +FD ++   G  Y N + CP++ AVI  + G V  G+PG +    +G  F
Sbjct  2335  EDTCFSNKFVNFDAFW---GRPYDNSRNCPIVTAVIDGD-GTVATGVPGFVSWVMDGVMF  2390

Query  2882  LH---------FLPRVFSA--VGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPV  2930
             +H         ++P  F+   VG   YT   +I    F TS  + +A C ++  AS  P 
Sbjct  2391  IHMTQTERKPWYIPTWFNREIVG---YTQDSIITEGSFYTSIALFSARC-LYLTASNTPQ  2446

Query  2931  PYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
              YC++  N   G++ + S+ P   Y   +G  +  P   L     V    DS YCR   C
Sbjct  2447  LYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQILHTPYVVKFVSDS-YCRGSVC  2505

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             E +  G CVS + +WVL ND Y S PGVFCG     L+ +M +     +   +I   +  
Sbjct  2506  EYTRPGYCVSLNPQWVLFNDEYTSKPGVFCGSTVRELMFSMVSTFFTGVNP-NIYMQLAT  2564

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
               ++ +VV  +    ++F+  F  Y+  V    L+++++  +LC+    S L  +  V+Y
Sbjct  2565  MFLILVVVVLIFAMVIKFQGVFKAYATTVFITMLVWVINAFILCVHSYNSVLAVILLVLY  2624

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAYIICISTKHFYWFFSNYLKRRVV  3166
              Y +   + +   + H   +  F  +VP W+    + +II + T  F W +      R +
Sbjct  2625  CYASLVTSRNTVIIMHCWLVFTFGLIVPTWLACCYLGFIIYMYTPLFLWCYGTTKNTRKL  2684

Query  3167  FNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTS  3225
             ++G  F   ++ AA  TF++    ++KL +++     ++  YL+ Y + KY+SG      
Sbjct  2685  YDGNEFVGNYDLAAKSTFVIRGSEFVKLTNEIG---DKFEAYLSAYARLKYYSGTGSEQD  2741

Query  3226  YREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTC  3285
             Y +A    LA AL+ + NSG +++Y PP+ SI  + LQSGF+K+  PS  VE C+V V+ 
Sbjct  2742  YLQACRAWLAYALDQYRNSGVEIVYTPPRYSIGVSRLQSGFKKLVSPSSAVEKCIVSVSY  2801

Query  3286  GTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGN-VQLRVIGH  3343
                 LNGLWL D +YCPRHV+   S D  N    D+L   +NH F V   + V L V+  
Sbjct  2802  RGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLNLANNHEFEVTTQHGVTLNVVSR  2857

Query  3344  SMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSF  3403
              ++  VL L+   AN +TPKYKF++   G +F++   Y G+  G+Y   MR N TI+ SF
Sbjct  2858  RLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYGGTVVGLYPVTMRSNGTIRASF  2917

Query  3404  LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI  3463
             L G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G FYG +VD + AQ    D  +
Sbjct  2918  LAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVDEEVAQRVPPDNLV  2977

Query  3464  TVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPL  3516
             T N++AWLYAA+I+         +W L   T +++D+N  A    + P +      +  L
Sbjct  2978  TNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYNKWAGDNGFTPFSTSTA--ITKL  3034

Query  3517  SAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
             SA TG+   D+C  L+ ++   +   G  ILG    EDE TP  V  Q  GV  QS+  R
Sbjct  3035  SAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFEDELTPESVFNQIGGVRLQSSFVR  3091

Query  3575  TIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKH  3631
                 +  W   +L   L  L  +V  T   L F++Y    L  A+  I+ +      VKH
Sbjct  3092  KAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFT------VKH  3144

Query  3632  KHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRIMTWLDMV--DTSL--------  3674
               A++  FLLP+L TV     A    +Y  + +  V+ +  W D V  DT +        
Sbjct  3145  VMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLV  3204

Query  3675  --SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAI  3731
               + FK ++ C M +    LL+L     +       ++T  N LT   +   GN      
Sbjct  3205  LYTAFKCVQGCYMNSFNTSLLMLYQFVKL----GFVIYTSSNTLTAYTE---GN------  3251

Query  3732  SMWALII-----SVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFL  3786
               W L       +V +N S      +F+ +   +M + YC   ++    L  +M V C +
Sbjct  3252  --WELFFELVHTTVLANVSSNSLIGLFVFKCAKWM-LYYCNATYLNNYVLMAVM-VNC-I  3306

Query  3787  GYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLG  3846
             G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM    + PPK   + F  NI + G
Sbjct  3307  GWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQG  3366

Query  3847  VGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTE  3906
             +GG   + +ATVQ+K+SDVKCT+VVL+ +L +L VE++SK+    V+LHN IL + D  E
Sbjct  3367  IGGDRVLPIATVQAKLSDVKCTTVVLMQLLTKLNVEANSKMHVYLVELHNKILASDDVGE  3426

Query  3907  AFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQ  3966
               + ++ +L  L  +   +D+++ C+++L     LQ++  EFS +PSYA +  A+  YE+
Sbjct  3427  CMDNLLGMLITLFCIDSTIDLSEYCDDILKRSTVLQSVTQEFSHIPSYAEYERAKNLYEK  3486

Query  3967  AVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKR  4022
              + +    G ++  L   +K+ N+AKS FDRD A+Q+KL+ MA++AMT MYK+AR  D+R
Sbjct  3487  VLVDSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLDSMAERAMTTMYKEARVTDRR  3546

Query  4023  AKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKN  4082
             AK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +P+  + KL +VIPD  T+  
Sbjct  3547  AKLVSSLHALLFSMLKKIDSEKLNVLFDQASSGVVPLATVPIVCSNKLTLVIPDPETWVK  3606

Query  4083  TCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----NSPNLAWPLIVTALRANS--  4135
               +G   TY++ +W I  V+DAD   +  +          +  N+AWPL V   R     
Sbjct  3607  CVEGVHVTYSTVVWNIDTVIDADGTELHPTSTGSGLTYCISGANIAWPLKVNLTRNGHNK  3666

Query  4136  -AVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
               V LQNNEL P  ++  +C AG  Q  C+ ++   YY    G   V A+ S   +LK A
Sbjct  3667  VDVVLQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTNISGNSVVAAITSSNPNLKVA  3725

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
              F    G   IY +L+PPC+F        +V YLYFIK   ++ RGMVLG+++  V LQ+
Sbjct  3726  SFLNEAGN-QIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQS  3784

Query  4255  -GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
              G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ NCVKML  H G+G AIT  P 
Sbjct  3785  KGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPS  3844

Query  4314  ANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
                DQ+S+GGAS CLYCR HI HP    N  G C  KG +VQIPTT   DPVGF L+N V
Sbjct  3845  PTPDQDSYGGASVCLYCRAHIAHPGSVGNLDGRCQFKGSFVQIPTT-EKDPVGFCLRNKV  3903

Query  4370  CTVCGMWKGYGCSCDQLREPM--LQSADAQS-----FLNGFAV  4405
             CTVC  W GYGC CD LR+P   +QS    S     +LNG+ V
Sbjct  3904  CTVCQCWIGYGCQCDSLRQPKSSVQSVAGASDFDKNYLNGYGV  3946


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 107/243 (44%), Gaps = 15/243 (6%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  Y     V      +  + +  YV   D ++  
Sbjct  1180  IYLTEDGVKYRSIVLKPGDSLGQ-FGQVYAKNKIV--FTADDVEDKEILYVPTTDKSI--  1234

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
                EYY      ++  Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1235  --LEYYGLDAQKYV-IYLQTL--AQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKIR  1289

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A C   VG+  D    ++ L +H + D     L 
Sbjct  1290  FK-GFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLK  1348

Query  1749  -NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM  1806
               V C  CG +   L+G+EA +  +   +   FK       TCG   T  +++   P+++
Sbjct  1349  KRVSC-NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLL  1407

Query  1807  MSA  1809
             + A
Sbjct  1408  LFA  1410


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query  985   QQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQ---TIEVNSFSGYLKLTDNVYIK  1041
             ++ V Q+DG++  Q    + I  V+PQ E +         T E   F  Y     ++ + 
Sbjct  971   EEVVSQKDGAQIKQ----EPIQVVKPQREKKAKKFKVKPATCEKPKFLEYKTCVGDLTVV  1026

Query  1042  NADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGG  1101
              A  ++E K+     +VNAAN ++ HG GVA A+            +DY+  +GP +   
Sbjct  1027  IAKALDEFKEF---CIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHGPQQ---  1080

Query  1102  SCVLSGHNLAKHCL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADP  1158
               V         C+ +VVGP        + L +AY+N     V+  + P+LS GIFG D 
Sbjct  1081  RLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVD-  1139

Query  1159  IHSLRVCVDTVR  1170
                 ++ +D +R
Sbjct  1140  ---FKMSIDAMR  1148


> sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=1a PE=1 SV=1
Length=3953

 Score = 1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 757/2283 (33%), Positives = 1156/2283 (51%), Gaps = 199/2283 (9%)

Query  2229  IIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPC  2288
             +I+WF+  S     ++++   +   +  L   S C  Y +   +S +V    YC G   C
Sbjct  1759  LIVWFIYTS---NPVVFTGIRV---LDFLFEGSLCGPYNDYGKDSFDVL--RYCAGDFTC  1810

Query  2289  SVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAI  2346
              VCL   DSL  Y    +++           A G+   W   Y++F   F   V G   I
Sbjct  1811  RVCLHDRDSLHLYKHAYSVEQIYKD-----AASGINFNWNWLYLVFLILFVKPVAGFVII  1865

Query  2347  MQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVV  2401
                   Y   + + +S ++   +  +    +  +   + F  + +Y W  Y     VH +
Sbjct  1866  -----CYCVKYLVLSSTVLQTGVGFLDWF-VKTVFTHFNFMGAGFYFWLFYKIYVQVHHI  1919

Query  2402  DGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAG  2461
               C   TC +C +  R+ R E + +V G ++  +VY N G  FCK HNW C NCD +   
Sbjct  1920  LYCKDVTCEVCKRVARSNRQEVSVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQ  1979

Query  2462  STFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKA-GQKTYERHSLSH  2520
             +TF+S EVA +LS + KR + PT  + ++V    V +  ++L +  A   K     ++  
Sbjct  1980  NTFMSPEVAGELSEKLKRHVKPTAYAYHVVYEACVVDDFVNLKYKAAIPGKDNASSAVKC  2039

Query  2521  FVNLDNLR-ANNTKGSLPINVIVFDGKSKCEESSA------KSASVYYSQLMCQPILLLD  2573
             F   D L+ A   K +L    I  DG   C   SA      K+A+VYY+Q +C+PIL+LD
Sbjct  2040  FSVTDFLKKAVFLKEALKCEQISNDGFIVCNTQSAHALEEAKNAAVYYAQYLCKPILILD  2099

Query  2574  QALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTF  2633
             QAL                     +      P+ K  +++    + L+  +S+D     +
Sbjct  2100  QAL---------------------YEQLIVEPVSK--SVIDKVCSILSNIISVDTAALNY  2136

Query  2634  ISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACI  2692
              +   +  + S  + ++ V+     H  ++E TGD   N + +Y    + +TPRD G  I
Sbjct  2137  KAGTLRDALLSITKDEEAVDMAIFCHNHEVEYTGDGFTNVIPSYGMDTDKLTPRDRGFLI  2196

Query  2693  DCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVN  2752
             +  A   N +V  +  +  +W   D + LS+   K + SA  K+   F +T +  +QV++
Sbjct  2197  NADASIANLRVKNAPPV--VWKFSDLIKLSDSCLKYLISATVKSGGRFFITKSGAKQVIS  2254

Query  2753  VVTTKIAL--KGGKIVNN---WLKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDF  2802
               T K+ +  K G ++NN   W     K   VF  LF A     +Y+      +    D 
Sbjct  2255  CHTQKLLVEKKAGGVINNTFKWFMSCFKWLFVFYILFTACCLGYYYMEMNKSFVHPMYDV  2314

Query  2803  SS--EIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITR  2860
             +S   + G+K ID GV R+I S D CF+NK  +FD ++   G SY N+K CP++  VI  
Sbjct  2315  NSTLHVEGFKVIDKGVIREIVSEDNCFSNKFVNFDAFW---GKSYENNKNCPIVTVVIDG  2371

Query  2861  EVGFVVPGLPGTILRTTNG-DFLH---------FLPRVFSA--VGNICYTPSKLIEYTDF  2908
             + G V  G+PG +    +G  F+H         ++P  F+   VG   YT   +I    F
Sbjct  2372  D-GTVAVGVPGFVSWVMDGVMFVHMTQTDRRPWYIPTWFNREIVG---YTQDSIITEGSF  2427

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNT  2967
              TS  + +A C ++  AS  P  YC++  N   G++ + S+ P   Y   +G  +  P  
Sbjct  2428  YTSIALFSARC-LYLTASNTPQLYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQ  2486

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
              L     V    DS YCR   CE ++ G CVS   +WVL ND Y S PGVFCG     L+
Sbjct  2487  ILHTPYIVKFVSDS-YCRGSVCEYTKPGYCVSLDSQWVLFNDEYISKPGVFCGSTVRELM  2545

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
              NM +     +   +I   +    ++ +V+  +    ++F+  F  Y+ +V    L++++
Sbjct  2546  FNMVSTFFTGVNP-NIYIQLATMFLILVVIVLIFAMVIKFQGVFKAYATIVFTIMLVWVI  2604

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAY  3144
             +  VLC+    S L  +  V+Y Y +   + + + + H   +  F  +VP W+    + +
Sbjct  2605  NAFVLCVHSYNSVLAVILLVLYCYASMVTSRNTAIIMHCWLVFTFGLIVPTWLACCYLGF  2664

Query  3145  IICISTKHFYWFFSNYLKRRVVFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQ  3203
             I+ + T   +W +      R +++G  F   ++ AA  TF++    ++KL +++     +
Sbjct  2665  ILYMYTPLVFWCYGTTKNTRKLYDGNEFVGNYDLAAKSTFVIRGTEFVKLTNEIG---DK  2721

Query  3204  YNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ  3263
             +  YL+ Y + KY+SG      Y +A    LA AL+ + NSG +V+Y PP+ SI  + LQ
Sbjct  2722  FEAYLSAYARLKYYSGTGSEQDYLQACRAWLAYALDQYRNSGVEVVYTPPRYSIGVSRLQ  2781

Query  3264  SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR  3323
             +GF+K+  PS  VE C+V V+     LNGLWL D +YCPRHV+          + D+L  
Sbjct  2782  AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL  2838

Query  3324  KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN  3382
              +NH F V   N V L V+   ++  VL L+   AN +TPKYKFV+   G +F++   Y 
Sbjct  2839  ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG  2898

Query  3383  GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG  3442
             G+  G+Y   MR N TI+ SFL G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G
Sbjct  2899  GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG  2958

Query  3443  NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVIN-------GDRWFLNRFTTTLNDFNL  3495
              FYG +VD + AQ    D  +T N++AWLYAA+I+         +W L   T ++ D+N 
Sbjct  2959  EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNR  3017

Query  3496  VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE  3553
              A    + P +      +  LSA TG+   D+C  L+ ++       +  ILG    EDE
Sbjct  3018  WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE  3072

Query  3554  FTPFDVVRQCSGVTFQSAVKRTIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENA  3610
              TP  V  Q  GV  QS+  R    +  W   +L   L  L  +V  T   L F+++   
Sbjct  3073  LTPESVFNQVGGVRLQSSFVRKAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVHAAV  3131

Query  3611  FLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRI  3663
              L  A+  I+ +      VKH  A++  FLLP+L TV     A    +Y  + +  V+ +
Sbjct  3132  ILLMAVLFISFT------VKHVMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFL  3185

Query  3664  MTWLDMV--DTSL----------SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWT  3710
               W D V  DT +          + FK ++ C M +    LL+L     +       ++T
Sbjct  3186  SQWYDPVVFDTMVPWMLLPLVLYTAFKCVQGCYMNSFNTSLLMLYQFMKL----GFVIYT  3241

Query  3711  LMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVE----YC  3766
               N LT   +   GN        W L   +         +   L   IVF C +    YC
Sbjct  3242  SSNTLTAYTE---GN--------WELFFELVHTIVLANVSSNSLIGLIVFKCAKWMLYYC  3290

Query  3767  PIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQ  3826
                +     L  +M+    +G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM   
Sbjct  3291  NATYFNNYVLMAVMV--NGIGWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLH  3348

Query  3827  GLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSK  3886
              + PPK   + F  NI + G+GG   + +ATVQSK+SDVKCT+VVL+ +L +L VE++SK
Sbjct  3349  KVNPPKTVWEVFTTNILIQGIGGDRVLPIATVQSKLSDVKCTTVVLMQLLTKLNVEANSK  3408

Query  3887  LWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIAS  3946
             + A  V+LHN IL + D  E  + ++ +L  L  +   +D+ + C+++L     LQ++  
Sbjct  3409  MHAYLVELHNKILASDDVGECMDNLLGMLITLFCIDSTIDLGEYCDDILKRSTVLQSVTQ  3468

Query  3947  EFSSLPSYAAFATAQEAYEQAVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE  4002
             EFS +PSYA +  A+  YE+ +A+    G ++  L   +K+ N+AKS FDRD A+Q+KL+
Sbjct  3469  EFSHIPSYAEYERAKSIYEKVLADSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLD  3528

Query  4003  KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII  4062
              MA++AMT MYK+AR  D+RAK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +
Sbjct  3529  SMAERAMTTMYKEARVTDRRAKLVSSLHALLFSMLKKIDSEKLNVLFDQANSGVVPLATV  3588

Query  4063  PLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----  4117
             P+  + KL +VIPD  T+    +G   TY++ +W I  V DAD   +  +          
Sbjct  3589  PIVCSNKLTLVIPDPETWVKCVEGVHVTYSTVVWNIDCVTDADGTELHPTSTGSGLTYCI  3648

Query  4118  NSPNLAWPLIVTALRANS---AVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNT  4174
             +  N+AWPL V   R       V LQNNEL P  ++  +C AG  Q  C+ ++   YY +
Sbjct  3649  SGDNIAWPLKVNLTRNGHNKVDVALQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTS  3707

Query  4175  TKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGL  4234
               G   V A+ S   +LK A F    G   IY +L+PPC+F        +V YLYFIK  
Sbjct  3708  ISGSSVVAAITSSNPNLKVASFLNEAGN-QIYVDLDPPCKFGMKVGDKVEVVYLYFIKNT  3766

Query  4235  NNLNRGMVLGSLAATVRLQA-GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITN  4293
              ++ RGMVLG+++  V LQ+ G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ N
Sbjct  3767  RSIVRGMVLGAISNVVVLQSKGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGN  3826

Query  4294  CVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKY  4349
             CVKML  H G+G AIT  P    DQ+S+GGAS CLYCR HI HP    N  G C  KG +
Sbjct  3827  CVKMLTVHNGSGFAITSKPSPTPDQDSYGGASVCLYCRAHIAHPGGAGNLDGRCQFKGSF  3886

Query  4350  VQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREP-------MLQSADAQSFLNG  4402
             VQIPTT   DPVGF L+N VCTVC  W GYGC CD LR+P        + S   +++LNG
Sbjct  3887  VQIPTT-EKDPVGFCLRNKVCTVCQCWIGYGCQCDSLRQPKPSVQSVAVASGFDKNYLNG  3945

Query  4403  FAV  4405
             + V
Sbjct  3946  YGV  3948


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/242 (24%), Positives = 108/242 (45%), Gaps = 13/242 (5%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  +   A    +   +  E K    +P  D   +
Sbjct  1182  IYLTEDGVKYRSVVLKPGDSLGQ-FGQVF---ARNKVVFSADDVEDKEILFIPTTDKTIL  1237

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
             E    Y+  D      Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1238  E----YYGLDAQKYVTYLQTL--AQKWDVQYRDNFVILEWRDGNCWISSAIVLLQAAKIR  1291

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A CN  VG+  D    ++ L +H + D    +L 
Sbjct  1292  FK-GFLAEAWAKLLGGDPTDFVAWCYASCNAKVGDFSDANWLLANLAEHFDADYTNALLK  1350

Query  1749  NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               V   CG +   L+G+EA +  +   +   FK       TCG  +T  +++   P++++
Sbjct  1351  KCVSCNCGVKSYELRGLEACIQPVRAPNLLHFKTQYSNCPTCGASSTDEVIEASLPYLLL  1410

Query  1808  SA  1809
              A
Sbjct  1411  FA  1412


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 80/180 (44%), Gaps = 28/180 (16%)

Query  1009  QPQLEMELTPVVQ---------------TIEVNSFSGYLKLTDNVYIKNADIVEEAKKVK  1053
             +PQ+E E T VV+               T E   F  Y     ++ +  A  ++E K+  
Sbjct  981   EPQVEQEPTLVVKAQREKKAKKFKVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEF-  1039

Query  1054  PTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH  1113
                +VNAAN ++ HGGGVA A+             DY+  +GP +     V         
Sbjct  1040  --CIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQ---KLVTPSFVKGIQ  1094

Query  1114  CL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADPIHSLRVCVDTVR  1170
             C+ +VVGP        + L +AY++     V+  + P+LS+GIFG D     ++ +D +R
Sbjct  1095  CVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVD----FKISIDAMR  1150


> sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep 
PE=3 SV=1
Length=6629

 Score = 1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/2420 (32%), Positives = 1209/2420 (50%), Gaps = 232/2420 (10%)

Query  2080  ANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIA  2139
             A N +K+ +++G   +     ++    + KPN L R+  +   A  G + V +     I 
Sbjct  1626  AENFVKMGDKIGGVTMGLWRAEH----LNKPN-LERIFNIAKKAIVGSSVVTTQCGKLIG  1680

Query  2140  NYAKPFLNKVVSTTTNIVTRCLNRVC--------TNYMPYFF-TLLLQLCTFTRSTNSRI  2190
               A    +KV       +T  +  +C            P F  TL+  L  F +++   +
Sbjct  1681  KAATFIADKVGGGVVRNITDSIKGLCGITRGHFERKMSPQFLKTLMFFLFYFLKASVKSV  1740

Query  2191  KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL  2250
              AS  T + K  + ++                      +I+WF+  S     ++++   +
Sbjct  1741  VASYKTVLCKVVLATL----------------------LIVWFVYTS---NPVMFTGIRV  1775

Query  2251  GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQIT  2310
                +  L   S C  Y++   +S +V    YC     C VCL   DSL  Y    +++  
Sbjct  1776  ---LDFLFEGSLCGPYKDYGKDSFDVL--RYCADDFICRVCLHDKDSLHLYKHAYSVEQV  1830

Query  2311  ISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAIMQLFFSYFAVHFISNSWLMWLI  2368
                      A G +  W   Y++F   F   V G   I      Y   + + NS ++   
Sbjct  1831  YKD-----AASGFIFNWNWLYLVFLILFVKPVAGFVII-----CYCVKYLVLNSTVLQTG  1880

Query  2369  INLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVVDGCNSSTCMMCYKRNRATRVEC  2423
             +  +    +  +   + F  + +Y W  Y     VH +  C   TC +C +  R+ R E 
Sbjct  1881  VCFLDWF-VQTVFSHFNFMGAGFYFWLFYKIYIQVHHILYCKDVTCEVCKRVARSNRQEV  1939

Query  2424  TTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINP  2483
             + +V G ++  +VY N G  FCK HNW C NCD +   +TF+S EVA +LS + KR + P
Sbjct  1940  SVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQNTFMSPEVAGELSEKLKRHVKP  1999

Query  2484  TDQSSYIVDSVTVKNGSIHLYFDKAGQ-KTYERHSLSHFVNLDNLR-ANNTKGSLPINVI  2541
             T  + ++VD   + +  ++L +  A   K     ++  F   D L+ A   K +L    I
Sbjct  2000  TAYAYHVVDEACLVDDFVNLKYKAATPGKDSASSAVKCFSVTDFLKKAVFLKEALKCEQI  2059

Query  2542  VFDGKSKCEESSA------KSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYV  2595
               DG   C   SA      K+A++YY+Q +C+PIL+LDQAL        ++ V+      
Sbjct  2060  SNDGFIVCNTQSAHALEEAKNAAIYYAQYLCKPILILDQALYE------QLVVE------  2107

Query  2596  NTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECL  2655
                      P+ K  +++    + L+  +S+D     + +   +  + S  + ++ V+  
Sbjct  2108  ---------PVSK--SVIDKVCSILSSIISVDTAALNYKAGTLRDALLSITKDEEAVDMA  2156

Query  2656  KLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACIDCSARHINAQVAKSHNIALIWN  2714
                H  D++ TGD   N + +Y      +TPRD G  I+  A   N +V  +  +  +W 
Sbjct  2157  IFCHNHDVDYTGDGFTNVIPSYGIDTGKLTPRDRGFLINADASIANLRVKNAPPV--VWK  2214

Query  2715  VKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL--KGGKIVN---NW  2769
               + + LS+   K + SA  K+ + F +T +  +QV+   T K+ +  K G IV+     
Sbjct  2215  FSELIKLSDSCLKYLISATVKSGVRFFITKSGAKQVIACHTQKLLVEKKAGGIVSGTFKC  2274

Query  2770  LKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDFSS--EIIGYKAIDGGVTRDIAS  2822
              K   K  L+F  LF A     +Y+      +    D +S   + G+K ID GV R+I  
Sbjct  2275  FKSYFKWLLIFYILFTACCSGYYYMEVSKSFVHPMYDVNSTLHVEGFKVIDKGVLREIVP  2334

Query  2823  TDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNG-DF  2881
              DTCF+NK  +FD ++   G  Y N + CP++ AVI  + G V  G+PG +    +G  F
Sbjct  2335  EDTCFSNKFVNFDAFW---GRPYDNSRNCPIVTAVIDGD-GTVATGVPGFVSWVMDGVMF  2390

Query  2882  LH---------FLPRVFSA--VGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPV  2930
             +H         ++P  F+   VG   YT   +I    F TS  + +A C ++  AS  P 
Sbjct  2391  IHMTQTERKPWYIPTWFNREIVG---YTQDSIITEGSFYTSIALFSARC-LYLTASNTPQ  2446

Query  2931  PYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
              YC++  N   G++ + S+ P   Y   +G  +  P   L     V    DS YCR   C
Sbjct  2447  LYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQILHTPYVVKFVSDS-YCRGSVC  2505

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             E +  G CVS + +WVL ND Y S PGVFCG     L+ +M +     +   +I   +  
Sbjct  2506  EYTRPGYCVSLNPQWVLFNDEYTSKPGVFCGSTVRELMFSMVSTFFTGVNP-NIYMQLAT  2564

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
               ++ +VV  +    ++F+  F  Y+  V    L+++++  +LC+    S L  +  V+Y
Sbjct  2565  MFLILVVVVLIFAMVIKFQGVFKAYATTVFITMLVWVINAFILCVHSYNSVLAVILLVLY  2624

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAYIICISTKHFYWFFSNYLKRRVV  3166
              Y +   + +   + H   +  F  +VP W+    + +II + T  F W +      R +
Sbjct  2625  CYASLVTSRNTVIIMHCWLVFTFGLIVPTWLACCYLGFIIYMYTPLFLWCYGTTKNTRKL  2684

Query  3167  FNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTS  3225
             ++G  F   ++ AA  TF++    ++KL +++     ++  YL+ Y + KY+SG      
Sbjct  2685  YDGNEFVGNYDLAAKSTFVIRGSEFVKLTNEIG---DKFEAYLSAYARLKYYSGTGSEQD  2741

Query  3226  YREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTC  3285
             Y +A    LA AL+ + NSG +++Y PP+ SI  + LQSGF+K+  PS  VE C+V V+ 
Sbjct  2742  YLQACRAWLAYALDQYRNSGVEIVYTPPRYSIGVSRLQSGFKKLVSPSSAVEKCIVSVSY  2801

Query  3286  GTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGN-VQLRVIGH  3343
                 LNGLWL D +YCPRHV+   S D  N    D+L   +NH F V   + V L V+  
Sbjct  2802  RGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLNLANNHEFEVTTQHGVTLNVVSR  2857

Query  3344  SMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSF  3403
              ++  VL L+   AN +TPKYKF++   G +F++   Y G+  G+Y   MR N TI+ SF
Sbjct  2858  RLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYGGTVVGLYPVTMRSNGTIRASF  2917

Query  3404  LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI  3463
             L G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G FYG +VD + AQ    D  +
Sbjct  2918  LAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVDEEVAQRVPPDNLV  2977

Query  3464  TVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPL  3516
             T N++AWLYAA+I+         +W L   T +++D+N  A    + P +      +  L
Sbjct  2978  TNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYNKWAGDNGFTPFSTSTA--ITKL  3034

Query  3517  SAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
             SA TG+   D+C  L+ ++   +   G  ILG    EDE TP  V  Q  GV  QS+  R
Sbjct  3035  SAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFEDELTPESVFNQIGGVRLQSSFVR  3091

Query  3575  TIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKH  3631
                 +  W   +L   L  L  +V  T   L F++Y    L  A+  I+ +      VKH
Sbjct  3092  KAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFT------VKH  3144

Query  3632  KHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRIMTWLDMV--DTSL--------  3674
               A++  FLLP+L TV     A    +Y  + +  V+ +  W D V  DT +        
Sbjct  3145  VMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLV  3204

Query  3675  --SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAI  3731
               + FK ++ C M +    LL+L     +       ++T  N LT   +   GN      
Sbjct  3205  LYTAFKCVQGCYMNSFNTSLLMLYQFVKL----GFVIYTSSNTLTAYTE---GN------  3251

Query  3732  SMWALII-----SVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFL  3786
               W L       +V +N S      +F+ +   +M + YC   ++    L  +M V C +
Sbjct  3252  --WELFFELVHTTVLANVSSNSLIGLFVFKCAKWM-LYYCNATYLNNYVLMAVM-VNC-I  3306

Query  3787  GYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLG  3846
             G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM    + PPK   + F  NI + G
Sbjct  3307  GWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQG  3366

Query  3847  VGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTE  3906
             +GG   + +ATVQ+K+SDVKCT+VVL+ +L +L VE++SK+    V+LHN IL + D  E
Sbjct  3367  IGGDRVLPIATVQAKLSDVKCTTVVLMQLLTKLNVEANSKMHVYLVELHNKILASDDVGE  3426

Query  3907  AFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQ  3966
               + ++ +L  L  +   +D+++ C+++L     LQ++  EFS +PSYA +  A+  YE+
Sbjct  3427  CMDNLLGMLITLFCIDSTIDLSEYCDDILKRSTVLQSVTQEFSHIPSYAEYERAKNLYEK  3486

Query  3967  AVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKR  4022
              + +    G ++  L   +K+ N+AKS FDRD A+Q+KL+ MA++AMT MYK+AR  D+R
Sbjct  3487  VLVDSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLDSMAERAMTTMYKEARVTDRR  3546

Query  4023  AKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKN  4082
             AK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +P+  + KL +VIPD  T+  
Sbjct  3547  AKLVSSLHALLFSMLKKIDSEKLNVLFDQASSGVVPLATVPIVCSNKLTLVIPDPETWVK  3606

Query  4083  TCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----NSPNLAWPLIVTALRANSA-  4136
               +G   TY++ +W I  V+DAD   +  +          +  N+AWPL V   R     
Sbjct  3607  CVEGVHVTYSTVVWNIDTVIDADGTELHPTSTGSGLTYCISGANIAWPLKVNLTRNGHNK  3666

Query  4137  --VKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
               V LQNNEL P  ++  +C AG  Q  C+ ++   YY    G   V A+ S   +LK A
Sbjct  3667  VDVVLQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTNISGNSVVAAITSSNPNLKVA  3725

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
              F    G   IY +L+PPC+F        +V YLYFIK   ++ RGMVLG+++  V LQ+
Sbjct  3726  SFLNEAGN-QIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQS  3784

Query  4255  -GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
              G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ NCVKML  H G+G AIT  P 
Sbjct  3785  KGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPS  3844

Query  4314  ANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
                DQ+S+GGAS CLYCR HI HP    N  G C  KG +VQIPTT   DPVGF L+N V
Sbjct  3845  PTPDQDSYGGASVCLYCRAHIAHPGSVGNLDGRCQFKGSFVQIPTT-EKDPVGFCLRNKV  3903

Query  4370  CTVCGMWKGYGCSCDQLREP  4389
             CTVC  W GYGC CD LR+P
Sbjct  3904  CTVCQCWIGYGCQCDSLRQP  3923


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 107/243 (44%), Gaps = 15/243 (6%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  Y     V      +  + +  YV   D ++  
Sbjct  1180  IYLTEDGVKYRSIVLKPGDSLGQ-FGQVYAKNKIV--FTADDVEDKEILYVPTTDKSI--  1234

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
                EYY      ++  Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1235  --LEYYGLDAQKYV-IYLQTL--AQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKIR  1289

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A C   VG+  D    ++ L +H + D     L 
Sbjct  1290  FK-GFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLK  1348

Query  1749  -NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM  1806
               V C  CG +   L+G+EA +  +   +   FK       TCG   T  +++   P+++
Sbjct  1349  KRVSC-NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLL  1407

Query  1807  MSA  1809
             + A
Sbjct  1408  LFA  1410


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query  985   QQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQ---TIEVNSFSGYLKLTDNVYIK  1041
             ++ V Q+DG++  Q    + I  V+PQ E +         T E   F  Y     ++ + 
Sbjct  971   EEVVSQKDGAQIKQ----EPIQVVKPQREKKAKKFKVKPATCEKPKFLEYKTCVGDLTVV  1026

Query  1042  NADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGG  1101
              A  ++E K+     +VNAAN ++ HG GVA A+            +DY+  +GP +   
Sbjct  1027  IAKALDEFKEF---CIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHGPQQ---  1080

Query  1102  SCVLSGHNLAKHCL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADP  1158
               V         C+ +VVGP        + L +AY+N     V+  + P+LS GIFG D 
Sbjct  1081  RLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVD-  1139

Query  1159  IHSLRVCVDTVR  1170
                 ++ +D +R
Sbjct  1140  ---FKMSIDAMR  1148


> sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 
SV=1
Length=6629

 Score = 1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/2420 (32%), Positives = 1209/2420 (50%), Gaps = 232/2420 (10%)

Query  2080  ANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIA  2139
             A N +K+ +++G   +     ++    + KPN L R+  +   A  G + V +     I 
Sbjct  1626  AENFVKMGDKIGGVTMGLWRAEH----LNKPN-LERIFNIAKKAIVGSSVVTTQCGKLIG  1680

Query  2140  NYAKPFLNKVVSTTTNIVTRCLNRVC--------TNYMPYFF-TLLLQLCTFTRSTNSRI  2190
               A    +KV       +T  +  +C            P F  TL+  L  F +++   +
Sbjct  1681  KAATFIADKVGGGVVRNITDSIKGLCGITRGHFERKMSPQFLKTLMFFLFYFLKASVKSV  1740

Query  2191  KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL  2250
              AS  T + K  + ++                      +I+WF+  S     ++++   +
Sbjct  1741  VASYKTVLCKVVLATL----------------------LIVWFVYTS---NPVMFTGIRV  1775

Query  2251  GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQIT  2310
                +  L   S C  Y++   +S +V    YC     C VCL   DSL  Y    +++  
Sbjct  1776  ---LDFLFEGSLCGPYKDYGKDSFDVL--RYCADDFICRVCLHDKDSLHLYKHAYSVEQV  1830

Query  2311  ISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAIMQLFFSYFAVHFISNSWLMWLI  2368
                      A G +  W   Y++F   F   V G   I      Y   + + NS ++   
Sbjct  1831  YKD-----AASGFIFNWNWLYLVFLILFVKPVAGFVII-----CYCVKYLVLNSTVLQTG  1880

Query  2369  INLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVVDGCNSSTCMMCYKRNRATRVEC  2423
             +  +    +  +   + F  + +Y W  Y     VH +  C   TC +C +  R+ R E 
Sbjct  1881  VCFLDWF-VQTVFSHFNFMGAGFYFWLFYKIYIQVHHILYCKDVTCEVCKRVARSNRQEV  1939

Query  2424  TTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINP  2483
             + +V G ++  +VY N G  FCK HNW C NCD +   +TF+S EVA +LS + KR + P
Sbjct  1940  SVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQNTFMSPEVAGELSEKLKRHVKP  1999

Query  2484  TDQSSYIVDSVTVKNGSIHLYFDKAGQ-KTYERHSLSHFVNLDNLR-ANNTKGSLPINVI  2541
             T  + ++VD   + +  ++L +  A   K     ++  F   D L+ A   K +L    I
Sbjct  2000  TAYAYHVVDEACLVDDFVNLKYKAATPGKDSASSAVKCFSVTDFLKKAVFLKEALKCEQI  2059

Query  2542  VFDGKSKCEESSA------KSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYV  2595
               DG   C   SA      K+A++YY+Q +C+PIL+LDQAL        ++ V+      
Sbjct  2060  SNDGFIVCNTQSAHALEEAKNAAIYYAQYLCKPILILDQALYE------QLVVE------  2107

Query  2596  NTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECL  2655
                      P+ K  +++    + L+  +S+D     + +   +  + S  + ++ V+  
Sbjct  2108  ---------PVSK--SVIDKVCSILSSIISVDTAALNYKAGTLRDALLSITKDEEAVDMA  2156

Query  2656  KLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACIDCSARHINAQVAKSHNIALIWN  2714
                H  D++ TGD   N + +Y      +TPRD G  I+  A   N +V  +  +  +W 
Sbjct  2157  IFCHNHDVDYTGDGFTNVIPSYGIDTGKLTPRDRGFLINADASIANLRVKNAPPV--VWK  2214

Query  2715  VKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL--KGGKIVN---NW  2769
               + + LS+   K + SA  K+ + F +T +  +QV+   T K+ +  K G IV+     
Sbjct  2215  FSELIKLSDSCLKYLISATVKSGVRFFITKSGAKQVIACHTQKLLVEKKAGGIVSGTFKC  2274

Query  2770  LKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDFSS--EIIGYKAIDGGVTRDIAS  2822
              K   K  L+F  LF A     +Y+      +    D +S   + G+K ID GV R+I  
Sbjct  2275  FKSYFKWLLIFYILFTACCSGYYYMEVSKSFVHPMYDVNSTLHVEGFKVIDKGVLREIVP  2334

Query  2823  TDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNG-DF  2881
              DTCF+NK  +FD ++   G  Y N + CP++ AVI  + G V  G+PG +    +G  F
Sbjct  2335  EDTCFSNKFVNFDAFW---GRPYDNSRNCPIVTAVIDGD-GTVATGVPGFVSWVMDGVMF  2390

Query  2882  LH---------FLPRVFSA--VGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPV  2930
             +H         ++P  F+   VG   YT   +I    F TS  + +A C ++  AS  P 
Sbjct  2391  IHMTQTERKPWYIPTWFNREIVG---YTQDSIITEGSFYTSIALFSARC-LYLTASNTPQ  2446

Query  2931  PYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTC  2989
              YC++  N   G++ + S+ P   Y   +G  +  P   L     V    DS YCR   C
Sbjct  2447  LYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQILHTPYVVKFVSDS-YCRGSVC  2505

Query  2990  ERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVA  3049
             E +  G CVS + +WVL ND Y S PGVFCG     L+ +M +     +   +I   +  
Sbjct  2506  EYTRPGYCVSLNPQWVLFNDEYTSKPGVFCGSTVRELMFSMVSTFFTGVNP-NIYMQLAT  2564

Query  3050  GGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIY  3109
               ++ +VV  +    ++F+  F  Y+  V    L+++++  +LC+    S L  +  V+Y
Sbjct  2565  MFLILVVVVLIFAMVIKFQGVFKAYATTVFITMLVWVINAFILCVHSYNSVLAVILLVLY  2624

Query  3110  LYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAYIICISTKHFYWFFSNYLKRRVV  3166
              Y +   + +   + H   +  F  +VP W+    + +II + T  F W +      R +
Sbjct  2625  CYASLVTSRNTVIIMHCWLVFTFGLIVPTWLACCYLGFIIYMYTPLFLWCYGTTKNTRKL  2684

Query  3167  FNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTS  3225
             ++G  F   ++ AA  TF++    ++KL +++     ++  YL+ Y + KY+SG      
Sbjct  2685  YDGNEFVGNYDLAAKSTFVIRGSEFVKLTNEIG---DKFEAYLSAYARLKYYSGTGSEQD  2741

Query  3226  YREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTC  3285
             Y +A    LA AL+ + NSG +++Y PP+ SI  + LQSGF+K+  PS  VE C+V V+ 
Sbjct  2742  YLQACRAWLAYALDQYRNSGVEIVYTPPRYSIGVSRLQSGFKKLVSPSSAVEKCIVSVSY  2801

Query  3286  GTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGN-VQLRVIGH  3343
                 LNGLWL D +YCPRHV+   S D  N    D+L   +NH F V   + V L V+  
Sbjct  2802  RGNNLNGLWLGDTIYCPRHVLGKFSGDQWN----DVLNLANNHEFEVTTQHGVTLNVVSR  2857

Query  3344  SMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSF  3403
              ++  VL L+   AN +TPKYKF++   G +F++   Y G+  G+Y   MR N TI+ SF
Sbjct  2858  RLKGAVLILQTAVANAETPKYKFIKANCGDSFTIACAYGGTVVGLYPVTMRSNGTIRASF  2917

Query  3404  LNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI  3463
             L G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G FYG +VD + AQ    D  +
Sbjct  2918  LAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMGEFYGGYVDEEVAQRVPPDNLV  2977

Query  3464  TVNVLAWLYAAVINGD-------RWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPL  3516
             T N++AWLYAA+I+         +W L   T +++D+N  A    + P +      +  L
Sbjct  2978  TNNIVAWLYAAIISVKESSFSLPKW-LESTTVSVDDYNKWAGDNGFTPFSTSTA--ITKL  3034

Query  3517  SAQTGIAVLDMCASLKELL--QNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKR  3574
             SA TG+   D+C  L+ ++   +   G  ILG    EDE TP  V  Q  GV  QS+  R
Sbjct  3035  SAITGV---DVCKLLRTIMVKNSQWGGDPILGQYNFEDELTPESVFNQIGGVRLQSSFVR  3091

Query  3575  TIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKH  3631
                 +  W   +L   L  L  +V  T   L F++Y    L  A+  I+ +      VKH
Sbjct  3092  KAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFT------VKH  3144

Query  3632  KHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRIMTWLDMV--DTSL--------  3674
               A++  FLLP+L TV     A    +Y  + +  V+ +  W D V  DT +        
Sbjct  3145  VMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLV  3204

Query  3675  --SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAI  3731
               + FK ++ C M +    LL+L     +       ++T  N LT   +   GN      
Sbjct  3205  LYTAFKCVQGCYMNSFNTSLLMLYQFVKL----GFVIYTSSNTLTAYTE---GN------  3251

Query  3732  SMWALII-----SVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFL  3786
               W L       +V +N S      +F+ +   +M + YC   ++    L  +M V C +
Sbjct  3252  --WELFFELVHTTVLANVSSNSLIGLFVFKCAKWM-LYYCNATYLNNYVLMAVM-VNC-I  3306

Query  3787  GYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLG  3846
             G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM    + PPK   + F  NI + G
Sbjct  3307  GWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQG  3366

Query  3847  VGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTE  3906
             +GG   + +ATVQ+K+SDVKCT+VVL+ +L +L VE++SK+    V+LHN IL + D  E
Sbjct  3367  IGGDRVLPIATVQAKLSDVKCTTVVLMQLLTKLNVEANSKMHVYLVELHNKILASDDVGE  3426

Query  3907  AFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQ  3966
               + ++ +L  L  +   +D+++ C+++L     LQ++  EFS +PSYA +  A+  YE+
Sbjct  3427  CMDNLLGMLITLFCIDSTIDLSEYCDDILKRSTVLQSVTQEFSHIPSYAEYERAKNLYEK  3486

Query  3967  AVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKR  4022
              + +    G ++  L   +K+ N+AKS FDRD A+Q+KL+ MA++AMT MYK+AR  D+R
Sbjct  3487  VLVDSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLDSMAERAMTTMYKEARVTDRR  3546

Query  4023  AKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKN  4082
             AK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +P+  + KL +VIPD  T+  
Sbjct  3547  AKLVSSLHALLFSMLKKIDSEKLNVLFDQASSGVVPLATVPIVCSNKLTLVIPDPETWVK  3606

Query  4083  TCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----NSPNLAWPLIVTALRANSA-  4136
               +G   TY++ +W I  V+DAD   +  +          +  N+AWPL V   R     
Sbjct  3607  CVEGVHVTYSTVVWNIDTVIDADGTELHPTSTGSGLTYCISGANIAWPLKVNLTRNGHNK  3666

Query  4137  --VKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWA  4194
               V LQNNEL P  ++  +C AG  Q  C+ ++   YY    G   V A+ S   +LK A
Sbjct  3667  VDVVLQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTNISGNSVVAAITSSNPNLKVA  3725

Query  4195  RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA  4254
              F    G   IY +L+PPC+F        +V YLYFIK   ++ RGMVLG+++  V LQ+
Sbjct  3726  SFLNEAGN-QIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQS  3784

Query  4255  -GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPE  4313
              G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ NCVKML  H G+G AIT  P 
Sbjct  3785  KGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPS  3844

Query  4314  ANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV  4369
                DQ+S+GGAS CLYCR HI HP    N  G C  KG +VQIPTT   DPVGF L+N V
Sbjct  3845  PTPDQDSYGGASVCLYCRAHIAHPGSVGNLDGRCQFKGSFVQIPTT-EKDPVGFCLRNKV  3903

Query  4370  CTVCGMWKGYGCSCDQLREP  4389
             CTVC  W GYGC CD LR+P
Sbjct  3904  CTVCQCWIGYGCQCDSLRQP  3923


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 107/243 (44%), Gaps = 15/243 (6%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  Y     V      +  + +  YV   D ++  
Sbjct  1180  IYLTEDGVKYRSIVLKPGDSLGQ-FGQVYAKNKIV--FTADDVEDKEILYVPTTDKSI--  1234

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
                EYY      ++  Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1235  --LEYYGLDAQKYV-IYLQTL--AQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKIR  1289

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A C   VG+  D    ++ L +H + D     L 
Sbjct  1290  FK-GFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLK  1348

Query  1749  -NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVM  1806
               V C  CG +   L+G+EA +  +   +   FK       TCG   T  +++   P+++
Sbjct  1349  KRVSC-NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLL  1407

Query  1807  MSA  1809
             + A
Sbjct  1408  LFA  1410


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query  985   QQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQ---TIEVNSFSGYLKLTDNVYIK  1041
             ++ V Q+DG++  Q    + I  V+PQ E +         T E   F  Y     ++ + 
Sbjct  971   EEVVSQKDGAQIKQ----EPIQVVKPQREKKAKKFKVKPATCEKPKFLEYKTCVGDLTVV  1026

Query  1042  NADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGG  1101
              A  ++E K+     +VNAAN ++ HG GVA A+            +DY+  +GP +   
Sbjct  1027  IAKALDEFKEF---CIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHGPQQ---  1080

Query  1102  SCVLSGHNLAKHCL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADP  1158
               V         C+ +VVGP        + L +AY+N     V+  + P+LS GIFG D 
Sbjct  1081  RLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVD-  1139

Query  1159  IHSLRVCVDTVR  1170
                 ++ +D +R
Sbjct  1140  ---FKMSIDAMR  1148


> sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1
Length=6631

 Score = 1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 752/2260 (33%), Positives = 1146/2260 (51%), Gaps = 192/2260 (8%)

Query  2229  IIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPC  2288
             +I+WF+  S     ++++   +   +  L   S C  Y +   +S +V    YC G   C
Sbjct  1759  LIVWFIYTS---NPVVFTGIRV---LDFLFEGSLCGPYNDYGKDSFDVL--RYCAGDFTC  1810

Query  2289  SVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFY--VLGLAAI  2346
              VCL   DSL  Y    +++           A G+   W   Y++F   F   V G   I
Sbjct  1811  RVCLHDRDSLHLYKHAYSVEQIYKD-----AASGINFNWNWLYLVFLILFVKPVAGFVII  1865

Query  2347  MQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSY-----VHVV  2401
                   Y   + + +S ++   +  +    +  +   + F  + +Y W  Y     VH +
Sbjct  1866  -----CYCVKYLVLSSTVLQTGVGFLDWF-VKTVFTHFNFMGAGFYFWLFYKIYVQVHHI  1919

Query  2402  DGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAG  2461
               C   TC +C +  R+ R E + +V G ++  +VY N G  FCK HNW C NCD +   
Sbjct  1920  LYCKDVTCEVCKRVARSNRQEVSVVVGGRKQIVHVYTNSGYNFCKRHNWYCRNCDDYGHQ  1979

Query  2462  STFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKA-GQKTYERHSLSH  2520
             +TF+S EVA +LS + KR + PT  + ++V    V +  ++L +  A   K     ++  
Sbjct  1980  NTFMSPEVAGELSEKLKRHVKPTAYAYHVVYEACVVDDFVNLKYKAAIPGKDNASSAVKC  2039

Query  2521  FVNLDNLR-ANNTKGSLPINVIVFDGKSKCEESSA------KSASVYYSQLMCQPILLLD  2573
             F   D L+ A   K +L    I  DG   C   SA      K+A+VYY+Q +C+PIL+LD
Sbjct  2040  FSVTDFLKKAVFLKEALKCEQISNDGFIVCNTQSAHALEEAKNAAVYYAQYLCKPILILD  2099

Query  2574  QALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTF  2633
             QAL                     +      P+ K  +++    + L+  +S+D     +
Sbjct  2100  QAL---------------------YEQLIVEPVSK--SVIDKVCSILSNIISVDTAALNY  2136

Query  2634  ISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYN-KVENMTPRDLGACI  2692
              +   +  + S  + ++ V+     H  ++E TGD   N + +Y    + +TPRD G  I
Sbjct  2137  KAGTLRDALLSITKDEEAVDMAIFCHNHEVEYTGDGFTNVIPSYGMDTDKLTPRDRGFLI  2196

Query  2693  DCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVN  2752
             +  A   N +V  +  +  +W   D + LS+   K + SA  K+   F +T +  +QV++
Sbjct  2197  NADASIANLRVKNAPPV--VWKFSDLIKLSDSCLKYLISATVKSGGRFFITKSGAKQVIS  2254

Query  2753  VVTTKIAL--KGGKIVNN---WLKQLIKVTLVF--LFVA---AIFYLITPVHVMSKHTDF  2802
               T K+ +  K G ++NN   W     K   VF  LF A     +Y+      +    D 
Sbjct  2255  CHTQKLLVEKKAGGVINNTFKWFMSCFKWLFVFYILFTACCLGYYYMEMNKSFVHPMYDV  2314

Query  2803  SS--EIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITR  2860
             +S   + G+K ID GV R+I S D CF+NK  +FD ++   G SY N+K CP++  VI  
Sbjct  2315  NSTLHVEGFKVIDKGVIREIVSEDNCFSNKFVNFDAFW---GKSYENNKNCPIVTVVIDG  2371

Query  2861  EVGFVVPGLPGTILRTTNG-DFLH---------FLPRVFSA--VGNICYTPSKLIEYTDF  2908
             + G V  G+PG +    +G  F+H         ++P  F+   VG   YT   +I    F
Sbjct  2372  D-GTVAVGVPGFVSWVMDGVMFVHMTQTDRRPWYIPTWFNREIVG---YTQDSIITEGSF  2427

Query  2909  ATSACVLAAECTIFKDASGKPVPYCYD-TNVLEGSVAYESLRPDTRYVLMDGSIIQFPNT  2967
              TS  + +A C ++  AS  P  YC++  N   G++ + S+ P   Y   +G  +  P  
Sbjct  2428  YTSIALFSARC-LYLTASNTPQLYCFNGDNDAPGALPFGSIIPHRVYFQPNGVRLIVPQQ  2486

Query  2968  YLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLL  3027
              L     V    DS YCR   CE ++ G CVS   +WVL ND Y S PGVFCG     L+
Sbjct  2487  ILHTPYIVKFVSDS-YCRGSVCEYTKPGYCVSLDSQWVLFNDEYISKPGVFCGSTVRELM  2545

Query  3028  TNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLM  3087
              NM +     +   +I   +    ++ +V+  +    ++F+  F  Y+ +V    L++++
Sbjct  2546  FNMVSTFFTGVNP-NIYIQLATMFLILVVIVLIFAMVIKFQGVFKAYATIVFTIMLVWVI  2604

Query  3088  SFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWIT---IAY  3144
             +  VLC+    S L  +  V+Y Y +   + + + + H   +  F  +VP W+    + +
Sbjct  2605  NAFVLCVHSYNSVLAVILLVLYCYASMVTSRNTAIIMHCWLVFTFGLIVPTWLACCYLGF  2664

Query  3145  IICISTKHFYWFFSNYLKRRVVFNGVSF-STFEEAALCTFLLNKEMYLKLRSDVLLPLTQ  3203
             I+ + T   +W +      R +++G  F   ++ AA  TF++    ++KL +++     +
Sbjct  2665  ILYMYTPLVFWCYGTTKNTRKLYDGNEFVGNYDLAAKSTFVIRGTEFVKLTNEIG---DK  2721

Query  3204  YNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ  3263
             +  YL+ Y + KY+SG      Y +A    LA AL+ + NSG +V+Y PP+ SI  + LQ
Sbjct  2722  FEAYLSAYARLKYYSGTGSEQDYLQACRAWLAYALDQYRNSGVEVVYTPPRYSIGVSRLQ  2781

Query  3264  SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR  3323
             +GF+K+  PS  VE C+V V+     LNGLWL D +YCPRHV+          + D+L  
Sbjct  2782  AGFKKLVSPSSAVEKCIVSVSYRGNNLNGLWLGDSIYCPRHVL---GKFSGDQWGDVLNL  2838

Query  3324  KSNHNFLVQAGN-VQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYN  3382
              +NH F V   N V L V+   ++  VL L+   AN +TPKYKFV+   G +F++   Y 
Sbjct  2839  ANNHEFEVVTQNGVTLNVVSRRLKGAVLILQTAVANAETPKYKFVKANCGDSFTIACSYG  2898

Query  3383  GSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEG  3442
             G+  G+Y   MR N TI+ SFL G+CGSVGFNI+   V+F YMHH+ELP  +H GTDL G
Sbjct  2899  GTVIGLYPVTMRSNGTIRASFLAGACGSVGFNIEKGVVNFFYMHHLELPNALHTGTDLMG  2958

Query  3443  NFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVIN-------GDRWFLNRFTTTLNDFNL  3495
              FYG +VD + AQ    D  +T N++AWLYAA+I+         +W L   T ++ D+N 
Sbjct  2959  EFYGGYVDEEVAQRVPPDNLVTNNIVAWLYAAIISVKESSFSQPKW-LESTTVSIEDYNR  3017

Query  3496  VAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRT--ILGSALLEDE  3553
              A    + P +      +  LSA TG+   D+C  L+ ++       +  ILG    EDE
Sbjct  3018  WASDNGFTPFSTSTA--ITKLSAITGV---DVCKLLRTIMVKSAQWGSDPILGQYNFEDE  3072

Query  3554  FTPFDVVRQCSGVTFQSAVKRTIKGTHHW---LLLTILTSLLVLVQSTQWSLFFFLYENA  3610
              TP  V  Q  GV  QS+  R    +  W   +L   L  L  +V  T   L F+++   
Sbjct  3073  LTPESVFNQVGGVRLQSSFVRKAT-SWFWSRCVLACFLFVLCAIVLFTAVPLKFYVHAAV  3131

Query  3611  FLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATV-----AYFNMVY--MPASWVMRI  3663
              L  A+  I+ +      VKH  A++  FLLP+L TV     A    +Y  + +  V+ +
Sbjct  3132  ILLMAVLFISFT------VKHVMAYMDTFLLPTLITVIIGVCAEVPFIYNTLISQVVIFL  3185

Query  3664  MTWLDMV--DTSL----------SGFK-LKDCVMYASAVVLLILMTARTVYDDGARRVWT  3710
               W D V  DT +          + FK ++ C M +    LL+L     +       ++T
Sbjct  3186  SQWYDPVVFDTMVPWMLLPLVLYTAFKCVQGCYMNSFNTSLLMLYQFMKL----GFVIYT  3241

Query  3711  LMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVE----YC  3766
               N LT   +   GN        W L   +         +   L   IVF C +    YC
Sbjct  3242  SSNTLTAYTE---GN--------WELFFELVHTIVLANVSSNSLIGLIVFKCAKWMLYYC  3290

Query  3767  PIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQ  3826
                +     L  +M+    +G+ CTCYFGL+  +N+ F LTLG Y++ VS  ++RYM   
Sbjct  3291  NATYFNNYVLMAVMVN--GIGWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLH  3348

Query  3827  GLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSK  3886
              + PPK   + F  NI + G+GG   + +ATVQSK+SDVKCT+VVL+ +L +L VE++SK
Sbjct  3349  KVNPPKTVWEVFTTNILIQGIGGDRVLPIATVQSKLSDVKCTTVVLMQLLTKLNVEANSK  3408

Query  3887  LWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIAS  3946
             + A  V+LHN IL + D  E  + ++ +L  L  +   +D+ + C+++L     LQ++  
Sbjct  3409  MHAYLVELHNKILASDDVGECMDNLLGMLITLFCIDSTIDLGEYCDDILKRSTVLQSVTQ  3468

Query  3947  EFSSLPSYAAFATAQEAYEQAVAN----GDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLE  4002
             EFS +PSYA +  A+  YE+ +A+    G ++  L   +K+ N+AKS FDRD A+Q+KL+
Sbjct  3469  EFSHIPSYAEYERAKSIYEKVLADSKNGGVTQQELAAYRKAANIAKSVFDRDLAVQKKLD  3528

Query  4003  KMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNII  4062
              MA++AMT MYK+AR  D+RAK+ S++  +LF+ML+K+D++ LN + + A  G VPL  +
Sbjct  3529  SMAERAMTTMYKEARVTDRRAKLVSSLHALLFSMLKKIDSEKLNVLFDQANSGVVPLATV  3588

Query  4063  PLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMD-----  4117
             P+  + KL +VIPD  T+    +G   TY++ +W I  V DAD   +  +          
Sbjct  3589  PIVCSNKLTLVIPDPETWVKCVEGVHVTYSTVVWNIDCVTDADGTELHPTSTGSGLTYCI  3648

Query  4118  NSPNLAWPLIVTALRANS---AVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNT  4174
             +  N+AWPL V   R       V LQNNEL P  ++  +C AG  Q  C+ ++   YY +
Sbjct  3649  SGDNIAWPLKVNLTRNGHNKVDVALQNNELMPHGVKTKACVAGVDQAHCSVESK-CYYTS  3707

Query  4175  TKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGL  4234
               G   V A+ S   +LK A F    G   IY +L+PPC+F        +V YLYFIK  
Sbjct  3708  ISGSSVVAAITSSNPNLKVASFLNEAGN-QIYVDLDPPCKFGMKVGDKVEVVYLYFIKNT  3766

Query  4235  NNLNRGMVLGSLAATVRLQA-GNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITN  4293
              ++ RGMVLG+++  V LQ+ G+ TE      +LS C+FAVD A  Y  Y+A+G QP+ N
Sbjct  3767  RSIVRGMVLGAISNVVVLQSKGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGN  3826

Query  4294  CVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP----NPKGFCDLKGKY  4349
             CVKML  H G+G AIT  P    DQ+S+GGAS CLYCR HI HP    N  G C  KG +
Sbjct  3827  CVKMLTVHNGSGFAITSKPSPTPDQDSYGGASVCLYCRAHIAHPGGAGNLDGRCQFKGSF  3886

Query  4350  VQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREP  4389
             VQIPTT   DPVGF L+N VCTVC  W GYGC CD LR+P
Sbjct  3887  VQIPTT-EKDPVGFCLRNKVCTVCQCWIGYGCQCDSLRQP  3925


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/242 (24%), Positives = 108/242 (45%), Gaps = 13/242 (5%)

Query  1570  VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRV  1629
             ++ T D +   + V+    + GQ FG  +   A    +   +  E K    +P  D   +
Sbjct  1182  IYLTEDGVKYRSVVLKPGDSLGQ-FGQVF---ARNKVVFSADDVEDKEILFIPTTDKTIL  1237

Query  1630  EAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELK  1689
             E    Y+  D      Y+  L   +KW     +    ++W D NC++++A++ LQ  +++
Sbjct  1238  E----YYGLDAQKYVTYLQTL--AQKWDVQYRDNFVILEWRDGNCWISSAIVLLQAAKIR  1291

Query  1690  FNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVL-  1748
             F    L +A+ +   G+  +F A   A CN  VG+  D    ++ L +H + D    +L 
Sbjct  1292  FK-GFLAEAWAKLLGGDPTDFVAWCYASCNAKVGDFSDANWLLANLAEHFDADYTNALLK  1350

Query  1749  NVVCKTCGQQQTTLKGVEA-VMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMM  1807
               V   CG +   L+G+EA +  +   +   FK       TCG  +T  +++   P++++
Sbjct  1351  KCVSCNCGVKSYELRGLEACIQPVRAPNLLHFKTQYSNCPTCGASSTDEVIEASLPYLLL  1410

Query  1808  SA  1809
              A
Sbjct  1411  FA  1412


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 80/180 (44%), Gaps = 28/180 (16%)

Query  1009  QPQLEMELTPVVQ---------------TIEVNSFSGYLKLTDNVYIKNADIVEEAKKVK  1053
             +PQ+E E T VV+               T E   F  Y     ++ +  A  ++E K+  
Sbjct  981   EPQVEQEPTLVVKAQREKKAKKFKVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEF-  1039

Query  1054  PTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH  1113
                +VNAAN ++ HGGGVA A+             DY+  +GP +     V         
Sbjct  1040  --CIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQ---KLVTPSFVKGIQ  1094

Query  1114  CL-HVVGPNVNKGEDIQLLKSAYENFNQHEVL--LAPLLSAGIFGADPIHSLRVCVDTVR  1170
             C+ +VVGP        + L +AY++     V+  + P+LS+GIFG D     ++ +D +R
Sbjct  1095  CVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVD----FKISIDAMR  1150


> sp|Q4J9D2|Y1252_SULAC Uncharacterized protein Saci_1252 OS=Sulfolobus 
acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 
/ NBRC 15157 / NCIMB 11770) OX=330779 GN=Saci_1252 PE=4 
SV=1
Length=181

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 10/124 (8%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             V ++N DI     KV+   +VNAAN YL HGGGVA A+ ++    +Q ESD+Y+  NGP+
Sbjct  13    VILENGDIT----KVEADAIVNAANSYLSHGGGVALAIVRSGGYIIQEESDEYVRRNGPV  68

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVNKGEDIQL---LKSAYENFNQHEV--LLAPLLSA  1151
              VG   V +   L A++ +H VGP      D +L   ++ + E  ++ ++  +  P +S 
Sbjct  69    PVGEVAVTTAGKLKARYVIHAVGPRYGIEGDDKLESAIRRSLEKADELKLSSIALPAIST  128

Query  1152  GIFG  1155
             GI+G
Sbjct  129   GIYG  132


> sp|Q8ZXT3|Y1111_PYRAE Uncharacterized protein PAE1111 OS=Pyrobaculum 
aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 
9630 / NBRC 100827) OX=178306 GN=PAE1111 PE=4 SV=1
Length=182

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 83/170 (49%), Gaps = 23/170 (14%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             V +   DI E    V+   +VNAAN YL+HGGGVAGA+ +     +Q ES +++  +GP+
Sbjct  10    VVLMRGDITE----VEADAIVNAANSYLEHGGGVAGAIVRKGGQVIQEESREWVRKHGPV  65

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVNKGEDIQLLKSAYEN--FNQHEVLLA----PLLS  1150
              VG   V S   L AK+ +H VGP     E I+ L  A +N      E+ L     P +S
Sbjct  66    PVGDVAVTSAGRLKAKYVIHAVGPRCGV-EPIEKLAEAVKNALLKAEELGLVSIALPAIS  124

Query  1151  AGIFG----------ADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSF  1190
              GIFG          A  I  +   + ++R  + + ++ +  Y K +  F
Sbjct  125   TGIFGCPYDAAAEQMATAIREVAPALRSIR-RILVVLYGEEAYQKFLEVF  173


> sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermotoga 
maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) 
OX=243274 GN=TM_0508 PE=3 SV=1
Length=599

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query  1037  NVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP  1096
              + I   DI  E    +   +VNAAN YLKHGGGVAGA+ +A  + +Q ESD  +   G 
Sbjct  428   KIRIVKGDITRE----EVDAIVNAANEYLKHGGGVAGAIVRAGGSVIQEESDRIVQERGR  483

Query  1097  LKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYEN-FNQHEVLLA----P  1147
             +  G + V S   L AK+ +H VGP     + GED  L K+ Y      HE+ L     P
Sbjct  484   VPTGEAVVTSAGKLKAKYVIHTVGPVWRGGSHGEDELLYKAVYNALLRAHELKLKSISMP  543

Query  1148  LLSAGIFG  1155
              +S GIFG
Sbjct  544   AISTGIFG  551


> sp|Q97UU4|Y2899_SACS2 Uncharacterized protein SSO2899 OS=Saccharolobus 
solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 
/ P2) OX=273057 GN=SSO2899 PE=4 SV=1
Length=177

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 53/167 (32%), Positives = 85/167 (51%), Gaps = 19/167 (11%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             +Y+   DI E    ++   +VNAAN YL+HGGGVA A+ +     +Q ESD+Y+   GP+
Sbjct  10    IYLIKGDITE----IEADAIVNAANSYLQHGGGVAYAIVRKGGYIIQKESDEYVKKFGPV  65

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVN-KGEDIQLLKSAYENFNQHEVL-----LAPLLS  1150
              VG   V S   L AK+ +H VGP    +GED +L  + +++  + + L       P +S
Sbjct  66    PVGEVAVTSAGKLKAKYVIHAVGPRYGIEGED-KLESAIFKSLLKADELSLSSIAMPAIS  124

Query  1151  AGIFGADPIHSLRVCVDTVR-------TNVYLAVFDKNLYDKLVSSF  1190
              GI+G       R+  + ++         V + ++ K+ YD   S F
Sbjct  125   TGIYGYPFEICARIMANVLKGYKPKTLRKVMICLYTKDAYDVFKSIF  171


> sp|Q96XY5|Y2383_SULTO Uncharacterized protein STK_23830 OS=Sulfurisphaera 
tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 
/ 7) OX=273063 GN=STK_23830 PE=4 SV=1
Length=182

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 58/189 (31%), Positives = 93/189 (49%), Gaps = 32/189 (17%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             V I   DI E    ++   +VNAAN YL+HGGGVA A+ +     +Q ES +Y+   GP+
Sbjct  3     VKIIKGDITE----IEAEAIVNAANSYLEHGGGVARAIVEKGGYIIQKESREYVRKYGPV  58

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVN-KGEDIQLLKSAYENF--NQHEVLLA----PLL  1149
               GG  V S   L AK+ +H VGP    +GE  + L+ A  N      E+ L+    P +
Sbjct  59    PTGGVAVTSAGKLKAKYVIHAVGPRYGIEGE--EKLEEAIRNALRKAEELKLSSIALPAI  116

Query  1150  SAGIFGADPIHSLRVCVDTV-------RTN------VYLAVFDKNLYDKLVSSF-LEMKS  1195
             S GI+G    +   +C + +        TN      + ++++ +  Y+  V+ F  E+  
Sbjct  117   STGIYG----YPYEICAEKMVKVIKEEYTNFKHLNTIIVSLYSEEAYNIFVNIFERELAK  172

Query  1196  EKQVEQKIA  1204
             EK +  K++
Sbjct  173   EKNITLKMS  181


> sp|P0C6F3|R1A_BEV Replicase polyprotein 1a OS=Berne virus OX=11156 
GN=1a PE=1 SV=1
Length=4569

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 14/147 (10%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK--HC  1114
             VVN AN  LKHGGG+A  ++      +Q  S++YI  N  + V  +    G  L K  + 
Sbjct  1715  VVNPANSQLKHGGGIAKVISCMCGPKLQAWSNNYITKNKTVPVTKAIKSPGFQLGKKVNI  1774

Query  1115  LHVVGPNVNKGEDIQLLKSAYENF-----NQHEVLLAPLLSAGIFGADPIHSLRVCVDTV  1169
             +H VGP V+ G+  Q L  A+ +      +QH +L + +LS GIFG     ++    +T 
Sbjct  1775  IHAVGPRVSDGDVFQKLDQAWRSVFDLCEDQHTILTS-MLSTGIFGC----TVNDSFNTF  1829

Query  1170  RTNVYLAVFDKNLYDKLVSSFLEMKSE  1196
              +NV  A  DK+L   +V++ +E  ++
Sbjct  1830  LSNV--ARLDKSLVVFVVTNMVEQYNQ  1854


 Score = 45.1 bits (105),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 17/143 (12%)

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLF-------LMSFTVLCLTPVYSFLPGV  3104
              V IVV     + +  R     YS+   F  ++F       +M   V+CL P+   +PGV
Sbjct  3063  FVFIVVIFTVIFLILIRLYIVMYSYFKVFTYVVFKLLFVNIIMVLFVVCLPPL---VPGV  3119

Query  3105  YSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRR  3164
               V    L  +L + V FL ++ ++ +F  ++P++  + ++  +    F+W   +     
Sbjct  3120  VFV----LALWLCDSVMFLLYLAFLSLF--ILPWFYVLFFLFMVGGFVFWWMMRSADVVH  3173

Query  3165  VVFNGVSFS-TFEEAALCTFLLN  3186
             +  +G++F+ TFE+ + C F LN
Sbjct  3174  LTTDGLTFNGTFEQISKCVFPLN  3196


> sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11156 
GN=rep PE=1 SV=1
Length=6857

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 14/147 (10%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK--HC  1114
             VVN AN  LKHGGG+A  ++      +Q  S++YI  N  + V  +    G  L K  + 
Sbjct  1715  VVNPANSQLKHGGGIAKVISCMCGPKLQAWSNNYITKNKTVPVTKAIKSPGFQLGKKVNI  1774

Query  1115  LHVVGPNVNKGEDIQLLKSAYENF-----NQHEVLLAPLLSAGIFGADPIHSLRVCVDTV  1169
             +H VGP V+ G+  Q L  A+ +      +QH +L + +LS GIFG     ++    +T 
Sbjct  1775  IHAVGPRVSDGDVFQKLDQAWRSVFDLCEDQHTILTS-MLSTGIFGC----TVNDSFNTF  1829

Query  1170  RTNVYLAVFDKNLYDKLVSSFLEMKSE  1196
              +NV  A  DK+L   +V++ +E  ++
Sbjct  1830  LSNV--ARLDKSLVVFVVTNMVEQYNQ  1854


 Score = 45.1 bits (105),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 17/143 (12%)

Query  3052  IVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLF-------LMSFTVLCLTPVYSFLPGV  3104
              V IVV     + +  R     YS+   F  ++F       +M   V+CL P+   +PGV
Sbjct  3063  FVFIVVIFTVIFLILIRLYIVMYSYFKVFTYVVFKLLFVNIIMVLFVVCLPPL---VPGV  3119

Query  3105  YSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRR  3164
               V    L  +L + V FL ++ ++ +F  ++P++  + ++  +    F+W   +     
Sbjct  3120  VFV----LALWLCDSVMFLLYLAFLSLF--ILPWFYVLFFLFMVGGFVFWWMMRSADVVH  3173

Query  3165  VVFNGVSFS-TFEEAALCTFLLN  3186
             +  +G++F+ TFE+ + C F LN
Sbjct  3174  LTTDGLTFNGTFEQISKCVFPLN  3196


> sp|P36327|POLN_EEVV3 Polyprotein P1234 OS=Venezuelan equine encephalitis 
virus (strain 3880) OX=36382 PE=3 SV=3
Length=2485

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 70/140 (50%), Gaps = 26/140 (19%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCL  1115
             V++NAAN   + GGGV GAL K    +  ++         P++VG + ++ G   AKH +
Sbjct  1347  VIINAANSKGQPGGGVCGALYKKFPESFDLQ---------PIEVGKARLVKG--AAKHII  1395

Query  1116  HVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIFGADP------IH  1160
             H VGPN NK  +I+    L  AYE      N N ++ +  PLLS GIF  +       ++
Sbjct  1396  HAVGPNFNKVSEIEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLN  1455

Query  1161  SLRVCVDTVRTNVYLAVFDK  1180
              L   +DT   +V +   DK
Sbjct  1456  HLLTALDTTDADVAIYCRDK  1475


> sp|Q8CAS9|PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 
OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
Length=866

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 64/142 (45%), Gaps = 16/142 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH-CL  1115
             VVNAAN  L HG G+AG+L K     +Q ES   IA  G + VGG  +     L  H  +
Sbjct  137   VVNAANENLLHGSGLAGSLVKTGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCHLII  196

Query  1116  HVVGPN---VNKGEDIQLLKSAYENFNQH--------EVLLAPLLSAGIFGADPIHSLRV  1164
             H VGP     N    I+LLK A  N   +        + +  P LS+GIF       L +
Sbjct  197   HAVGPRWTVTNSQTAIELLKFAIRNILDYVTKYDLRIKTVAIPALSSGIFQ----FPLDL  252

Query  1165  CVDTVRTNVYLAVFDKNLYDKL  1186
             C   +   + L   DK ++  L
Sbjct  253   CTSIILETIRLYFQDKQMFGNL  274


> sp|P27282|POLN_EEVVT Polyprotein P1234 OS=Venezuelan equine encephalitis 
virus (strain Trinidad donkey) OX=11038 PE=1 SV=3
Length=2493

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 70/141 (50%), Gaps = 26/141 (18%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCL  1115
             V++NAAN   + GGGV GAL K    +  ++         P++VG + ++ G   AKH +
Sbjct  1347  VIINAANSKGQPGGGVCGALYKKFPESFDLQ---------PIEVGKARLVKG--AAKHII  1395

Query  1116  HVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIFGAD------PIH  1160
             H VGPN NK  +++    L  AYE      N N ++ +  PLLS GIF  +       ++
Sbjct  1396  HAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLN  1455

Query  1161  SLRVCVDTVRTNVYLAVFDKN  1181
              L   +DT   +V +   DK 
Sbjct  1456  HLLTALDTTDADVAIYCRDKK  1476


> sp|P36328|POLN_EEVVP Polyprotein P1234 OS=Venezuelan equine encephalitis 
virus (strain P676) OX=36385 PE=1 SV=2
Length=2493

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 70/140 (50%), Gaps = 26/140 (19%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCL  1115
             V++NAAN   + GGGV GAL K    +  ++         P++VG + ++ G   AKH +
Sbjct  1347  VIINAANSKGQPGGGVCGALYKKFPESFDLQ---------PIEVGKARLVKG--AAKHII  1395

Query  1116  HVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIFGAD------PIH  1160
             H VGPN NK  +++    L  AYE      N N ++ +  PLLS GIF  +       ++
Sbjct  1396  HAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLN  1455

Query  1161  SLRVCVDTVRTNVYLAVFDK  1180
              L   +DT   +V +   DK
Sbjct  1456  HLLTALDTTDADVAIYCRDK  1475


> sp|A7MG20|YMDB_CROS8 O-acetyl-ADP-ribose deacetylase OS=Cronobacter 
sakazakii (strain ATCC BAA-894) OX=290339 GN=ymdB PE=3 
SV=1
Length=180

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 47/158 (30%), Positives = 71/158 (45%), Gaps = 21/158 (13%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHC  1114
             V+VNAAN  L  GGGV GA+++A   A+           G  + G + +    +L AK  
Sbjct  19    VIVNAANPSLMGGGGVDGAIHRAAGPALLAACRQVRQQQGECQPGHAVITEAGDLAAKAV  78

Query  1115  LHVVGPNVNKGED--IQLLKSAYEN------FNQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             +H VGP    G+D   QLL  AY N       N +  +  P +S GI+G     + ++  
Sbjct  79    VHTVGPVWRGGQDNEPQLLADAYRNSLQLVAANGYNSVAFPAISTGIYGYPKAAAAQIAF  138

Query  1167  DTVR---------TNVYLAVFDKN---LYDKLVSSFLE  1192
             +TV            VY   +D+    LY +L+  + E
Sbjct  139   ETVSDYLTRHPQPKQVYFVCYDEENFLLYQRLLGQYDE  176


> sp|E1SDF1|YMDB1_PANVC O-acetyl-ADP-ribose deacetylase 1 OS=Pantoea 
vagans (strain C9-1) OX=712898 GN=ymdB1 PE=3 SV=1
Length=171

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (47%), Gaps = 18/152 (12%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL  1110
             KV    +VNAAN  L  GGGV GA+++A    +  E        G  KVG + +    NL
Sbjct  13    KVSAEAIVNAANSSLLGGGGVDGAIHRAGGPVILAECQLIRNRQGGCKVGDAVITGAGNL  72

Query  1111  -AKHCLHVVGPNVNKG--EDIQLLKSAYE------NFNQHEVLLAPLLSAGIFGADPIHS  1161
              A + +H VGP  + G  ++  LLK AY+      +++  + +  P +S GI+G     +
Sbjct  73    PADYVIHTVGPRWSDGRHDEDALLKRAYQSCFKLVDYHGIKTVSFPNISTGIYGFPKERA  132

Query  1162  LRVCVDTVR---------TNVYLAVFDKNLYD  1184
               + +D ++          NV L  FD   YD
Sbjct  133   ATIALDVIKHCIAENRTLENVNLVCFDAENYD  164


> sp|A8AI35|YMDB_CITK8 O-acetyl-ADP-ribose deacetylase OS=Citrobacter 
koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) 
OX=290338 GN=ymdB PE=3 SV=1
Length=177

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 49/178 (28%), Positives = 84/178 (47%), Gaps = 29/178 (16%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +   +++++ DI +    +   V+VNAAN  L  GGGV GA+++A    +          
Sbjct  1     MKSRIHVQHGDITQ----LTVDVIVNAANASLLGGGGVDGAIHRAAGPTLLEACKKVRQQ  56

Query  1094  NGPLKVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYENFNQHEVLLA----  1146
              G    G + + L+G+  AK  +H VGP    G+  + QLL+ AY  FN  +++LA    
Sbjct  57    QGECPAGHAVITLAGNLPAKAVIHTVGPVWRGGDHNESQLLEDAY--FNSLQLVLANGYR  114

Query  1147  ----PLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
                 P +S G +G     +  + V+TV            VY   +D+    LY++L++
Sbjct  115   SVAFPAISTGAYGYPRPAAAEIAVNTVADFLARHALPEQVYFVCYDEETARLYERLLT  172


> sp|C9Y0V8|YMDB_CROTZ O-acetyl-ADP-ribose deacetylase OS=Cronobacter 
turicensis (strain DSM 18703 / LMG 23827 / z3032) OX=693216 
GN=ymdB PE=3 SV=1
Length=176

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 72/163 (44%), Gaps = 21/163 (13%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL  1110
             ++   V+VNAAN  L  GGGV GA+++A   ++           G  + G + +    +L
Sbjct  14    RIDTDVIVNAANPSLMGGGGVDGAIHRAAGPSLLAACKVVRQQQGECQPGHAVITEAGDL  73

Query  1111  -AKHCLHVVGPNVNKGED--IQLLKSAYEN------FNQHEVLLAPLLSAGIFGADPIHS  1161
              AK  +H VGP    G D   QLL  AY N       N +  +  P +S GI+G     +
Sbjct  74    AAKAVIHTVGPIWRGGHDNEPQLLADAYRNSLELVTANGYNSVAFPAISTGIYGYPKAAA  133

Query  1162  LRVCVDTVR---------TNVYLAVFDKN---LYDKLVSSFLE  1192
              ++  +TV            VY   +D+    LY +L+  + E
Sbjct  134   AQIAFETVSDYLTRRPQPKQVYFVCYDEENFLLYQRLLGQYDE  176


> sp|Q8V294|POLN_EEVVC Polyprotein P1234 OS=Venezuelan equine encephalitis 
virus (strain CPA201) OX=376610 PE=3 SV=3
Length=2497

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (49%), Gaps = 26/141 (18%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCL  1115
             V+VNAAN   + G GV GAL +    +  ++         P++VG + ++ G+  +KH +
Sbjct  1347  VIVNAANSKGQPGSGVCGALYRKYPESFDLQ---------PIEVGKARLVKGN--SKHLI  1395

Query  1116  HVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIFGADP------IH  1160
             H VGPN NK  +++    L  AYE      N N +  +  PLLS GIF  +       ++
Sbjct  1396  HAVGPNFNKVSEVEGDKQLAEAYESIARIINDNNYRSVAIPLLSTGIFAGNKDRLMQSLN  1455

Query  1161  SLRVCVDTVRTNVYLAVFDKN  1181
              L   +DT   +V +   DK 
Sbjct  1456  HLLTALDTTDADVAIYCRDKK  1476


> sp|P0A8D6|YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia 
coli (strain K12) OX=83333 GN=ymdB PE=1 SV=1
Length=177

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 79/172 (46%), Gaps = 25/172 (15%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             +++   DI     K+   V+VNAAN  L  GGGV GA+++A   A+           G  
Sbjct  5     IHVVQGDIT----KLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC  60

Query  1098  KVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPL  1148
               G + + L+G   AK  +H VGP    GE  + QLL+ AY N       N +  +  P 
Sbjct  61    PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA  120

Query  1149  LSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
             +S G++G     +  + V TV            VY   +D+   +LY++L++
Sbjct  121   ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLT  172


> sp|P0A8D7|YMDB_ECOL6 O-acetyl-ADP-ribose deacetylase OS=Escherichia 
coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 
GN=ymdB PE=3 SV=1
Length=177

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 79/172 (46%), Gaps = 25/172 (15%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             +++   DI     K+   V+VNAAN  L  GGGV GA+++A   A+           G  
Sbjct  5     IHVVQGDIT----KLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC  60

Query  1098  KVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPL  1148
               G + + L+G   AK  +H VGP    GE  + QLL+ AY N       N +  +  P 
Sbjct  61    PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA  120

Query  1149  LSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
             +S G++G     +  + V TV            VY   +D+   +LY++L++
Sbjct  121   ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLT  172


> sp|P0A8D8|YMDB_ECO57 O-acetyl-ADP-ribose deacetylase OS=Escherichia 
coli O157:H7 OX=83334 GN=ymdB PE=3 SV=1
Length=177

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 79/172 (46%), Gaps = 25/172 (15%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             +++   DI     K+   V+VNAAN  L  GGGV GA+++A   A+           G  
Sbjct  5     IHVVQGDIT----KLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC  60

Query  1098  KVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPL  1148
               G + + L+G   AK  +H VGP    GE  + QLL+ AY N       N +  +  P 
Sbjct  61    PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA  120

Query  1149  LSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
             +S G++G     +  + V TV            VY   +D+   +LY++L++
Sbjct  121   ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLT  172


> sp|B5F961|YMDB_SALA4 O-acetyl-ADP-ribose deacetylase OS=Salmonella 
agona (strain SL483) OX=454166 GN=ymdB PE=3 SV=1
Length=179

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T  + +   DI +    +    +VNAAN  L  GGGV GA+++A   A+          
Sbjct  1     MTSRLQVIQGDITQ----LSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G  + G + +     L AK  +H VGP    GE  + +LL++AY N       N    +
Sbjct  57    QGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEYQEAELLEAAYRNCLLLAEANHFRSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  V V TV            VY   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLT  172


> sp|A4W960|YMDB_ENT38 O-acetyl-ADP-ribose deacetylase OS=Enterobacter 
sp. (strain 638) OX=399742 GN=ymdB PE=3 SV=1
Length=180

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 21/164 (13%)

Query  1045  IVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV  1104
             +V +   ++  V+VNAAN  L  GGGV GA+++A    +           G    G + +
Sbjct  8     VVGDITTMEVDVIVNAANPSLMGGGGVDGAIHRAAGPQLLEACKTVRQQQGECAPGHAVI  67

Query  1105  -LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPLLSAGIFG  1155
              ++G   AK  +H VGP    GE  + + L+ AY N       N ++ L  P +S G++G
Sbjct  68    TIAGDLPAKAVIHAVGPVWQGGENHEARTLQDAYLNCLRLAAANGYKTLAFPAISTGVYG  127

Query  1156  ADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLV  1187
                  +  + VDTV            VY   +D+    LY +L+
Sbjct  128   YPKAAAAEIAVDTVSEFLTRKPLPERVYFVCYDEENAQLYQRLL  171


> sp|P67341|YMDB_SALTY O-acetyl-ADP-ribose deacetylase OS=Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 
GN=ymdB PE=3 SV=1
Length=179

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 75/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T  + +   DI +    +    +VNAAN  L  GGGV GA+++A   A+          
Sbjct  1     MTSRLQVIQGDITQ----LSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G  + G + +     L AK  +H VGP    GE  + +LL+ AY N       N    +
Sbjct  57    QGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  V V TV            VY   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLT  172


> sp|P67342|YMDB_SALTI O-acetyl-ADP-ribose deacetylase OS=Salmonella 
typhi OX=90370 GN=ymdB PE=3 SV=1
Length=179

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 75/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T  + +   DI +    +    +VNAAN  L  GGGV GA+++A   A+          
Sbjct  1     MTSRLQVIQGDITQ----LSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G  + G + +     L AK  +H VGP    GE  + +LL+ AY N       N    +
Sbjct  57    QGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  V V TV            VY   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLT  172


> sp|D3RKJ0|YMDB_KLEVT O-acetyl-ADP-ribose deacetylase OS=Klebsiella 
variicola (strain At-22) OX=640131 GN=ymdB PE=3 SV=1
Length=175

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 45/156 (29%), Positives = 73/156 (47%), Gaps = 21/156 (13%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV-LSGHNLAKHC  1114
             V+VNAAN  L  GGGV GA+++A   A+       +   G    G + + ++G   A   
Sbjct  19    VIVNAANPSLLGGGGVDGAIHRAAGPALLAACKQVLQQQGECPPGHAVITIAGDLPASAV  78

Query  1115  LHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             +H VGP  + G+  + Q L  AY+N       N +  +  P +S G++G     +  + V
Sbjct  79    IHTVGPVWHGGDRMEAQTLADAYKNSLQLAAANNYRSIAFPAISTGVYGYPKEEAAEIAV  138

Query  1167  DTV-----RTN----VYLAVFDKN---LYDKLVSSF  1190
              TV     R N    V    FD+    +Y +L++S+
Sbjct  139   RTVTAFLTRYNPLERVLFVCFDEETAAIYRRLLASY  174


> sp|B5XXK9|YMDB_KLEP3 O-acetyl-ADP-ribose deacetylase OS=Klebsiella 
pneumoniae (strain 342) OX=507522 GN=ymdB PE=3 SV=1
Length=175

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 45/156 (29%), Positives = 73/156 (47%), Gaps = 21/156 (13%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV-LSGHNLAKHC  1114
             V+VNAAN  L  GGGV GA+++A   A+       +   G    G + + ++G   A   
Sbjct  19    VIVNAANPSLLGGGGVDGAIHRAAGPALLAACKQVLQQQGECPPGHAVITIAGDLPASAV  78

Query  1115  LHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             +H VGP  + G+  + Q L  AY+N       N +  +  P +S G++G     +  + V
Sbjct  79    IHTVGPVWHGGDRMEAQTLADAYKNSLQLAAANNYRSIAFPAISTGVYGYPKEEAAEIAV  138

Query  1167  DTV-----RTN----VYLAVFDKN---LYDKLVSSF  1190
              TV     R N    V    FD+    +Y +L++S+
Sbjct  139   RTVTAFLTRYNPLERVLFVCFDEETAAIYRRLLASY  174


> sp|Q9WJC7|POLN_EEVVM Polyprotein P1234 OS=Venezuelan equine encephalitis 
virus (strain Mena II) OX=36384 PE=3 SV=3
Length=2499

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCL  1115
             V+VNAAN   + G GV GAL +    +  ++         P++VG + ++ G   +KH +
Sbjct  1347  VIVNAANSKGQPGSGVCGALYRKYPESFDLQ---------PIEVGKARLVKGS--SKHII  1395

Query  1116  HVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIFGAD------PIH  1160
             H VGPN +K  +++    L  AYE      N N +  +  PLLS GIF  +       ++
Sbjct  1396  HAVGPNFSKVSEVEGDKQLAEAYESIAKIINDNNYRSVAIPLLSTGIFAGNKDRLMQSLN  1455

Query  1161  SLRVCVDTVRTNVYLAVFDKN  1181
              L   +DT   +V +   DK 
Sbjct  1456  HLLTALDTTDADVAIYCRDKK  1476


> sp|B4T2X8|YMDB_SALNS O-acetyl-ADP-ribose deacetylase OS=Salmonella 
newport (strain SL254) OX=423368 GN=ymdB PE=3 SV=1
Length=179

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 47/176 (27%), Positives = 75/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T  + +   DI +    +    +VNAAN  L  GGGV GA+++A   A+          
Sbjct  1     MTSRLQVIQGDITQ----LSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G  + G + +     L AK  +H VGP    GE  + +LL+ AY N       N    +
Sbjct  57    QGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  + V TV            VY   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAQAAEIAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLT  172


> sp|Q460N5|PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 
OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
Length=1801

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 14/124 (11%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHC  1114
             VVVNA+N  LKH GG+A AL+KA    +Q + D  +   G L  G + +     L   H 
Sbjct  818   VVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHV  877

Query  1115  LHVVGPNVNKGED---IQLLKSAYE------NFNQHEVLLAPLLSAGIFGADPIHSLRVC  1165
             +H VGP  +  E    + LL+ A +         ++  +  P +S+G+FG      L  C
Sbjct  878   IHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFG----FPLGRC  933

Query  1166  VDTV  1169
             V+T+
Sbjct  934   VETI  937


> sp|D5CE05|YMDB_ENTCC O-acetyl-ADP-ribose deacetylase OS=Enterobacter 
cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 
/ NBRC 13535 / NCDC 279-56) OX=716541 GN=ymdB PE=3 SV=1
Length=180

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 9/123 (7%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV-LSGHNLAKHC  1114
             V+VNAAN  L  GGGV GA+++A    +           G    G + + L+G   AK  
Sbjct  19    VIVNAANPSLMGGGGVDGAIHRAAGPQLLEACKTVRQQQGECPPGHAVITLAGDLPAKAV  78

Query  1115  LHVVGPNVNKGE--DIQLLKSAYENF------NQHEVLLAPLLSAGIFGADPIHSLRVCV  1166
             +H VGP  + G+  +  +L+ AY N       N ++ +  P +S G++G     +  + V
Sbjct  79    IHAVGPIWHGGDRHEASILEEAYRNCLRLAADNGYKTMAFPAISTGVYGYPKAAAATIAV  138

Query  1167  DTV  1169
             DTV
Sbjct  139   DTV  141


> sp|Q8EYT0|Y4133_LEPIN Macro domain-containing protein LA_4133 
OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar 
Lai (strain 56601) OX=189518 GN=LA_4133 PE=4 SV=1
Length=175

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 82/172 (48%), Gaps = 31/172 (18%)

Query  1045  IVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV  1104
             I E+  +++   +VNAAN  L  GGGV GA+++A    +  E        G  KVG + +
Sbjct  8     IKEDITQLEVDAIVNAANSSLLGGGGVDGAIHRAGGPEILEECYKIREKQGECKVGEAVI  67

Query  1105  LSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYENFNQHEVLLA----------PLLS  1150
              +   L AK  +H VGP     NK ED +LL +AY+N     +LLA          P +S
Sbjct  68    TTAGRLNAKFIIHTVGPIWSGGNKNED-ELLSNAYKN----SLLLAKNHSLKTIAFPNIS  122

Query  1151  AGIFGADPIHSLRVCVDTVR---------TNVYLAVFD-KNL--YDKLVSSF  1190
              GI+      + ++ + +V            V+   FD +NL  Y+KL+ ++
Sbjct  123   TGIYHFPKERAAKIAIQSVTEFLKQDNQIQTVFFVCFDFENLEIYNKLLQTY  174


> sp|Q72M93|Y3295_LEPIC Macro domain-containing protein LIC_13295 
OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar 
copenhageni (strain Fiocruz L1-130) OX=267671 GN=LIC_13295 
PE=4 SV=1
Length=175

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 82/172 (48%), Gaps = 31/172 (18%)

Query  1045  IVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCV  1104
             I E+  +++   +VNAAN  L  GGGV GA+++A    +  E        G  KVG + +
Sbjct  8     IKEDITQLEVDAIVNAANSSLLGGGGVDGAIHRAGGPEILEECYKIREKQGECKVGEAVI  67

Query  1105  LSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYENFNQHEVLLA----------PLLS  1150
              +   L AK  +H VGP     NK ED +LL +AY+N     +LLA          P +S
Sbjct  68    TTAGRLNAKFIIHTVGPIWSGGNKNED-ELLSNAYKN----SLLLAKNHSLKTIAFPNIS  122

Query  1151  AGIFGADPIHSLRVCVDTVRT---------NVYLAVFD-KNL--YDKLVSSF  1190
              GI+      + ++ + +V            V+   FD +NL  Y+KL+ ++
Sbjct  123   TGIYHFPKERAAKIAIQSVTKFLKQDNQIQTVFFVCFDFENLEIYNKLLQTY  174


> sp|B5RBF3|YMDB_SALG2 O-acetyl-ADP-ribose deacetylase OS=Salmonella 
gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=ymdB 
PE=3 SV=1
Length=179

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 47/176 (27%), Positives = 75/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +T  + +   DI +    +    +VNAAN  L  GGGV GA+++A   A+          
Sbjct  1     MTSRLQVIQGDITQ----LSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G  + G + +     L AK  +H VGP    GE  + +LL+ AY +       N    +
Sbjct  57    QGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRSCLLLAEANHFRSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  V V TV            VY   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLT  172


> sp|B7LT90|YMDB_ESCF3 O-acetyl-ADP-ribose deacetylase OS=Escherichia 
fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) 
OX=585054 GN=ymdB PE=3 SV=2
Length=177

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 77/176 (44%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +   +++   DI + A  V    +VNAAN  L  GGGV GA+++A    +          
Sbjct  1     MKSRIHVLQGDITQLAVDV----IVNAANSSLMGGGGVDGAIHRAAGPELLEACQKVRRQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G    G + +    NL A+  +H VGP    GE  + QLL  AY N       N ++ +
Sbjct  57    QGECPTGHAVITIAGNLPARAVIHTVGPVWRDGEHNEDQLLHDAYLNSLKLAQANGYKSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
               P +S G++G     +  + V TV            +Y   +D+    LY++L++
Sbjct  117   AFPAISTGVYGFPRAAAAEIAVKTVSDFITRHALPEQIYFVCYDEENSRLYNRLLT  172


> sp|Q0T5Z6|YMDB_SHIF8 O-acetyl-ADP-ribose deacetylase OS=Shigella 
flexneri serotype 5b (strain 8401) OX=373384 GN=ymdB PE=3 
SV=1
Length=177

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 78/173 (45%), Gaps = 25/173 (14%)

Query  1037  NVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP  1096
              +++   DI     K+   V+VNAAN  L  GGGV GA+++A   A+           G 
Sbjct  4     RIHVVQGDIT----KLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGD  59

Query  1097  LKVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAP  1147
                G + + L+G   AK  +H VGP    GE  + QLL+ AY N       N +  +  P
Sbjct  60    CPTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFP  119

Query  1148  LLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
              +S G++      +  + V TV            VY   +D+   +LY++L++
Sbjct  120   AISTGVYSYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLT  172


> sp|P0C6F4|R1A_BRV1 Replicase polyprotein 1a OS=Breda virus 1 
OX=360393 GN=1a PE=3 SV=1
Length=4445

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 50/105 (48%), Gaps = 6/105 (6%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK--HC  1114
             VVN AN  LKHGGG+A  ++      +   S++YI     L V  +    G  L K    
Sbjct  1669  VVNPANNQLKHGGGIAKVISCMCGPKLTSWSNNYIKQYKKLGVTCAIRSPGFQLGKGVQI  1728

Query  1115  LHVVGPNVNKGEDIQLL----KSAYENFNQHEVLLAPLLSAGIFG  1155
             +HVVGP     + +  L    +S ++N      +L  +LS GIFG
Sbjct  1729  IHVVGPKSADSDVVNKLEASWRSVFQNVKPDTTVLTSMLSTGIFG  1773


 Score = 43.9 bits (102),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 76/154 (49%), Gaps = 15/154 (10%)

Query  3047  IVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL---MSFTVLCLTPVYSFLPG  3103
             +V   I  IV   L   ++     F  +++VV    LLF+   M   V+CL P+   +PG
Sbjct  2944  VVLVAIFTIVFLFLLRMYIVMYSYFKVFTYVVF--KLLFVNTVMVLFVVCLPPL---VPG  2998

Query  3104  VYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKR  3163
             V  V    L  +L + V FL ++  + +F  ++P++  + +++ +    F+W   +    
Sbjct  2999  VVFV----LALWLCDSVVFLLYLAVLSLF--ILPWFYVMLFVLIVGGFVFWWMMKSSDVV  3052

Query  3164  RVVFNGVSFS-TFEEAALCTFLLNKEMYLKLRSD  3196
              +  +G++F+ TFE+ + C F LN  +  +L  D
Sbjct  3053  HLTPDGLTFNGTFEQVSKCVFPLNPLIVNRLLLD  3086


> sp|D2TT52|YMDB_CITRI O-acetyl-ADP-ribose deacetylase OS=Citrobacter 
rodentium (strain ICC168) OX=637910 GN=ymdB PE=3 SV=2
Length=177

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 45/176 (26%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query  1034  LTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT  1093
             +   +++ + DI      V    +VNAAN  L  GGGV GA+++A    +          
Sbjct  1     MNSRIHVIHGDIT----TVAVDAIVNAANPSLMGGGGVDGAIHRAAGPELLEACMTVRRQ  56

Query  1094  NGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVL  1144
              G    G + + +   L AK  +H VGP    GE  + QLL  AY N       N ++ +
Sbjct  57    QGECPPGHAVITAAGRLPAKAVIHTVGPIWRGGEHNEAQLLHDAYLNSLNLALANGYQSI  116

Query  1145  LAPLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN---LYDKLVS  1188
               P +S G++G     +  + V+T+            +Y   +D+    LY +L++
Sbjct  117   AFPAISTGVYGYPRAAAAEIAVNTISEFITRRASPEQIYFVCYDEETTRLYQRLLT  172


> sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 
1 OX=360393 GN=rep PE=2 SV=1
Length=6733

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 50/105 (48%), Gaps = 6/105 (6%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAK--HC  1114
             VVN AN  LKHGGG+A  ++      +   S++YI     L V  +    G  L K    
Sbjct  1669  VVNPANNQLKHGGGIAKVISCMCGPKLTSWSNNYIKQYKKLGVTCAIRSPGFQLGKGVQI  1728

Query  1115  LHVVGPNVNKGEDIQLL----KSAYENFNQHEVLLAPLLSAGIFG  1155
             +HVVGP     + +  L    +S ++N      +L  +LS GIFG
Sbjct  1729  IHVVGPKSADSDVVNKLEASWRSVFQNVKPDTTVLTSMLSTGIFG  1773


 Score = 43.9 bits (102),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 76/154 (49%), Gaps = 15/154 (10%)

Query  3047  IVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFL---MSFTVLCLTPVYSFLPG  3103
             +V   I  IV   L   ++     F  +++VV    LLF+   M   V+CL P+   +PG
Sbjct  2944  VVLVAIFTIVFLFLLRMYIVMYSYFKVFTYVVF--KLLFVNTVMVLFVVCLPPL---VPG  2998

Query  3104  VYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKR  3163
             V  V    L  +L + V FL ++  + +F  ++P++  + +++ +    F+W   +    
Sbjct  2999  VVFV----LALWLCDSVVFLLYLAVLSLF--ILPWFYVMLFVLIVGGFVFWWMMKSSDVV  3052

Query  3164  RVVFNGVSFS-TFEEAALCTFLLNKEMYLKLRSD  3196
              +  +G++F+ TFE+ + C F LN  +  +L  D
Sbjct  3053  HLTPDGLTFNGTFEQVSKCVFPLNPLIVNRLLLD  3086


> sp|Q32E73|YMDB_SHIDS O-acetyl-ADP-ribose deacetylase OS=Shigella 
dysenteriae serotype 1 (strain Sd197) OX=300267 GN=ymdB 
PE=3 SV=1
Length=177

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 77/173 (45%), Gaps = 25/173 (14%)

Query  1037  NVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP  1096
              +++   DI     K+   V+VN  N  L  GGGV GA+++A   A+           G 
Sbjct  4     RIHVVQGDIT----KLAVDVIVNVTNPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGD  59

Query  1097  LKVGGSCV-LSGHNLAKHCLHVVGPNVNKGE--DIQLLKSAYEN------FNQHEVLLAP  1147
                G + + L+G   AK  +H VGP    GE  + QLL+ AY N       N +  +  P
Sbjct  60    CPTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFP  119

Query  1148  LLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDK---NLYDKLVS  1188
              +S G++G     +  + V TV            VY   +D+   +LY++L++
Sbjct  120   AISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLT  172


> sp|Q8RHQ2|Y1951_FUSNN Uncharacterized protein FN1951 OS=Fusobacterium 
nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 
101130 / JCM 8532 / LMG 13131) OX=190304 GN=FN1951 PE=4 SV=1
Length=175

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 7/82 (9%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCL  1115
             +VNAAN  L+ GGGV GA+ KA  + +  E  +     G    G + +  G+NL  K+ +
Sbjct  22    IVNAANSSLEMGGGVCGAIFKAAGSELAQECKEI----GGCNTGEAVITKGYNLPNKYII  77

Query  1116  HVVGPNVNKGE--DIQLLKSAY  1135
             H VGP  + GE  + + L SAY
Sbjct  78    HTVGPRYSTGENREAERLASAY  99


> sp|Q2EMV9|PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 
OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
Length=1817

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 16/125 (13%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHC  1114
             VVVNAAN  LKH  G+A AL+KA    +Q E D  +   G +  G + +     L   H 
Sbjct  829   VVVNAANENLKHISGLAQALSKAAGPELQTECDQIVKEGGVVLPGNAVISKAGKLPCHHV  888

Query  1115  LHVVGPNVNKGEDI--------QLLKSAYENFNQHEV--LLAPLLSAGIFGADPIHSLRV  1164
             +H VGP   KG+ +        ++++ +     +H    +  P +SAGIF       L +
Sbjct  889   IHAVGPRW-KGDKVLECVSLLKKVVRQSLSLAEEHRCRSIAMPAVSAGIFD----FPLEL  943

Query  1165  CVDTV  1169
             CV  +
Sbjct  944   CVANI  948


> sp|Q8Q0F9|Y177_METMA Macro domain-containing protein MM_0177 
OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 
/ Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_0177 PE=4 SV=1
Length=187

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 76/165 (46%), Gaps = 28/165 (17%)

Query  1036  DNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNG  1095
             D + I   DIV    K++   +VNAAN  L  GGGV GA+++A   A+  E       NG
Sbjct  19    DRIRIFEGDIV----KMRVDAIVNAANNTLLGGGGVDGAIHRAAGPALLEECK---TLNG  71

Query  1096  PLKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYENF------NQHEVLL  1145
                 G + + SG+ L AK+ +H VGP      KGED +LL S Y          + + + 
Sbjct  72    -CPTGEAKITSGYLLPAKYIIHTVGPVWQGGEKGED-ELLASCYRKSLELARDYKIKTIA  129

Query  1146  APLLSAGIFGADPIHSLRVCVDTVR---------TNVYLAVFDKN  1181
              P +S G +G     +  + V  V+           VYL  ++K+
Sbjct  130   FPAISTGAYGFPSERAAGIAVSQVKEFLQKNEIPETVYLVCYNKD  174


> sp|Q87JZ5|Y4103_VIBPA Macro domain-containing protein VPA0103 
OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) 
OX=223926 GN=VPA0103 PE=4 SV=1
Length=170

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQ---VESDDYIATNGPLKVGGSCVLSGHNL-AK  1112
             +VNAAN  +  GGGV GA+++A   A+       DD      P   G + +    NL A+
Sbjct  19    IVNAANPRMLGGGGVDGAIHRAAGPALINACYAVDDVDGIRCPF--GDARITEAGNLNAR  76

Query  1113  HCLHVVGPNVNKGEDIQ-LLKSAYEN------FNQHEVLLAPLLSAGIFGADPIHSLRVC  1165
             + +H VGP  +K  D + +L+SAY+        N  + +  P +S G++G  P  +  V 
Sbjct  77    YVIHAVGPIYDKFADPKTVLESAYQRSLDLALANHCQSVALPAISCGVYGYPPQEAAEVA  136

Query  1166  VDTVRTNVYLAVFDKNLY  1183
             +   +   Y A  D   Y
Sbjct  137   MAVCQRPEY-AALDMRFY  153


> sp|Q8RB30|Y995_CALS4 Macro domain-containing protein TTE0995 
OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain 
DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=TTE0995 
PE=4 SV=1
Length=175

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 47/154 (31%), Positives = 67/154 (44%), Gaps = 31/154 (20%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCL  1115
             +VNAAN  L  GGGV GA++KA   A+  E        G    G + +    NL AK+ +
Sbjct  20    IVNAANSSLIGGGGVDGAIHKAGGPAIAEELKVIREKQGGCPTGHAVITGAGNLKAKYVI  79

Query  1116  HVVGP---NVNKGEDIQLLKSAY-------ENFNQHEVLLAPLLSAGIFGADPIHSLRVC  1165
             H VGP     N  ED  LL SAY       + +N   +   P +S G +G     + R+ 
Sbjct  80    HAVGPIWKGGNHNED-NLLASAYIESLKLADEYNVKTIAF-PSISTGAYGFPVERAARIA  137

Query  1166  VDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQV  1199
             +                  ++VS +LE  S K+V
Sbjct  138   L------------------RVVSDYLEGSSIKEV  153


> sp|Q8TQD0|Y1614_METAC Macro domain-containing protein MA_1614 
OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 
/ JCM 12185 / C2A) OX=188937 GN=MA_1614 PE=4 SV=1
Length=195

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 78/166 (47%), Gaps = 22/166 (13%)

Query  1018  PVVQTIEVNSFSGYLKLTDN---VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGA  1074
             P  + ++ NS    L ++ N   + I   DI E    +K   +VNAAN  L  GGGV GA
Sbjct  6     PYKKELKRNSRKRSLNMSQNSERIRIIERDITE----LKVDAIVNAANNTLLGGGGVDGA  61

Query  1075  LNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQL  1130
             +++A    +  E       NG    G + +  G+ L AK+ +H VGP      KGED + 
Sbjct  62    IHRAAGPGLLEECR---TLNG-CPTGEAKITKGYLLPAKYVIHTVGPIWQEGTKGED-EF  116

Query  1131  LKSAY----ENFNQHEV--LLAPLLSAGIFGADPIHSLRVCVDTVR  1170
             L S Y    E   +++V  +  P +S G +G     + R+ V  V+
Sbjct  117   LASCYRKSLELARKYDVKTIAFPTISTGAYGFPSERAARIAVSQVK  162


> sp|Q8IXQ6|PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 
OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
Length=854

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 65/142 (46%), Gaps = 16/142 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCL  1115
             VVNAAN  L HGGG+A AL KA    +Q ES  ++A  G +  G   V     L  K  +
Sbjct  135   VVNAANEDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQII  194

Query  1116  HVVGPNVNKGE------DIQLLKSAYENF----NQH-EVLLAPLLSAGIFGADPIHSLRV  1164
             H VGP   + +       +Q    +  N+    N H + +  P LS+GIF       L +
Sbjct  195   HAVGPRWMEWDKQGCTGKLQRAIVSILNYVIYKNTHIKTVAIPALSSGIFQ----FPLNL  250

Query  1165  CVDTVRTNVYLAVFDKNLYDKL  1186
             C  T+   + +++  K +   L
Sbjct  251   CTKTIVETIRVSLQGKPMMSNL  272


> sp|E1PL40|YMDB2_PANVC O-acetyl-ADP-ribose deacetylase 2 OS=Pantoea 
vagans (strain C9-1) OX=712898 GN=ymdB2 PE=3 SV=1
Length=171

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 66/151 (44%), Gaps = 18/151 (12%)

Query  1052  VKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-  1110
             +    ++N AN  L  GGGV GA+++A    +  E     +  G  KVG + +     L 
Sbjct  14    IASEAIINVANSSLLGGGGVDGAIHRAGGPVILAECQAIRSRQGGCKVGEAVITGAGTLP  73

Query  1111  AKHCLHVVGPNVNKG---EDIQLLK---SAYENFNQHEVLLA--PLLSAGIFG-------  1155
             A + +H VGP  + G   ED QL     S ++    H +     P +S GI+G       
Sbjct  74    ADYVIHTVGPRWSDGRHNEDTQLKSVYLSCFKLVGHHGIKTVSFPNISTGIYGFPKKRAA  133

Query  1156  ADPIHSLRVCVDTVRT--NVYLAVFDKNLYD  1184
             A  +  ++ C+   RT   V L  FD   YD
Sbjct  134   AIALDVIKHCIAENRTIEKVNLVCFDAENYD  164


> sp|Q8BCR0|POLN_RUBVN Non-structural polyprotein p200 OS=Rubella 
virus (strain RN-UK86) OX=376267 PE=3 SV=1
Length=2116

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 62/154 (40%), Gaps = 18/154 (12%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+      A+  +    
Sbjct  812   YARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIFANATAALAADCRRL  869

Query  1091  IATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQLLKSAYENF------  1138
                  P   G +    GH     H +H V P   +      E   LL+ AY +       
Sbjct  870   ----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERAYRSIVALAAA  925

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTN  1172
              +   +  PLL AG++G     SLR  +   RT 
Sbjct  926   RRWACVACPLLGAGVYGWSAAESLRAALAATRTE  959


> sp|Q8Y2K1|Y334_RALSO Macro domain-containing protein RSc0334 
OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=RSc0334 
PE=4 SV=1
Length=171

 Score = 46.2 bits (108),  Expect = 0.001, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 13/123 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCL  1115
             +VNAAN  L  GGGV GA+++A    +    +   A +G  + G + +  G  L A++ +
Sbjct  23    IVNAANSALLGGGGVDGAIHRAAGPELL---EACRALHG-CRTGQAKITPGFLLPARYII  78

Query  1116  HVVGPNVNKG--EDIQLLKSAYEN----FNQHEV--LLAPLLSAGIFGADPIHSLRVCVD  1167
             H VGP    G  ++  LL + Y N      QH+V  +  P +S G++G  P  +  + V 
Sbjct  79    HTVGPIWRGGRQDEAALLAACYRNSLALAKQHDVRTIAFPCISTGVYGFPPQLAAPIAVR  138

Query  1168  TVR  1170
             TVR
Sbjct  139   TVR  141


> sp|P13889|POLN_RUBVT Non-structural polyprotein p200 OS=Rubella 
virus (strain Therien) OX=11045 PE=3 SV=5
Length=2116

 Score = 48.1 bits (113),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 61/154 (40%), Gaps = 18/154 (12%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+      A+       
Sbjct  812   YARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIFANATAALAANCRRL  869

Query  1091  IATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQLLKSAYENF------  1138
                  P   G +    GH     H +H V P   +      E   LL+ AY +       
Sbjct  870   ----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERAYRSIVALAAA  925

Query  1139  NQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTN  1172
              +   +  PLL AG++G     SLR  +   RT 
Sbjct  926   RRWACVACPLLGAGVYGWSAAESLRAALAATRTE  959


> sp|Q9EYI6|Y189_STRNO Macro domain-containing protein in sno 5'region 
OS=Streptomyces nogalater OX=38314 PE=4 SV=1
Length=181

 Score = 45.4 bits (106),  Expect = 0.003, Method: Composition-based stats.
 Identities = 47/144 (33%), Positives = 67/144 (47%), Gaps = 16/144 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT--NGPLKVGGSCVLSGHNL-AKH  1113
             +VNAAN  L  GGGV GA+++    A+  E     A+     L  G +   +  +L A+ 
Sbjct  19    LVNAANSSLLGGGGVDGAIHRRGGPAILAECRALRASRYGEGLPTGRAVATTAGDLDARW  78

Query  1114  CLHVVGPNVNKGED-IQLLKSAY-ENFNQHEVLLA-----PLLSAGIFGADPIHSLRVCV  1166
              +H VGP  +  ED   LL S Y E+      L A     P LS G++      + R+ V
Sbjct  79    VIHTVGPVWSSTEDRSDLLASCYRESLRLAGELGARTVAFPALSTGVYRWPMGDAARIAV  138

Query  1167  DTVRTN------VYLAVFDKNLYD  1184
             +TVRT       V   +FD + YD
Sbjct  139   ETVRTTPTAVEEVRFVLFDTHAYD  162


> sp|O40955|POLN_RUBVR Non-structural polyprotein p200 OS=Rubella 
virus (strain RA27/3 vaccine) OX=11044 PE=1 SV=1
Length=2116

 Score = 47.8 bits (112),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 60/154 (39%), Gaps = 18/154 (12%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+      A+  +    
Sbjct  812   YARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIFANATAALAADCRRL  869

Query  1091  IATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQLLKSAYENFNQHEVL  1144
                  P   G +    GH     H +H V P   +      E   LL+ AY +       
Sbjct  870   ----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERAYRSIVALAAA  925

Query  1145  LA------PLLSAGIFGADPIHSLRVCVDTVRTN  1172
                     PLL AG++G     SLR  +   RT 
Sbjct  926   RRWARVACPLLGAGVYGWSAAESLRAALAATRTE  959


> sp|Q97AU0|Y719_THEVO Uncharacterized protein TV0719 OS=Thermoplasma 
volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / 
NBRC 15438 / GSS1) OX=273116 GN=TV0719 PE=4 SV=1
Length=186

 Score = 45.1 bits (105),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 12/110 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP--LKVGGSCVLSGHNL-AKH  1113
             +VNAAN  L  GGGV GA++      + +E  +   T  P  L  G + + SG  L AK+
Sbjct  26    IVNAANPSLMGGGGVDGAIHLKGGKTIDLECAELRRTKWPKGLPPGEADITSGGKLKAKY  85

Query  1114  CLHVVGPNVNKG--EDIQLLKSAY----ENFNQHEV--LLAPLLSAGIFG  1155
              +H VGP + +G  ED + L S+Y    E    H +  +  P +S GI+G
Sbjct  86    VIHTVGP-IYRGQEEDAETLYSSYYRSLEIAKIHGIKCIAFPAISTGIYG  134


> sp|Q8KAE4|Y2219_CHLTE Macro domain-containing protein CT2219 
OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 
103806 / TLS) OX=194439 GN=CT2219 PE=4 SV=1
Length=172

 Score = 44.7 bits (104),  Expect = 0.004, Method: Composition-based stats.
 Identities = 45/148 (30%), Positives = 66/148 (45%), Gaps = 19/148 (13%)

Query  1034  LTDNVYIK--NADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYI  1091
             + DNV I    ADI      +    +VNAAN  L  GGGV GA+++A    +     +  
Sbjct  1     MPDNVLIHAIKADITS----LTVDAIVNAANTSLLGGGGVDGAIHRAAGPKLLEACREL-  55

Query  1092  ATNGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYEN-----FNQHEV  1143
                G    G + +  G+ L A   +H VGP  + G   + +LL S Y N        H  
Sbjct  56    ---GGCLTGEAKITKGYRLPATFVIHTVGPVWHGGNHGEAELLASCYRNSLKLAIEHHCR  112

Query  1144  LLA-PLLSAGIFGADPIHSLRVCVDTVR  1170
              +A P +S GI+G     +  + + TVR
Sbjct  113   TIAFPSISTGIYGYPVEQAAAIAITTVR  140


> sp|Q985D2|Y7730_RHILO Macro domain-containing protein mll7730 
OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / 
MAFF 303099) OX=266835 GN=mll7730 PE=4 SV=1
Length=176

 Score = 44.7 bits (104),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query  1033  KLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIA  1092
             K  D + I   DI     K+    +VNAAN  L  GGGV GA+++A    ++VE      
Sbjct  3     KALDRIRIHTGDIT----KLDVDAIVNAANTLLLGGGGVDGAIHRAAGRELEVECR---M  55

Query  1093  TNGPLKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYEN------FNQHE  1142
              NG  KVG + +  G+ L A+H +H VGP      KGE  +LL S Y +       N   
Sbjct  56    LNG-CKVGDAKITKGYKLPARHIIHTVGPVWQGGGKGE-AELLASCYRSSLELAAANDCR  113

Query  1143  VLLAPLLSAGIF  1154
              +  P +S G++
Sbjct  114   SVAFPAISTGVY  125


> sp|Q93SX7|Y189_ACISE Macro domain-containing protein OS=Acinetobacter 
sp. (strain ED45-25) OX=194927 PE=4 SV=1
Length=183

 Score = 44.3 bits (103),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 61/140 (44%), Gaps = 21/140 (15%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             V++  ADI   A       +VN+AN  L  GGG+   ++K     M+ E        G  
Sbjct  4     VHLIQADITAFAVHA----IVNSANKSLLGGGGLDYVIHKKAGPLMKEECVRLNQEKGGC  59

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVNKGE--DIQLLKSAYENFNQHEVLLAPLLSAGIF  1154
               G + V +  NL AK+ +H VGP    GE  + QLL  AY N               +F
Sbjct  60    PTGQAEVTTAGNLPAKYLIHAVGPRWLDGEHNEPQLLCDAYSN--------------ALF  105

Query  1155  GADPIHSLRVCVDTVRTNVY  1174
              A+ IH+L V    + T VY
Sbjct  106   KANEIHALTVSFPCISTGVY  125


> sp|Q88SK6|Y3408_LACPL Macro domain-containing protein lp_3408 
OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 
/ WCFS1) OX=220668 GN=lp_3408 PE=4 SV=1
Length=172

 Score = 43.9 bits (102),  Expect = 0.009, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 19/116 (16%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL---KVGGSCVLSG  1107
             K+    +VNAAN  L  GGGV GA+++A   A+       +A   PL     G + +  G
Sbjct  13    KMTVDAIVNAANTSLLGGGGVDGAIHRAAGPAL-------LAACRPLHGCATGEAKITPG  65

Query  1108  HNL-AKHCLHVVGPNVNKGE--DIQLLKSAYENF------NQHEVLLAPLLSAGIF  1154
               L AK+ +H  GP    G+  ++QLL ++Y N       N  + +  P +S G++
Sbjct  66    FRLPAKYVIHTPGPVWQGGQHNELQLLANSYRNSLNLAAENHCQTVAFPSISTGVY  121


> sp|O59182|Y1513_PYRHO Uncharacterized protein PH1513 OS=Pyrococcus 
horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 
/ NBRC 100139 / OT-3) OX=70601 GN=PH1513 PE=4 SV=1
Length=190

 Score = 43.5 bits (101),  Expect = 0.013, Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 35/165 (21%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQ------------------VESDDYIA  1092
             K +   +VNAAN YL+HGGGVA A+ KA +  +                   +E  + + 
Sbjct  14    KFRAEAIVNAANKYLEHGGGVAYAIAKAASGDVSEYTRISKEEMRRQLGKDWIEHGEVVV  73

Query  1093  TNGPLKVGGSCVLSGHNLAKHCLHVVGP------NVNKGEDIQL-LKSAYENFNQHEV--  1143
             T  P+K+         N  K+ +H VGP      + +K E ++L +  A +  ++  V  
Sbjct  74    TP-PMKL-------KENGVKYVIHTVGPYCGGVWSKDKEEKLKLAILGALKKADELGVKS  125

Query  1144  LLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVS  1188
             +  P +SAGI+G      +R   + V+  + +A   K +Y  L S
Sbjct  126   IAFPAISAGIYGCPLKEVVRTFKEVVKEFLKVANHVKEVYLVLYS  170


> sp|Q9V0Y3|Y656_PYRAB Uncharacterized protein PYRAB06560 OS=Pyrococcus 
abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06560 
PE=4 SV=2
Length=183

 Score = 43.1 bits (100),  Expect = 0.016, Method: Composition-based stats.
 Identities = 44/162 (27%), Positives = 81/162 (50%), Gaps = 28/162 (17%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKA----TNNAMQVESDDYIATNGP--LKVGGSCV  1104
             + K   +VNAAN YL+HGGGVA A+ KA     +  +++  ++     G   ++ G   V
Sbjct  11    RFKAEAIVNAANKYLEHGGGVAYAIAKAASGDVSEYIRISKEEMRKQIGRDWIEHGEVVV  70

Query  1105  LSGHNLA----KHCLHVVGP------NVNKGEDIQL-LKSAYENFNQHEV--LLAPLLSA  1151
                 NLA    K+ +H VGP      + +K + ++L +  A +  ++  V  +  P +SA
Sbjct  71    TPPLNLAKNGVKYVIHTVGPYCGGKWDEDKRKKLELAILGALKKADELGVRSIAFPAISA  130

Query  1152  GIFGA---DPIHSLRVCVDTVR------TNVYLAVFDKNLYD  1184
             GI+G    + + + ++ V+         T+VYL ++ +  Y+
Sbjct  131   GIYGCPLEEVVKTFKLVVNEFLKSAKNVTDVYLVLYSERDYE  172


> sp|P27283|POLN_SINDO Polyprotein P1234 OS=Sindbis virus subtype 
Ockelbo (strain Edsbyn 82-5) OX=31699 PE=3 SV=2
Length=2515

 Score = 45.4 bits (106),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 75/167 (45%), Gaps = 34/167 (20%)

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
             AD  EEA       VVNAAN   + G GV  A+ K   N+          T+   + G +
Sbjct  1359  ADCQEEA-------VVNAANPLGRPGEGVCRAIYKRWPNSF---------TDSATETGTA  1402

Query  1103  CVLSGHNLAKHCLHVVGPNVNK---GEDIQLLKSAYEN----FNQHEV--LLAPLLSAGI  1153
              +   H   K  +H VGP+  K    E ++LL++AY       N+H +  +  PLLS GI
Sbjct  1403  KLTVCH--GKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGI  1460

Query  1154  FGADP------IHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK  1194
             + A        ++ L   +D    +V +   DK   ++ + + L++K
Sbjct  1461  YAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKER-IDAVLQLK  1506


> sp|Q8P5Z8|Y3184_XANCP Macro domain-containing protein XCC3184 
OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 
/ DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC3184 
PE=4 SV=1
Length=179

 Score = 42.7 bits (99),  Expect = 0.020, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 13/127 (10%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP---LKVGGSCVLSGHNL-A  1111
             V+VNAAN  L  GGGV GA+++A    + +E+ + +    P      G   +  G +L A
Sbjct  17    VIVNAANESLLGGGGVDGAIHRAAGPRL-LEACEALPEVRPGVRCPTGEIRITDGFDLKA  75

Query  1112  KHCLHVVGPNVNKG---EDIQLLKSAYENFNQHEVLLA-----PLLSAGIFGADPIHSLR  1163
             +H  H VGP    G   E  QL    +++    E ++      P +S GI+G     + R
Sbjct  76    RHIFHTVGPVWRDGKHNEPEQLANCYWQSLKLAEQMMLHSIAFPAISCGIYGYPLYQAAR  135

Query  1164  VCVDTVR  1170
             + V   R
Sbjct  136   IAVTETR  142


> sp|Q8PHB6|Y3343_XANAC Macro domain-containing protein XAC3343 
OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 
GN=XAC3343 PE=4 SV=2
Length=179

 Score = 42.7 bits (99),  Expect = 0.021, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 15/128 (12%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGP---LKVGGSCVLSGHNL-A  1111
             V+VNAAN  L  GGGV GA+++A    + +E+ + +    P      G   +  G +L A
Sbjct  17    VIVNAANESLLGGGGVDGAIHRAAGPRL-LEACEALPQVRPGVRCPTGEIRITDGFDLKA  75

Query  1112  KHCLHVVGPNVNKG---EDIQLLKSAYENFNQHEVLLA-----PLLSAGIFGADPIH-SL  1162
             +H  H VGP    G   E  QL    +++    E ++      P +S GI+G  P+H + 
Sbjct  76    RHIFHTVGPVWRDGRHNEPEQLANCYWQSLKLAEQMMLHSIAFPAISCGIYGY-PLHQAA  134

Query  1163  RVCVDTVR  1170
             R+ V   R
Sbjct  135   RIAVTETR  142


> sp|Q99IE7|POLN_RUBVO Non-structural polyprotein p200 OS=Rubella 
virus (strain TO-336 vaccine) OX=376265 PE=3 SV=1
Length=2116

 Score = 44.7 bits (104),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 60/151 (40%), Gaps = 18/151 (12%)

Query  1017  TPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALN  1076
             TP     + +    Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+ 
Sbjct  798   TPTKADPDSDIVESYARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIF  855

Query  1077  KATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQL  1130
                  A+  +         P   G +    GH     H +H V P   +      E   L
Sbjct  856   ANATAALAADCRRL----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEAL  911

Query  1131  LKSAYENF------NQHEVLLAPLLSAGIFG  1155
             L+ AY +        +   +  PLL AG++G
Sbjct  912   LERAYRSIVALAAARRWACVACPLLGAGVYG  942


> sp|Q99IE5|POLN_RUBVV Non-structural polyprotein p200 OS=Rubella 
virus (strain TO-336) OX=376264 PE=3 SV=1
Length=2116

 Score = 44.7 bits (104),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 60/151 (40%), Gaps = 18/151 (12%)

Query  1017  TPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALN  1076
             TP     + +    Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+ 
Sbjct  798   TPTKADPDSDIVESYARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIF  855

Query  1077  KATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQL  1130
                  A+  +         P   G +    GH     H +H V P   +      E   L
Sbjct  856   ANATAALAADCRRL----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEAL  911

Query  1131  LKSAYENF------NQHEVLLAPLLSAGIFG  1155
             L+ AY +        +   +  PLL AG++G
Sbjct  912   LERAYRSIVALAAARRWACVACPLLGAGVYG  942


> sp|Q9HJ67|Y1105_THEAC Uncharacterized protein Ta1105 OS=Thermoplasma 
acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 
/ NBRC 15155 / AMRC-C165) OX=273075 GN=Ta1105 PE=4 SV=2
Length=196

 Score = 42.7 bits (99),  Expect = 0.027, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 19/128 (15%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAM-----QVESDDYIATNGPLKVGGSCVLSGHNL-  1110
             +VNAAN  L  GGGV GA++ A    +     ++  + Y   NG L  G + +  G+ L 
Sbjct  26    IVNAANSSLMGGGGVDGAIHSAAGPELNGELVKIRRERY--PNG-LPPGEAVITRGYRLK  82

Query  1111  AKHCLHVVGP---NVNKGEDIQLLKS------AYENFNQHEVLLAPLLSAGIFGADPIHS  1161
             A H +H VGP       GED  L +S          F  H++   P LS G +G     +
Sbjct  83    ASHIIHTVGPVWMGGRNGEDDVLYRSYRSCLDLAREFGIHDIAF-PALSTGAYGFPFDRA  141

Query  1162  LRVCVDTV  1169
              R+ + +V
Sbjct  142   ERIAIRSV  149


> sp|Q6X2U2|POLN_RUBVC Non-structural polyprotein p200 OS=Rubella 
virus (strain BRDII) OX=376263 PE=3 SV=1
Length=2116

 Score = 44.3 bits (103),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 69/165 (42%), Gaps = 22/165 (13%)

Query  1007  EVQPQLEME----LTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAAN  1062
             + +P++  E     TP     + +    Y +    V+++  +I++     K  VVVNAAN
Sbjct  784   DAEPEVACEPGGPATPARADPDSDIVESYARAAGPVHLRVRNIMDPPPGCK--VVVNAAN  841

Query  1063  VYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCLHVVGPN  1121
               L  G GV GA+  A+  A   E    +A   P   G +    GH     H +H V P 
Sbjct  842   EGLLAGSGVCGAIF-ASAAASLAEDCRRLA---PCPTGEAVATPGHGCGYAHIIHAVAPR  897

Query  1122  VNKG-----EDIQLLKSAYENF------NQHEVLLAPLLSAGIFG  1155
               +      +   LL+ AY +        +   +  PLL AGI+G
Sbjct  898   RPQDPAALEQSEALLERAYRSIVALAAARRWTCVACPLLGAGIYG  942


> sp|Q6X2U4|POLN_RUBVB Non-structural polyprotein p200 OS=Rubella 
virus (strain BRD1) OX=376262 PE=3 SV=1
Length=2116

 Score = 44.3 bits (103),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 69/165 (42%), Gaps = 22/165 (13%)

Query  1007  EVQPQLEME----LTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAAN  1062
             + +P++  E     TP     + +    Y +    V+++  +I++     K  VVVNAAN
Sbjct  784   DAEPEVACEPGGPATPTRADPDSDIVESYARAAGPVHLRVRNIMDPPPGCK--VVVNAAN  841

Query  1063  VYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLA-KHCLHVVGPN  1121
               L  G GV GA+  A+  A   E    +A   P   G +    GH     H +H V P 
Sbjct  842   EGLLAGSGVCGAIF-ASAAATLAEDCRRLA---PCPTGEAVATPGHGCGYTHIIHAVAPR  897

Query  1122  VNKG-----EDIQLLKSAYENF------NQHEVLLAPLLSAGIFG  1155
               +      +   LL+ AY +        +   +  PLL AGI+G
Sbjct  898   RPQDPAALEQSEALLERAYRSVVALAAARRWACVACPLLGAGIYG  942


> sp|Q86924|POLN_AURAV Polyprotein P1234 OS=Aura virus OX=44158 
PE=3 SV=3
Length=2499

 Score = 43.9 bits (102),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 85/183 (46%), Gaps = 35/183 (19%)

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
             AD  EEA       VVNAAN   K G GV  A+ K    + +         N   +V  +
Sbjct  1357  ADCTEEA-------VVNAANARGKPGDGVCRAIFKKWPKSFE---------NATTEVETA  1400

Query  1103  CVLSGHNLAKHCLHVVGPNVNK---GEDIQLLKSAYEN----FNQHEV--LLAPLLSAGI  1153
              +   HN  K  +H VGP+  K    E  +LL++AY +     N+  +  +  PLLS GI
Sbjct  1401  VMKPCHN--KVVIHAVGPDFRKYTLEEATKLLQNAYHDVAKIVNEKGISSVAIPLLSTGI  1458

Query  1154  F--GADPIH-SLR---VCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIP  1207
             +  GAD +  SLR     +D    +V +   DK  +++ ++  + M+ E+  E K  +I 
Sbjct  1459  YAAGADRLDLSLRCLFTALDRTDADVTIYCLDKK-WEQRIADAIRMR-EQVTELKDPDIE  1516

Query  1208  KEE  1210
              +E
Sbjct  1517  IDE  1519


> sp|Q6PAV8|MACD2_XENLA ADP-ribose glycohydrolase MACROD2 OS=Xenopus 
laevis OX=8355 GN=macrod2 PE=2 SV=1
Length=418

 Score = 43.1 bits (100),  Expect = 0.054, Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 92/204 (45%), Gaps = 42/204 (21%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCL  1115
             +VNAAN  L  GGGV G +++A+  ++  E  +     G  + G + +  G+ L AK+ +
Sbjct  85    IVNAANTSLLGGGGVDGCIHRASGPSLLAECREL----GGCETGQAKITCGYELPAKYVI  140

Query  1116  HVVGPNVNKGE----DIQLLKSAYENF------NQHEVLLAPLLSAGIFGADPIHSLRVC  1165
             H VGP + +G       Q L S Y +       N    +  P +S GI+G     +  V 
Sbjct  141   HTVGP-IARGHITPNHKQDLASCYNSSLTLATENDIRTIAFPCISTGIYGYPNEPAANVA  199

Query  1166  VDTVRT----------NVYLAVF---DKNLYDKLVSSFL--EMKSEKQVEQKIAEIPKEE  1210
             + TV+            V   VF   D  +Y + ++ F   +   +++ E+  ++  KE+
Sbjct  200   LTTVKEFLKKNRDKIDRVIFCVFLEVDFKIYKRKLNEFFPKDGGDDEEGEKGDSDEMKED  259

Query  1211  VKPFITESKPS------VEQRKQD  1228
                  TE KP       ++++K+D
Sbjct  260   -----TEGKPQSPPMKKIKEKKED  278


> sp|Q9BQ69|MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo 
sapiens OX=9606 GN=MACROD1 PE=1 SV=2
Length=325

 Score = 42.7 bits (99),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 24/150 (16%)

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
             V   +E   +    +L + + +  +DI     K++   +VNAAN  L  GGGV G +++A
Sbjct  135   VAVKVEEPRYKKDKQLNEKISLLRSDIT----KLEVDAIVNAANSSLLGGGGVDGCIHRA  190

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE----DIQLLKS  1133
                 +     D   T    K G + +  G+ L AK+ +H VGP +  GE        L+S
Sbjct  191   AGPLLT----DECRTLQSCKTGKAKITGGYRLPAKYVIHTVGP-IAYGEPSASQAAELRS  245

Query  1134  AYENFNQHEVLLA--------PLLSAGIFG  1155
              Y   +  ++LL         P +S G+FG
Sbjct  246   CY--LSSLDLLLEHRLRSVAFPCISTGVFG  273


> sp|Q9ZBG3|Y6450_STRCO Macro domain-containing protein SCO6450 
OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) 
OX=100226 GN=SCO6450 PE=4 SV=1
Length=169

 Score = 41.2 bits (95),  Expect = 0.071, Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 16/148 (11%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATN--GPLKVGGSCVLSGHNL-AKH  1113
             +VNAAN  L  GGGV GA+++    A+  E     A +    L  G +   +  +L A+ 
Sbjct  19    IVNAANSSLLGGGGVDGAIHRRGGPAILAECRRLRAGHLGKGLPTGRAVATTAGDLDARW  78

Query  1114  CLHVVGPNVNKGEDIQ-LLKSAY-ENFNQHEVLLA-----PLLSAGIFGADPIHSLRVCV  1166
              +H VGP  +  ED   LL S Y E+    + L A     P +S G++      + R+ V
Sbjct  79    VIHTVGPVWSATEDRSGLLASCYRESLRTADELGARTVAFPAISTGVYRWPMDDAARIAV  138

Query  1167  DTVRTN------VYLAVFDKNLYDKLVS  1188
             +TV T       +   +FD   Y+   +
Sbjct  139   ETVATTKTSVTEIRFVLFDARAYEAFAA  166


> sp|Q86500|POLN_RUBVM Non-structural polyprotein p200 OS=Rubella 
virus (strain M33) OX=11043 PE=1 SV=2
Length=2116

 Score = 42.7 bits (99),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 55/137 (40%), Gaps = 18/137 (13%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+      A+  +    
Sbjct  812   YARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIFANATAALAADCRRL  869

Query  1091  IATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQLLKSAYENFNQHEVL  1144
                  P  +G +    GH     H +H V P   +      E   LL+ AY +       
Sbjct  870   ----APCPIGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERAYRSIVALAAA  925

Query  1145  LA------PLLSAGIFG  1155
                     PLL AG++G
Sbjct  926   RRWARVACPLLGAGVYG  942


> sp|Q9J6K9|POLN_RUBVD Non-structural polyprotein p200 OS=Rubella 
virus (strain Cendehill) OX=376266 PE=3 SV=2
Length=2116

 Score = 42.7 bits (99),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 56/137 (41%), Gaps = 18/137 (13%)

Query  1031  YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDY  1090
             Y +    V+++  DI++     K  VVVNAAN  L  G GV GA+      A+  +    
Sbjct  812   YARAAGPVHLRVRDIMDPPPGCK--VVVNAANEGLLAGSGVCGAIFANATAALAADCRRL  869

Query  1091  IATNGPLKVGGSCVLSGHNLA-KHCLHVVGPNVNKG-----EDIQLLKSAYENF------  1138
                  P   G +    GH     H +H V P   +      E   LL+ AY +       
Sbjct  870   ----APCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERAYRSIVALAAA  925

Query  1139  NQHEVLLAPLLSAGIFG  1155
              +   +  PLL AG++G
Sbjct  926   RRWAYVACPLLGAGVYG  942


> sp|Q8K4G6|MACD1_RAT ADP-ribose glycohydrolase MACROD1 (Fragment) 
OS=Rattus norvegicus OX=10116 GN=Macrod1 PE=2 SV=2
Length=258

 Score = 41.6 bits (96),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (45%), Gaps = 22/150 (15%)

Query  1033  KLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIA  1092
             +L + + +   DI     K++   +VNAAN  L  GGGV G +++A  + +     D   
Sbjct  82    QLNEKISLFRGDIT----KLEVDAIVNAANNSLLGGGGVDGCIHRAAGSLLT----DECR  133

Query  1093  TNGPLKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYENFNQHEVLLA--  1146
             T    + G + +  G+ L AKH +H VGP             L+S Y   +  ++LL   
Sbjct  134   TLQNCETGKAKITCGYRLPAKHVIHTVGPIAVGQPTASQAAELRSCY--LSSLDLLLEHR  191

Query  1147  ------PLLSAGIFGADPIHSLRVCVDTVR  1170
                   P +S G+FG     +  V + T+R
Sbjct  192   LRSVAFPCISTGVFGYPNEEAAEVVLATLR  221


> sp|P03317|POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=11034 
PE=1 SV=2
Length=2513

 Score = 42.4 bits (98),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 33/184 (18%)

Query  1043  ADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGS  1102
             AD  EEA       VVNAAN   + G GV  A+ K    +      D     G  ++   
Sbjct  1359  ADCQEEA-------VVNAANPLGRPGEGVCRAIYKRWPTSFT----DSATETGTARMT-V  1406

Query  1103  CVLSGHNLAKHCLHVVGPNVNK---GEDIQLLKSAYEN----FNQHEV--LLAPLLSAGI  1153
             C      L K  +H VGP+  K    E ++LL++AY       N+H +  +  PLLS GI
Sbjct  1407  C------LGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGI  1460

Query  1154  FGADP------IHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIP  1207
             + A        ++ L   +D    +V +   DK   +++ ++    +S  +++ +  EI 
Sbjct  1461  YAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEID  1520

Query  1208  KEEV  1211
              E V
Sbjct  1521  DELV  1524


> sp|Q306W6|POLN_EEEV1 Polyprotein P1234 OS=Eastern equine encephalitis 
virus (strain PE-0.0155) OX=374596 PE=3 SV=3
Length=2471

 Score = 42.4 bits (98),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 75/183 (41%), Gaps = 48/183 (26%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHC-  1114
             V+VNAAN   + G GV GAL K    A             P+  G +      +L KH  
Sbjct  1345  VIVNAANNKGQPGAGVCGALYKKWPGAFD---------KAPIATGTA------HLVKHTP  1389

Query  1115  --LHVVGPNVNKGEDI---QLLKSAYE------NFNQHEVLLAPLLSAGIF--GADPI--  1159
               +H VGPN ++  ++   Q L   Y       N  ++  +  PLLS G++  G D +  
Sbjct  1390  NIIHAVGPNFSRMSEVEGNQKLSEVYMDIAKIINKERYNKVSIPLLSTGVYAGGKDRVMQ  1449

Query  1160  --HSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITE  1217
               + L   +DT   +V +   DK               E +++  IA   KE V+  + +
Sbjct  1450  SLNHLFTAMDTTDADVTIYCLDKQW-------------ETRIKDAIAR--KESVEELVED  1494

Query  1218  SKP  1220
              KP
Sbjct  1495  DKP  1497


> sp|O28751|Y1521_ARCFU ADP-ribose glycohydrolase AF_1521 OS=Archaeoglobus 
fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / 
JCM 9628 / NBRC 100126) OX=224325 GN=AF_1521 PE=1 SV=2
Length=192

 Score = 40.4 bits (93),  Expect = 0.15, Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 68/152 (45%), Gaps = 30/152 (20%)

Query  1057  VVNAANVYLKHGGGVAGALNKA-----------TNNAMQVE-SDDYIATNGPLKVGGSCV  1104
             +VNAAN  L+HGGGVA A+ KA           +  AM+ +   DYI  +G + V  +  
Sbjct  29    IVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDYI-DHGEVVVTPAMN  87

Query  1105  LSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENF---------NQHEVLLAPLLSAGIFG  1155
             L    + K+  H VGP  +     +L +  Y+ F            E +  P +SAGI+G
Sbjct  88    LEERGI-KYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYG  146

Query  1156  ADPIHSLRVCVDTVRT-------NVYLAVFDK  1180
              D    +   ++ V+         V L ++D+
Sbjct  147   CDLEKVVETFLEAVKNFKGSAVKEVALVIYDR  178


> sp|Q44020|YGB2_CUPNE Macro domain-containing protein in gbd 3'region 
OS=Cupriavidus necator OX=106590 PE=4 SV=1
Length=173

 Score = 40.0 bits (92),  Expect = 0.17, Method: Composition-based stats.
 Identities = 39/109 (36%), Positives = 58/109 (53%), Gaps = 11/109 (10%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCL  1115
             +VNAAN  L  GGGV GA++ A  +A++        T G    G + + +G +L A + +
Sbjct  21    IVNAANSGLLGGGGVDGAIHGAGGSAIKEACRAIRDTQGGCPTGEAVITTGGHLPAPYVI  80

Query  1116  HVVGP---NVNKGEDIQLLKSAYEN----FNQHEV--LLAPLLSAGIFG  1155
             H VGP     ++GED +LL +AY N      QH +  L  P +S GI+ 
Sbjct  81    HAVGPVWQGGDQGED-ELLANAYRNSIRLAAQHHLRRLAFPNISTGIYA  128


> sp|Q2KHU5|MACD1_BOVIN ADP-ribose glycohydrolase MACROD1 OS=Bos 
taurus OX=9913 GN=MACROD1 PE=2 SV=1
Length=325

 Score = 40.8 bits (94),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 20/148 (14%)

Query  1019  VVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKA  1078
             V   +E   +    +L + + +   DI     K++   +VNAAN  L  GGGV G +++A
Sbjct  135   VTVKVEEPKYKKDKQLNEKISLFRGDIT----KLEVDAIVNAANSSLLGGGGVDGCIHRA  190

Query  1079  TNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHCLHVVGPNVNKGE----DIQLLKS  1133
                 +     D   T    + G + +  G+ L AK+ +H VGP +  GE        L+S
Sbjct  191   AGPLLT----DECRTLQNCETGKAKITCGYRLPAKYVIHTVGP-IAHGEPSASQAAELRS  245

Query  1134  AY----ENFNQHEVLLA--PLLSAGIFG  1155
              Y    +   +H +  A  P +S G+FG
Sbjct  246   CYLSSLDLLLEHRLRSAAFPCISTGVFG  273


> sp|Q9YBE9|Y1648_AERPE Uncharacterized protein APE_1648.1 OS=Aeropyrum 
pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / 
NBRC 100138 / K1) OX=272557 GN=APE_1648.1 PE=4 SV=2
Length=189

 Score = 40.0 bits (92),  Expect = 0.21, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query  1051  KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL  1110
             KV+   VVN AN  +  GGG AGAL +A  + ++ E+        P+ VG + + SG +L
Sbjct  20    KVRAEAVVNPANSLMIMGGGAAGALKRAGGSVIEEEA----MRKAPVPVGEAVITSGGSL  75

Query  1111  -AKHCLH  1116
              A+  +H
Sbjct  76    PARFVIH  82


> sp|P13896|POLN_WEEV Polyprotein P1234 OS=Western equine encephalitis 
virus OX=11039 PE=3 SV=3
Length=2467

 Score = 41.2 bits (95),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 66/157 (42%), Gaps = 33/157 (21%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH---  1113
             +VNAAN   + G GV GAL +    A   +         P+ VG +       L KH   
Sbjct  1346  IVNAANSKGQPGSGVCGALYRKWPAAFDRQ---------PIAVGTA------RLVKHEPL  1390

Query  1114  CLHVVGPNVNKGEDIQ---LLKSAYE------NFNQHEVLLAPLLSAGIF--GADPI---  1159
              +H VGPN +K  + +    L +AY       N  +   +  PLLS GI+  G D +   
Sbjct  1391  IIHAVGPNFSKMPEPEGDLKLAAAYMSIASIVNAERITKISVPLLSTGIYSGGKDRVMQS  1450

Query  1160  -HSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKS  1195
              H L    DT   +V +   DK    +++ +    +S
Sbjct  1451  LHHLFTAFDTTDADVTIYCLDKQWETRIIEAIHRKES  1487


> sp|Q9VHM2|VP35L_DROME VPS35 endosomal protein sorting factor-like 
OS=Drosophila melanogaster OX=7227 GN=CG8202 PE=2 SV=3
Length=942

 Score = 40.8 bits (94),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query  3702  DDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLA------  3755
             DD  R++  L+NV   ++KV++GN L+Q +S +       SN   V  T++  A      
Sbjct  609   DDERRQIAQLINVF--IHKVHFGNDLEQQLSFYVEARGTFSNLDAVYVTLVHAACKLATR  666

Query  3756  -----RGIVFMCVEYCPIFFITGNTLQCIMLVYCFLG  3787
                   G V  C+ YC I   +   +Q  M +Y   G
Sbjct  667   NRSKSTGFVKACIAYCFITIPSIEAVQQQMNLYLLCG  703


> sp|Q306W8|POLN_EEEV8 Polyprotein P1234 OS=Eastern equine encephalitis 
virus (strain PE-3.0815) OX=374597 PE=3 SV=3
Length=2474

 Score = 40.4 bits (93),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 74/182 (41%), Gaps = 48/182 (26%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHC--  1114
             +VNAAN   + G GV GAL K    A             P+  G +      +L KH   
Sbjct  1346  IVNAANNKGQPGAGVCGALYKKWPGAFD---------KVPIATGTA------HLVKHTPN  1390

Query  1115  -LHVVGPNVNKGEDI---QLLKSAYE------NFNQHEVLLAPLLSAGIF--GADPI---  1159
              +H VGPN ++  ++   Q L   Y       N  ++  +  PLLS GI+  G D +   
Sbjct  1391  IIHAVGPNFSRVSEVEGNQKLSEVYMDIAKIINRERYNKVSIPLLSTGIYAGGKDRVMQS  1450

Query  1160  -HSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITES  1218
              + L   +DT   +V +   DK               E +++  IA   KE V+  + + 
Sbjct  1451  LNHLFTAMDTTDADVTIYCLDKQW-------------EARIKDAIAR--KESVEELVEDD  1495

Query  1219  KP  1220
             KP
Sbjct  1496  KP  1497


> sp|Q922B1|MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus 
musculus OX=10090 GN=Macrod1 PE=1 SV=2
Length=323

 Score = 39.3 bits (90),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 75/172 (44%), Gaps = 24/172 (14%)

Query  1033  KLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIA  1092
             +L + + +   DI     K++   +VNAAN  L  GGGV G +++A  + +     D   
Sbjct  147   QLNEKISLYRGDIT----KLEVDAIVNAANSSLLGGGGVDGCIHRAAGSLLT----DECR  198

Query  1093  TNGPLKVGGSCVLSGHNL-AKHCLHVVGP---NVNKGEDIQLLKSAYENFNQHEVLLA--  1146
             T    + G + +  G+ L AK+ +H VGP             L+S Y   +  ++LL   
Sbjct  199   TLQNCETGKAKITCGYRLPAKYVIHTVGPIAVGQPTASQAAELRSCY--LSSLDLLLEHR  256

Query  1147  ------PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE  1192
                   P +S G+FG     +  V + ++R   +L      +   ++  FLE
Sbjct  257   LRSVAFPCISTGVFGYPNEEAAEVVLASLRE--WLEQHKDKVDRLIICVFLE  306


> sp|Q9HXU7|Y3693_PSEAE Macro domain-containing protein PA3693 
OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 
104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 
GN=PA3693 PE=4 SV=1
Length=173

 Score = 38.1 bits (87),  Expect = 0.86, Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 51/112 (46%), Gaps = 21/112 (19%)

Query  1057  VVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL---KVGGSCVLSGHNL-AK  1112
             +VNAAN  L  GGGV GA+++A    +       +A    L   K G + +  G  L A 
Sbjct  19    IVNAANSSLLGGGGVDGAIHRAAGAEL-------VAACRLLHGCKTGEAKITRGFRLPAA  71

Query  1113  HCLHVVGPNVNKGE--DIQLLKSAY-------ENFNQHEVLLAPLLSAGIFG  1155
             H +H VGP    G+  + +LL S Y       E      V   P +S GI+G
Sbjct  72    HVIHTVGPVWRGGDNGEAELLASCYRRSLALAEQAGAASVAF-PAISCGIYG  122


> sp|Q9RUV0|PPDE_DEIRA Phosphatase/phosphodiesterase DR_1281 OS=Deinococcus 
radiodurans (strain ATCC 13939 / DSM 20539 / JCM 
16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) 
OX=243230 GN=DR_1281 PE=1 SV=1
Length=255

 Score = 37.7 bits (86),  Expect = 1.9, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 47/110 (43%), Gaps = 21/110 (19%)

Query  2858  ITREVGFVVPGLPGTILRT--TNGDFL---HFLPRVF-SAVGNICYTPSKLIEYTDFATS  2911
             I R + +  PG PG   RT   NG+ L   + L RVF  AV N   T   L+E  D  T 
Sbjct  84    IVRPLNYADPGTPGVGWRTFDVNGEKLTVVNLLGRVFMEAVDNPFRTMDALLERDDLGTV  143

Query  2912  ACVLAAECTIFKDASG--------------KPVPYCYDTNVLEGSVAYES  2947
                  AE T  K+A G                VP   DT +L+G  AY++
Sbjct  144   FVDFHAEATSEKEAMGWHLAGRVAAVIGTHTHVPTA-DTRILKGGTAYQT  192


> sp|Q4QXJ8|POLN_EEEVF Polyprotein P1234 OS=Eastern equine encephalitis 
virus (strain Florida 91-469) OX=374598 PE=1 SV=3
Length=2494

 Score = 38.5 bits (88),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 71/167 (43%), Gaps = 39/167 (23%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH--  1113
             V+VNAAN   + G GV GAL +    A   +         P+  G +      +L KH  
Sbjct  1345  VIVNAANNKGQPGSGVCGALYRKWPGAFDKQ---------PVATGKA------HLVKHSP  1389

Query  1114  -CLHVVGPN---VNKGEDIQLLKSAY---------ENFNQHEVLLAPLLSAGIF--GADP  1158
               +H VGPN   +++ E  Q L   Y         E F +  +   PLLS GI+  G D 
Sbjct  1390  NVIHAVGPNFSRLSENEGDQKLSEVYMDIARIINNERFTKVSI---PLLSTGIYAGGKDR  1446

Query  1159  I----HSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQ  1201
             +    + L   +DT   ++ +   DK    ++  +    +S +++ +
Sbjct  1447  VMQSLNHLFTAMDTTDADITIYCLDKQWESRIKEAITRKESVEELTE  1493


> sp|P26627|R1AB_CVMJD Replicase polyprotein 1ab (Fragment) OS=Murine 
coronavirus (strain defective JHM) OX=11143 GN=rep PE=3 
SV=1
Length=500

 Score = 38.1 bits (87),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 74/183 (40%), Gaps = 15/183 (8%)

Query  1596  PTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLR-VEAFEYYHTTDPSFLGRYMSALNHTK  1654
             P  ++  D+ K++     E +T    P D T   V AF+  ++   S      S   H K
Sbjct  316   PDQVEAFDIEKVEDSILSELQTELNAPADKTYEDVLAFDAIYSETLSAFYAVPSDETHFK  375

Query  1655  KWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALI  1714
                   V G  S      NC+L + L+ +Q + L+F    +Q  +   +AG    F   +
Sbjct  376   ------VCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDLGMQKLWLSYKAGYDQCFVDKL  429

Query  1715  LAYCNKT-VGELGDVRETMSYLFQHANLDSC--KRVLNVVCKTCGQQQTTLKGVEAVMYM  1771
             +    K+ +   G      +Y F    L  C  K   N  C  CG  +  L+G++AV + 
Sbjct  430   VKSAPKSIILPQGGYVADFAYFF----LSQCSFKVHANWRCLKCG-MELKLQGLDAVFFY  484

Query  1772  GTL  1774
             G +
Sbjct  485   GDV  487


> sp|Q9KHE2|Y189_STRGR Macro domain-containing protein in non 5'region 
OS=Streptomyces griseus OX=1911 PE=4 SV=1
Length=177

 Score = 36.6 bits (83),  Expect = 2.4, Method: Composition-based stats.
 Identities = 43/145 (30%), Positives = 62/145 (43%), Gaps = 17/145 (12%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIAT--NGPLKVGGSCVLSGHNL-AK  1112
             V+VNAAN  L  GGGV GA+++     +     +  A+     L  G +   +   L A+
Sbjct  23    VIVNAANSSLLGGGGVDGAIHRRGGPDILAACRELRASRYGKGLPTGQAVATTAGRLDAR  82

Query  1113  HCLHVVGPNVNKGEDIQ-LLKSAY-ENFNQHEVLLA-----PLLSAGIFGADPIHSLRVC  1165
               +H VGP  +  +D   LL S Y E+      L A     P +S GI+G       R+ 
Sbjct  83    WIVHTVGPVFSGAQDRSALLASCYRESLRLAAELGARSIAFPAISTGIYGWPMDDGARIA  142

Query  1166  VDTVRT-------NVYLAVFDKNLY  1183
             V TV          V   +FD + Y
Sbjct  143   VRTVLAETVEPVEEVRFVLFDAHAY  167


> sp|Q7TZB9|Y1934_MYCBO Uncharacterized protein Mb1934c OS=Mycobacterium 
bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 
GN=lppD PE=4 SV=1
Length=358

 Score = 37.7 bits (86),  Expect = 2.4, Method: Composition-based stats.
 Identities = 24/83 (29%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query  1036  DNVYIKNADIVE-EAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATN  1094
             DNV +   ++ + +  K++   + NAAN  L+H GGVA A+ +A    +Q ES +     
Sbjct  184   DNVSMIELEVHQADVTKLELDAITNAANTRLRHAGGVAAAIARAGGPELQRESTE----K  239

Query  1095  GPLKVGGSC-VLSGHNLAKHCLH  1116
              P+ +G +    +G   A++ +H
Sbjct  240   APIGLGEAVETTAGDMPARYVIH  262


> sp|P9WK29|Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 
GN=Rv1899c PE=1 SV=1
Length=359

 Score = 37.7 bits (86),  Expect = 2.4, Method: Composition-based stats.
 Identities = 24/83 (29%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query  1036  DNVYIKNADIVE-EAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATN  1094
             DNV +   ++ + +  K++   + NAAN  L+H GGVA A+ +A    +Q ES +     
Sbjct  185   DNVSMIELEVHQADVTKLELDAITNAANTRLRHAGGVAAAIARAGGPELQRESTE----K  240

Query  1095  GPLKVGGSC-VLSGHNLAKHCLH  1116
              P+ +G +    +G   A++ +H
Sbjct  241   APIGLGEAVETTAGDMPARYVIH  263


> sp|P9WK28|Y1899_MYCTO Uncharacterized protein MT1950 OS=Mycobacterium 
tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1950 
PE=4 SV=1
Length=374

 Score = 37.7 bits (86),  Expect = 2.5, Method: Composition-based stats.
 Identities = 24/83 (29%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query  1036  DNVYIKNADIVE-EAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATN  1094
             DNV +   ++ + +  K++   + NAAN  L+H GGVA A+ +A    +Q ES +     
Sbjct  200   DNVSMIELEVHQADVTKLELDAITNAANTRLRHAGGVAAAIARAGGPELQRESTE----K  255

Query  1095  GPLKVGGSC-VLSGHNLAKHCLH  1116
              P+ +G +    +G   A++ +H
Sbjct  256   APIGLGEAVETTAGDMPARYVIH  278


> sp|Q8Y3S3|Y2759_LISMO Macro domain-containing protein lmo2759 
OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 
/ EGD-e) OX=169963 GN=lmo2759 PE=4 SV=1
Length=176

 Score = 36.2 bits (82),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 76/175 (43%), Gaps = 27/175 (15%)

Query  1038  VYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPL  1097
             + I   DI E+    +  V+VNAAN  L  GGGV GA+++A    +  E  + I   G  
Sbjct  3     ITIVKGDITEQ----EVDVIVNAANSGLLGGGGVDGAIHQAAGPDLLKECQEVINRIGSC  58

Query  1098  KVGGSCVLSGHNL-AKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA--------PL  1148
               G + + S  +L A + +H VGP    GE  +  K A   +   ++           P 
Sbjct  59    PAGEAVITSAGDLKATYIIHAVGPIWKDGEHQEANKLASCYWKALDLAAGKDLTSIAFPN  118

Query  1149  LSAGIFGADPIHSLRVCVDTVR-----------TNVYLAVFDK---NLYDKLVSS  1189
             +S G++G     +  V + TVR             +    FD+    LY+KL++S
Sbjct  119   ISTGVYGFPKKLAAEVALYTVRKWAEEEYDTSIKEIRFVCFDEENLKLYNKLINS  173


> sp|Q926Y8|Y2902_LISIN Macro domain-containing protein lin2902 
OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 
11262) OX=272626 GN=lin2902 PE=4 SV=1
Length=176

 Score = 36.2 bits (82),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 68/157 (43%), Gaps = 23/157 (15%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKH-C  1114
             V+VNAAN  L  GGGV GA+++A    +  E  + I   G    G + + S  +L  H  
Sbjct  17    VIVNAANPGLLGGGGVDGAIHQAAGPDLLKECQEVINRIGSCPAGEAVITSAGDLKAHFI  76

Query  1115  LHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA--------PLLSAGIFGADPIHSLRVCV  1166
             +H VGP    GE  +  K A   +   ++           P +S G++G     +  V +
Sbjct  77    IHAVGPIWKDGEHQEANKLASCYWKALDLAAGKDLTSIAFPNISTGVYGFPKKLAAEVAL  136

Query  1167  DTVR-----------TNVYLAVFDKN---LYDKLVSS  1189
              TVR             V    FD+    LY+KL++S
Sbjct  137   YTVRKWAEEEYDSSIKEVRFVCFDEENLTLYNKLINS  173


> sp|Q3UYG8|MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus 
musculus OX=10090 GN=Macrod2 PE=1 SV=1
Length=475

 Score = 37.4 bits (85),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 18/112 (16%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHC  1114
              +VNAAN  L  GGGV G +++A    +  E  +    NG  + G + +  G++L AK+ 
Sbjct  86    AIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNL---NG-CETGHAKITCGYDLPAKYV  141

Query  1115  LHVVGP------NVNKGEDI-----QLLKSAYENFNQHEVLLAPLLSAGIFG  1155
             +H VGP      N +  ED+       LK   EN N   V   P +S GI+G
Sbjct  142   IHTVGPIARGHINGSHKEDLANCYQSSLKLVKEN-NLRSVAF-PCISTGIYG  191


> sp|B4S3G9|PDXJ_PROA2 Pyridoxine 5'-phosphate synthase OS=Prosthecochloris 
aestuarii (strain DSM 271 / SK 413) OX=290512 GN=pdxJ 
PE=3 SV=1
Length=236

 Score = 36.6 bits (83),  Expect = 3.7, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 49/119 (41%), Gaps = 16/119 (13%)

Query  2021  TSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDII-LKP  2079
             T   FD+++  D        C  +KPV +  +E     +   E   +      +I+ L  
Sbjct  100   TEGGFDIIRHYDT------LCRYIKPVQDAGIEVSIFIEPEEEAIERAASAGAEIVELHT  153

Query  2080  ANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTI  2138
                SLK T     T+LM          I+K    +R  GL+ +A HGL   N VP+ TI
Sbjct  154   GPYSLKKTPAELETELM---------RIRKAATFARSRGLRVVAGHGLDYFNIVPFRTI  203


> sp|A1Z1Q3|MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo 
sapiens OX=9606 GN=MACROD2 PE=1 SV=2
Length=425

 Score = 37.0 bits (84),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 56/110 (51%), Gaps = 14/110 (13%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHC  1114
              +VNAAN  L  GGGV G +++A    +  E  +    NG    G + +  G++L AK+ 
Sbjct  86    AIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNL---NG-CDTGHAKITCGYDLPAKYV  141

Query  1115  LHVVGP------NVNKGEDI-QLLKSAYENFNQHEV--LLAPLLSAGIFG  1155
             +H VGP      N +  ED+    KS+ +   ++ +  +  P +S GI+G
Sbjct  142   IHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYG  191


> sp|Q71W03|Y2748_LISMF Macro domain-containing protein LMOf2365_2748 
OS=Listeria monocytogenes serotype 4b (strain F2365) 
OX=265669 GN=LMOf2365_2748 PE=4 SV=1
Length=176

 Score = 35.8 bits (81),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 69/157 (44%), Gaps = 23/157 (15%)

Query  1056  VVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNL-AKHC  1114
             V+VNAAN  L  GGGV GA+++A    +  E  + I   G    G + + S  +L A + 
Sbjct  17    VIVNAANPGLLGGGGVDGAIHQAAGPDLLKECQEVINRIGTCPAGEAVITSAGDLQASYI  76

Query  1115  LHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA--------PLLSAGIFGADPIHSLRVCV  1166
             +H VGP    GE  +  K A   +   ++           P +S G++G     +  V +
Sbjct  77    IHAVGPIWKDGEHQEANKLASCYWKALDLAAGKELTSIAFPNISTGVYGFPKKLAAEVAL  136

Query  1167  DTVRT-----------NVYLAVFDKN---LYDKLVSS  1189
              TVR             +    FD+    LY+KL++S
Sbjct  137   YTVRKWAEEEYDTSIEEIRFVCFDEENLKLYNKLINS  173


> sp|P43349|TCTP_SOLTU Translationally-controlled tumor protein 
homolog OS=Solanum tuberosum OX=4113 GN=TCTP PE=2 SV=2
Length=168

 Score = 35.0 bits (79),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 13/99 (13%)

Query  423  WVPRASA--NIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
            WV + +   NIG N +   G   EG++D  +++       ++IV  F+L E+ A     F
Sbjct  35   WVVQGAVDVNIGANPSAEGGGEDEGVDDQAVKV-------VDIVDTFRLQEQPAFDKKQF  87

Query  481  SASTSAFVET----VKGLDYKAFKQIVESCGNFKVTKGK  515
                  +++     ++G   +AFK+ +ES   F ++K K
Sbjct  88   VTYIKRYIKNLTPKLEGEAQEAFKKNIESATKFLLSKLK  126



Lambda      K        H        a         alpha
   0.320    0.135    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 529816275270
Results from round 2


Query= sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1

Length=4405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute re...  6211    0.0  
  sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ...  6205    0.0  
  sp|P0C6U8|R1A_CVHSA Replicase polyprotein 1a OS=Human SARS coro...  6110    0.0  
  sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co...  6100    0.0  
  sp|P0C6F8|R1A_BCHK3 Replicase polyprotein 1a OS=Bat coronavirus...  6084    0.0  
  sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus...  6083    0.0  
  sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir...  6078    0.0  
  sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir...  6072    0.0  
  sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat coronavirus...  6066    0.0  
  sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir...  6055    0.0  
  sp|P0C6T5|R1A_BCHK5 Replicase polyprotein 1a OS=Bat coronavirus...  4665    0.0  
  sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir...  4660    0.0  
  sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat coronavirus...  4355    0.0  
  sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir...  4349    0.0  
  sp|K9N638|R1A_CVEMC Replicase polyprotein 1a OS=Middle East res...  3851    0.0  
  sp|K9N7C7|R1AB_CVEMC Replicase polyprotein 1ab OS=Middle East r...  3844    0.0  
  sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat coronavirus...  3744    0.0  
  sp|P0C6F7|R1A_BC133 Replicase polyprotein 1a OS=Bat coronavirus...  3742    0.0  
  sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir...  3742    0.0  
  sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir...  3740    0.0  
  sp|P0C6V0|R1A_CVMA5 Replicase polyprotein 1a OS=Murine coronavi...  3674    0.0  
  sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona...  3674    0.0  
  sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav...  3669    0.0  
  sp|P0C6U9|R1A_CVM2 Replicase polyprotein 1a OS=Murine coronavir...  3669    0.0  
  sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona...  3666    0.0  
  sp|P0C6V1|R1A_CVMJH Replicase polyprotein 1a OS=Murine coronavi...  3666    0.0  
  sp|P0C6T9|R1A_CVBLU Replicase polyprotein 1a OS=Bovine coronavi...  3546    0.0  
  sp|P0C6T8|R1A_CVBEN Replicase polyprotein 1a OS=Bovine coronavi...  3546    0.0  
  sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona...  3541    0.0  
  sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona...  3541    0.0  
  sp|P0C6U1|R1A_CVBQ Replicase polyprotein 1a OS=Bovine coronavir...  3519    0.0  
  sp|P0C6U0|R1A_CVBM Replicase polyprotein 1a OS=Bovine coronavir...  3516    0.0  
  sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav...  3515    0.0  
  sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav...  3513    0.0  
  sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavir...  3509    0.0  
  sp|P0C6U7|R1A_CVHOC Replicase polyprotein 1a OS=Human coronavir...  3508    0.0  
  sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav...  3506    0.0  
  sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav...  3506    0.0  
  sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavir...  3505    0.0  
  sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav...  3503    0.0  
  sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavir...  3503    0.0  
  sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav...  3501    0.0  
  sp|P0C6V4|R1A_IBVBC Replicase polyprotein 1a OS=Avian infectiou...  2695    0.0  
  sp|P0C6V3|R1A_IBVB Replicase polyprotein 1a OS=Avian infectious...  2695    0.0  
  sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti...  2687    0.0  
  sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio...  2687    0.0  
  sp|P0C6V5|R1A_IBVM Replicase polyprotein 1a OS=Avian infectious...  2674    0.0  
  sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio...  2667    0.0  
  sp|P0C6U2|R1A_CVH22 Replicase polyprotein 1a OS=Human coronavir...  2615    0.0  
  sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav...  2613    0.0  
  sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus...  2612    0.0  
  sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir...  2608    0.0  
  sp|P0C6V2|R1A_CVPPU Replicase polyprotein 1a OS=Porcine transmi...  2606    0.0  
  sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav...  2602    0.0  
  sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans...  2602    0.0  
  sp|P0C6V6|R1A_PEDV7 Replicase polyprotein 1a OS=Porcine epidemi...  2602    0.0  
  sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide...  2599    0.0  
  sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav...  2589    0.0  
  sp|P0C6U6|R1A_CVHNL Replicase polyprotein 1a OS=Human coronavir...  2588    0.0  
  sp|A7MG20|YMDB_CROS8 O-acetyl-ADP-ribose deacetylase OS=Cronoba...   193    2e-53
  sp|C9Y0V8|YMDB_CROTZ O-acetyl-ADP-ribose deacetylase OS=Cronoba...   191    7e-53
  sp|B7LT90|YMDB_ESCF3 O-acetyl-ADP-ribose deacetylase OS=Escheri...   188    2e-51
  sp|D2TT52|YMDB_CITRI O-acetyl-ADP-ribose deacetylase OS=Citroba...   187    2e-51
  sp|B4T2X8|YMDB_SALNS O-acetyl-ADP-ribose deacetylase OS=Salmone...   187    3e-51
  sp|B5F961|YMDB_SALA4 O-acetyl-ADP-ribose deacetylase OS=Salmone...   187    3e-51
  sp|P67341|YMDB_SALTY O-acetyl-ADP-ribose deacetylase OS=Salmone...   187    4e-51
  sp|P67342|YMDB_SALTI O-acetyl-ADP-ribose deacetylase OS=Salmone...   187    4e-51
  sp|B5RBF3|YMDB_SALG2 O-acetyl-ADP-ribose deacetylase OS=Salmone...   185    1e-50
  sp|A8AI35|YMDB_CITK8 O-acetyl-ADP-ribose deacetylase OS=Citroba...   184    4e-50
  sp|P0A8D6|YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escheri...   183    6e-50
  sp|P0A8D7|YMDB_ECOL6 O-acetyl-ADP-ribose deacetylase OS=Escheri...   183    6e-50
  sp|P0A8D8|YMDB_ECO57 O-acetyl-ADP-ribose deacetylase OS=Escheri...   183    6e-50
  sp|Q0T5Z6|YMDB_SHIF8 O-acetyl-ADP-ribose deacetylase OS=Shigell...   182    2e-49
  sp|A4W960|YMDB_ENT38 O-acetyl-ADP-ribose deacetylase OS=Enterob...   179    2e-48
  sp|D5CE05|YMDB_ENTCC O-acetyl-ADP-ribose deacetylase OS=Enterob...   178    3e-48
  sp|Q32E73|YMDB_SHIDS O-acetyl-ADP-ribose deacetylase OS=Shigell...   177    6e-48
  sp|D3RKJ0|YMDB_KLEVT O-acetyl-ADP-ribose deacetylase OS=Klebsie...   177    7e-48
  sp|B5XXK9|YMDB_KLEP3 O-acetyl-ADP-ribose deacetylase OS=Klebsie...   177    7e-48
  sp|E1SDF1|YMDB1_PANVC O-acetyl-ADP-ribose deacetylase 1 OS=Pant...   174    5e-47
  sp|Q8EYT0|Y4133_LEPIN Macro domain-containing protein LA_4133 O...   169    3e-45
  sp|Q72M93|Y3295_LEPIC Macro domain-containing protein LIC_13295...   169    4e-45
  sp|Q96XY5|Y2383_SULTO Uncharacterized protein STK_23830 OS=Sulf...   166    8e-44
  sp|Q97UU4|Y2899_SACS2 Uncharacterized protein SSO2899 OS=Saccha...   161    2e-42
  sp|Q8RB30|Y995_CALS4 Macro domain-containing protein TTE0995 OS...   161    3e-42
  sp|Q8ZXT3|Y1111_PYRAE Uncharacterized protein PAE1111 OS=Pyroba...   160    8e-42
  sp|E1PL40|YMDB2_PANVC O-acetyl-ADP-ribose deacetylase 2 OS=Pant...   159    1e-41
  sp|Q8TQD0|Y1614_METAC Macro domain-containing protein MA_1614 O...   158    5e-41
  sp|Q8Q0F9|Y177_METMA Macro domain-containing protein MM_0177 OS...   157    1e-40
  sp|Q4J9D2|Y1252_SULAC Uncharacterized protein Saci_1252 OS=Sulf...   154    9e-40
  sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermot...   156    3e-37
  sp|Q8Y2K1|Y334_RALSO Macro domain-containing protein RSc0334 OS...   144    2e-36
  sp|Q87JZ5|Y4103_VIBPA Macro domain-containing protein VPA0103 O...   144    2e-36
  sp|Q8RHQ2|Y1951_FUSNN Uncharacterized protein FN1951 OS=Fusobac...   137    3e-34
  sp|Q460N5|PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP1...   141    1e-31
  sp|Q2EMV9|PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP1...   139    5e-31
  sp|Q8CAS9|PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9...   137    6e-31
  sp|P0C6F3|R1A_BEV Replicase polyprotein 1a OS=Berne virus OX=11...   138    1e-30
  sp|Q8IXQ6|PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9...   137    1e-30
  sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=...   138    2e-30
  sp|Q8BCR0|POLN_RUBVN Non-structural polyprotein p200 OS=Rubella...   128    1e-27
  sp|P0C6F4|R1A_BRV1 Replicase polyprotein 1a OS=Breda virus 1 OX...   126    7e-27
  sp|P27282|POLN_EEVVT Polyprotein P1234 OS=Venezuelan equine enc...   126    7e-27
  sp|P36328|POLN_EEVVP Polyprotein P1234 OS=Venezuelan equine enc...   126    7e-27
  sp|P36327|POLN_EEVV3 Polyprotein P1234 OS=Venezuelan equine enc...   126    7e-27
  sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 ...   126    8e-27
  sp|Q8V294|POLN_EEVVC Polyprotein P1234 OS=Venezuelan equine enc...   123    4e-26
  sp|Q9WJC7|POLN_EEVVM Polyprotein P1234 OS=Venezuelan equine enc...   123    4e-26

Sequences not found previously or not previously below threshold:

  sp|Q8KAE4|Y2219_CHLTE Macro domain-containing protein CT2219 OS...   152    4e-39
  sp|Q8Y3S3|Y2759_LISMO Macro domain-containing protein lmo2759 O...   145    1e-36
  sp|Q71W03|Y2748_LISMF Macro domain-containing protein LMOf2365_...   144    2e-36
  sp|Q926Y8|Y2902_LISIN Macro domain-containing protein lin2902 O...   144    3e-36
  sp|Q9ZBG3|Y6450_STRCO Macro domain-containing protein SCO6450 O...   142    9e-36
  sp|Q9KHE2|Y189_STRGR Macro domain-containing protein in non 5'r...   142    9e-36
  sp|Q9HXU7|Y3693_PSEAE Macro domain-containing protein PA3693 OS...   142    1e-35
  sp|Q93SX7|Y189_ACISE Macro domain-containing protein OS=Acineto...   141    2e-35
  sp|Q8P5Z8|Y3184_XANCP Macro domain-containing protein XCC3184 O...   139    1e-34
  sp|Q8PHB6|Y3343_XANAC Macro domain-containing protein XAC3343 O...   139    1e-34
  sp|Q9EYI6|Y189_STRNO Macro domain-containing protein in sno 5'r...   139    2e-34
  sp|Q6PAV8|MACD2_XENLA ADP-ribose glycohydrolase MACROD2 OS=Xeno...   145    2e-34
  sp|Q88SK6|Y3408_LACPL Macro domain-containing protein lp_3408 O...   138    2e-34
  sp|Q44020|YGB2_CUPNE Macro domain-containing protein in gbd 3'r...   137    5e-34
  sp|Q97AU0|Y719_THEVO Uncharacterized protein TV0719 OS=Thermopl...   136    2e-33
  sp|Q985D2|Y7730_RHILO Macro domain-containing protein mll7730 O...   134    8e-33
  sp|Q3UYG8|MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus ...   139    2e-32
  sp|A1Z1Q3|MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo...   138    3e-32
  sp|Q8K4G6|MACD1_RAT ADP-ribose glycohydrolase MACROD1 (Fragment...   134    3e-32
  sp|Q9BQ69|MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo...   136    4e-32
  sp|Q922B1|MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus ...   135    6e-32
  sp|Q2KHU5|MACD1_BOVIN ADP-ribose glycohydrolase MACROD1 OS=Bos ...   134    1e-31
  sp|Q9RS39|Y2288_DEIRA Macro domain-containing protein DR_2288 O...   129    2e-31
  sp|Q9HJ67|Y1105_THEAC Uncharacterized protein Ta1105 OS=Thermop...   126    4e-30
  sp|P13889|POLN_RUBVT Non-structural polyprotein p200 OS=Rubella...   127    2e-27
  sp|Q6X2U2|POLN_RUBVC Non-structural polyprotein p200 OS=Rubella...   123    5e-26
  sp|Q99IE5|POLN_RUBVV Non-structural polyprotein p200 OS=Rubella...   122    7e-26
  sp|Q99IE7|POLN_RUBVO Non-structural polyprotein p200 OS=Rubella...   122    7e-26
  sp|P26627|R1AB_CVMJD Replicase polyprotein 1ab (Fragment) OS=Mu...   119    7e-26
  sp|Q6X2U4|POLN_RUBVB Non-structural polyprotein p200 OS=Rubella...   122    8e-26
  sp|Q9V0Y3|Y656_PYRAB Uncharacterized protein PYRAB06560 OS=Pyro...   112    2e-25
  sp|O59182|Y1513_PYRHO Uncharacterized protein PH1513 OS=Pyrococ...   111    5e-25
  sp|O40955|POLN_RUBVR Non-structural polyprotein p200 OS=Rubella...   119    5e-25
  sp|Q9J6K9|POLN_RUBVD Non-structural polyprotein p200 OS=Rubella...   117    2e-24
  sp|O28751|Y1521_ARCFU ADP-ribose glycohydrolase AF_1521 OS=Arch...   104    2e-22
  sp|Q86500|POLN_RUBVM Non-structural polyprotein p200 OS=Rubella...   110    4e-22
  sp|Q8U0P9|Y1536_PYRFU Uncharacterized protein PF1536 OS=Pyrococ...  97.1    3e-20
  sp|Q4QXJ8|POLN_EEEVF Polyprotein P1234 OS=Eastern equine enceph...   103    5e-20
  sp|P0DC29|ADPRH_STRPQ Protein-ADP-ribose hydrolase OS=Streptoco...  98.3    6e-20
  sp|P0DC28|ADPRH_STRP3 Protein-ADP-ribose hydrolase OS=Streptoco...  98.3    6e-20
  sp|Q99ZI6|ADPRH_STRP1 Protein-ADP-ribose hydrolase OS=Streptoco...  98.3    6e-20
  sp|P0DN70|ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptoco...  97.5    1e-19
  sp|Q8P0X2|ADPRH_STRP8 Protein-ADP-ribose hydrolase OS=Streptoco...  97.5    1e-19
  sp|Q5XC09|ADPRH_STRP6 Protein-ADP-ribose hydrolase OS=Streptoco...  97.5    1e-19
  sp|Q5JER1|Y1890_THEKO Uncharacterized protein TK1890 OS=Thermoc...  95.6    1e-19
  sp|Q8NYB7|ADPRH_STAAW Protein-ADP-ribose hydrolase OS=Staphyloc...  96.7    2e-19
  sp|Q6GCE6|ADPRH_STAAS Protein-ADP-ribose hydrolase OS=Staphyloc...  96.7    2e-19
  sp|Q5HIW9|ADPRH_STAAC Protein-ADP-ribose hydrolase OS=Staphyloc...  96.7    2e-19
  sp|Q6GJZ1|ADPRH_STAAR Protein-ADP-ribose hydrolase OS=Staphyloc...  95.2    6e-19
  sp|P27283|POLN_SINDO Polyprotein P1234 OS=Sindbis virus subtype...  99.4    8e-19
  sp|P67344|ADPRH_STAAN Protein-ADP-ribose hydrolase OS=Staphyloc...  94.4    9e-19
  sp|P67343|ADPRH_STAAM Protein-ADP-ribose hydrolase OS=Staphyloc...  94.4    9e-19
  sp|A7T167|GDAP2_NEMVE Protein GDAP2 homolog OS=Nematostella vec...  96.7    1e-18
  sp|P03317|POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=1103...  98.7    1e-18
  sp|P13896|POLN_WEEV Polyprotein P1234 OS=Western equine encepha...  98.3    2e-18
  sp|Q93RG0|ADPRH_TREMD Protein-ADP-ribose hydrolase OS=Treponema...  92.9    3e-18
  sp|Q306W6|POLN_EEEV1 Polyprotein P1234 OS=Eastern equine enceph...  97.1    4e-18
  sp|Q86924|POLN_AURAV Polyprotein P1234 OS=Aura virus OX=44158 P...  96.3    7e-18
  sp|Q7TZB9|Y1934_MYCBO Uncharacterized protein Mb1934c OS=Mycoba...  92.5    7e-18
  sp|P9WK29|Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycoba...  92.5    7e-18
  sp|P9WK28|Y1899_MYCTO Uncharacterized protein MT1950 OS=Mycobac...  92.5    8e-18
  sp|O67112|Y987_AQUAE Uncharacterized protein aq_987 OS=Aquifex ...  89.4    1e-17
  sp|Q306W8|POLN_EEEV8 Polyprotein P1234 OS=Eastern equine enceph...  94.8    2e-17
  sp|Q8JUX6|POLN_CHIKS Polyprotein P1234 OS=Chikungunya virus (st...  92.9    7e-17
  sp|Q5XXP4|POLN_CHIK3 Polyprotein P1234 OS=Chikungunya virus (st...  92.5    1e-16
  sp|O90370|POLN_ONNVI Polyprotein P1234 OS=O'nyong-nyong virus (...  90.2    4e-16
  sp|Q2KIX2|GDAP2_BOVIN Ganglioside-induced differentiation-assoc...  87.9    8e-16
  sp|O90368|POLN_ONNVS Polyprotein P1234 OS=O'nyong-nyong virus (...  89.0    1e-15
  sp|P13886|POLN_ONNVG Polyprotein P1234 OS=O'nyong-nyong virus (...  89.0    1e-15
  sp|Q5XGM5|GDAP2_XENLA Ganglioside-induced differentiation-assoc...  85.9    3e-15
  sp|Q8QZ73|POLN_MAYAB Polyprotein P1234 OS=Mayaro virus (strain ...  87.1    4e-15
  sp|Q5CZL1|GDAP2_XENTR Ganglioside-induced differentiation-assoc...  85.6    4e-15
  sp|Q9DBL2|GDAP2_MOUSE Ganglioside-induced differentiation-assoc...  85.6    4e-15
  sp|Q9NXN4|GDAP2_HUMAN Ganglioside-induced differentiation-assoc...  85.6    4e-15
  sp|P87515|POLN_BFV Polyprotein P1234 OS=Barmah forest virus OX=...  86.7    5e-15
  sp|P13887|POLN_RRVN Polyprotein P1234 OS=Ross river virus (stra...  86.3    8e-15
  sp|P13888|POLN_RRVT Polyprotein nsP1234 (Fragment) OS=Ross rive...  85.2    1e-14
  sp|Q9YBE9|Y1648_AERPE Uncharacterized protein APE_1648.1 OS=Aer...  80.2    2e-14
  sp|Q66H63|GDAP2_RAT Ganglioside-induced differentiation-associa...  83.2    2e-14
  sp|Q02874|H2AY_RAT Core histone macro-H2A.1 OS=Rattus norvegicu...  80.5    7e-14
  sp|O75367|H2AY_HUMAN Core histone macro-H2A.1 OS=Homo sapiens O...  79.8    1e-13
  sp|Q8QL53|POLN_SLDV Polyprotein P1234 OS=Sleeping disease virus...  81.7    2e-13
  sp|Q66HX8|GDAP2_DANRE Ganglioside-induced differentiation-assoc...  80.2    2e-13
  sp|Q8JJX1|POLN_SPDV Polyprotein P1234 OS=Salmon pancreas diseas...  81.3    2e-13
  sp|O93327|H2AY_CHICK Core histone macro-H2A.1 OS=Gallus gallus ...  79.0    2e-13
  sp|Q5Y389|POLN_GETV Polyprotein P1234 OS=Getah virus OX=59300 P...  81.3    2e-13
  sp|Q9QZQ8|H2AY_MOUSE Core histone macro-H2A.1 OS=Mus musculus O...  78.6    3e-13
  sp|Q9JGL0|POLN_SAGV Polyprotein P1234 OS=Sagiyama virus OX=5930...  80.9    3e-13
  sp|Q6QLN1|POLN_AHEV Non-structural polyprotein pORF1 OS=Avian h...  80.5    4e-13
  sp|Q4R678|GDAP2_MACFA Ganglioside-induced differentiation-assoc...  77.5    1e-12
  sp|Q460N3|PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP1...  75.5    9e-12
  sp|Q7JUR6|GDAP2_DROME Protein GDAP2 homolog OS=Drosophila melan...  69.8    3e-10
  sp|Q8CCK0|H2AW_MOUSE Core histone macro-H2A.2 OS=Mus musculus O...  67.8    8e-10
  sp|Q9P0M6|H2AW_HUMAN Core histone macro-H2A.2 OS=Homo sapiens O...  67.8    8e-10
  sp|Q292F9|GDAP2_DROPS Protein GDAP2 homolog OS=Drosophila pseud...  68.2    1e-09
  sp|Q9YLR1|POLN_HEVUS Non-structural polyprotein pORF1 OS=Hepati...  68.6    2e-09
  sp|Q81862|POLN_HEVCH Non-structural polyprotein pORF1 OS=Hepati...  64.4    3e-08
  sp|P33424|POLN_HEVPA Non-structural polyprotein pORF1 OS=Hepati...  64.0    4e-08
  sp|P29324|POLN_HEVBU Non-structural polyprotein pORF1 OS=Hepati...  64.0    4e-08
  sp|Q6J8G2|POLN_HEVMG Non-structural polyprotein pORF1 OS=Hepati...  62.4    1e-07
  sp|Q008X5|R1A_WBV24 Replicase polyprotein 1a OS=White bream vir...  62.1    2e-07
  sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream v...  62.1    2e-07
  sp|Q9WC28|POLN_HEVHY Non-structural polyprotein pORF1 OS=Hepati...  61.7    2e-07
  sp|Q03495|POLN_HEVME Non-structural polyprotein pORF1 OS=Hepati...  61.3    2e-07
  sp|Q04610|POLN_HEVMY Non-structural polyprotein pORF1 OS=Hepati...  60.5    5e-07
  sp|Q9M041|BH140_ARATH Transcription factor bHLH140 OS=Arabidops...  60.1    5e-07
  sp|Q9IVZ9|POLN_HEVCT Non-structural polyprotein pORF1 OS=Hepati...  60.1    5e-07
  sp|P08411|POLN_SFV Polyprotein P1234 OS=Semliki forest virus OX...  59.0    1e-06
  sp|Q54PT1|GDAP2_DICDI Protein GDAP2 homolog OS=Dictyostelium di...  55.5    1e-05
  sp|Q5HTX9|PGLB_CAMJR Undecaprenyl-diphosphooligosaccharide--pro...  45.1    0.019
  sp|Q0P9C8|PGLB_CAMJE Undecaprenyl-diphosphooligosaccharide--pro...  44.7    0.021
  sp|B9KDD4|PGLB_CAMLR Undecaprenyl-diphosphooligosaccharide--pro...  42.8    0.096
  sp|A8GUJ3|ATP6_RICB8 ATP synthase subunit a OS=Rickettsia belli...  41.6    0.097
  sp|Q1RGZ3|ATP6_RICBR ATP synthase subunit a OS=Rickettsia belli...  41.6    0.11 
  sp|Q5A1V3|POA1_CANAL ADP-ribose 1''-phosphate phosphatase OS=Ca...  40.1    0.11 
  sp|B0ULY1|ATP6_METS4 ATP synthase subunit a OS=Methylobacterium...  40.1    0.32 
  sp|Q4FRM3|RS20_PSYA2 30S ribosomal protein S20 OS=Psychrobacter...  37.4    0.49 
  sp|Q03QN6|TIG_LACBA Trigger factor OS=Lactobacillus brevis (str...  40.1    0.49 
  sp|Q11KH9|ATP6_CHESB ATP synthase subunit a OS=Chelativorans sp...  39.3    0.53 
  sp|Q03F26|TIG_PEDPA Trigger factor OS=Pediococcus pentosaceus (...  39.7    0.62 
  sp|Q2KBW1|ATP6_RHIEC ATP synthase subunit a OS=Rhizobium etli (...  38.9    0.73 
  sp|Q3KNA1|MRGB2_MOUSE Mas-related G-protein coupled receptor me...  39.3    0.80 
  sp|Q91ZC6|MRGA6_MOUSE Mas-related G-protein coupled receptor me...  38.6    1.0  
  sp|Q2FQC0|KUP_METHJ Probable potassium transport system protein...  38.9    1.3  
  sp|P15576|NU1M_LEITA NADH-ubiquinone oxidoreductase chain 1 OS=...  38.2    1.4  
  sp|A1SSX2|RNFD_PSYIN Ion-translocating oxidoreductase complex s...  38.6    1.5  
  sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster ...  38.6    1.7  
  sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster...  38.6    1.7  
  sp|B3PRF6|ATP6_RHIE6 ATP synthase subunit a OS=Rhizobium etli (...  37.4    2.0  
  sp|B5ZS16|ATP6_RHILW ATP synthase subunit a OS=Rhizobium legumi...  37.4    2.2  
  sp|Q49429|P200_MYCGE Protein P200 OS=Mycoplasma genitalium (str...  38.2    2.3  
  sp|P04540|NU5M_TRYBB NADH-ubiquinone oxidoreductase chain 5 OS=...  37.8    2.5  
  sp|B9JA28|ATP6_AGRRK ATP synthase subunit a OS=Agrobacterium ra...  37.0    2.7  
  sp|C4XXB1|AIM21_CLAL4 Altered inheritance of mitochondria prote...  37.8    3.0  
  sp|Q68XQ1|ATP6_RICTY ATP synthase subunit a OS=Rickettsia typhi...  37.0    3.1  
  sp|Q67ES1|TR113_RAT Taste receptor type 2 member 113 OS=Rattus ...  37.0    3.3  
  sp|Q6CRE9|FYV8_KLULA Protein FYV8 OS=Kluyveromyces lactis (stra...  37.8    3.4  
  sp|A5E287|POA1_LODEL ADP-ribose 1''-phosphate phosphatase OS=Lo...  35.9    3.4  
  sp|Q00167|VG78_ICHVA Putative zinc-binding protein ORF78 OS=Ict...  37.4    3.5  
  sp|Q8IRB5|CLSPN_DROME Claspin OS=Drosophila melanogaster OX=722...  37.4    3.8  
  sp|P46565|SRG8_CAEEL Serpentine receptor class gamma-8 OS=Caeno...  37.0    4.0  
  sp|A8GLV8|ATP6_RICAH ATP synthase subunit a OS=Rickettsia akari...  36.3    4.5  
  sp|Q9Z1Q1|NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus...  37.0    5.1  
  sp|Q58990|Y1595_METJA UPF0104 membrane protein MJ1595 OS=Methan...  36.6    5.1  
  sp|O74871|YCW3_SCHPO Uncharacterized protein C31H12.03c OS=Schi...  36.3    5.9  
  sp|A8F0C9|ATP6_RICM5 ATP synthase subunit a OS=Rickettsia massi...  35.9    5.9  
  sp|Q37376|NU2M_ACACA NADH-ubiquinone oxidoreductase chain 2 OS=...  36.6    5.9  
  sp|B5RRC2|MRAY_BORRA Phospho-N-acetylmuramoyl-pentapeptide-tran...  36.3    6.0  
  sp|Q7Z699|SPRE1_HUMAN Sprouty-related, EVH1 domain-containing p...  36.6    6.6  
  sp|Q9M6N7|AMT2_ARATH Ammonium transporter 2 OS=Arabidopsis thal...  36.3    6.8  
  sp|C3PM51|ATP6_RICAE ATP synthase subunit a OS=Rickettsia afric...  35.9    7.0  
  sp|P34338|YK14_CAEEL Uncharacterized protein C15H7.4 OS=Caenorh...  36.3    7.2  
  sp|Q04654|ATP6_VICFA ATP synthase subunit a OS=Vicia faba OX=39...  35.9    7.5  
  sp|Q91ZC7|MRGA5_MOUSE Mas-related G-protein coupled receptor me...  35.9    7.8  
  sp|Q4UNH7|ATP6_RICFE ATP synthase subunit a OS=Rickettsia felis...  35.5    8.2  
  sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strai...  36.6    8.5  
  sp|Q8JZW4|CPNE5_MOUSE Copine-5 OS=Mus musculus OX=10090 GN=Cpne...  36.3    8.7  
  sp|Q92JP0|ATP6_RICCN ATP synthase subunit a OS=Rickettsia conor...  35.5    9.1  
  sp|Q9HCH3|CPNE5_HUMAN Copine-5 OS=Homo sapiens OX=9606 GN=CPNE5...  36.3    9.1  
  sp|C4K0P3|ATP6_RICPU ATP synthase subunit a OS=Rickettsia peaco...  35.5    9.2  
  sp|Q6XL69|OPN4_RUTRU Melanopsin OS=Rutilus rutilus OX=48668 GN=...  35.9    9.6  
  sp|D0E0C2|SCNA1_PERAM Sodium channel protein PaFPC1 OS=Periplan...  36.3    9.7  


> sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1
Length=4405

 Score = 6211 bits (16113),  Expect = 0.0, Method: Composition-based stats.
 Identities = 4405/4405 (100%), Positives = 4405/4405 (100%), Gaps = 0/4405 (0%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
Sbjct  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
Sbjct  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
Sbjct  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
Sbjct  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
Sbjct  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
Sbjct  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
Sbjct  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
Sbjct  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
Sbjct  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
Sbjct  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
             GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
Sbjct  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
Sbjct  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840
             TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
Sbjct  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840

Query  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900
             ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
Sbjct  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900

Query  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960
             SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
Sbjct  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960

Query  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020
             EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
Sbjct  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020

Query  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080
             QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
Sbjct  1021  QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN  1080

Query  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140
             NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
Sbjct  1081  NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ  1140

Query  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200
             HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
Sbjct  1141  HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE  1200

Query  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260
             QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
Sbjct  1201  QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN  1260

Query  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320
             GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
Sbjct  1261  GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV  1320

Query  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380
             PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
Sbjct  1321  PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA  1380

Query  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440
             HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
Sbjct  1381  HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND  1440

Query  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500
             LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
Sbjct  1441  LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH  1500

Query  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560
             FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
Sbjct  1501  FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL  1560

Query  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620
             SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
Sbjct  1561  SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV  1620

Query  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680
             LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
Sbjct  1621  LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL  1680

Query  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740
             LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
Sbjct  1681  LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN  1740

Query  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800
             LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
Sbjct  1741  LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ  1800

Query  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860
             ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
Sbjct  1801  ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK  1860

Query  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920
             GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
Sbjct  1861  GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY  1920

Query  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980
             PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
Sbjct  1921  PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK  1980

Query  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040
             KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
Sbjct  1981  KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA  2040

Query  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100
             CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
Sbjct  2041  CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV  2100

Query  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160
             DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
Sbjct  2101  DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC  2160

Query  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220
             LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
Sbjct  2161  LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS  2220

Query  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280
             PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
Sbjct  2221  PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT  2280

Query  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340
             YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
Sbjct  2281  YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV  2340

Query  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400
             LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
Sbjct  2341  LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV  2400

Query  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460
             VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
Sbjct  2401  VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA  2460

Query  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520
             GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
Sbjct  2461  GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH  2520

Query  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580
             FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
Sbjct  2521  FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV  2580

Query  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640
             GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
Sbjct  2581  GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG  2640

Query  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700
             FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
Sbjct  2641  FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN  2700

Query  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760
             AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
Sbjct  2701  AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL  2760

Query  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820
             KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
Sbjct  2761  KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI  2820

Query  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880
             ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
Sbjct  2821  ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD  2880

Query  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940
             FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
Sbjct  2881  FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE  2940

Query  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000
             GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
Sbjct  2941  GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST  3000

Query  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060
             SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
Sbjct  3001  SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL  3060

Query  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120
             AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
Sbjct  3061  AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV  3120

Query  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180
             SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
Sbjct  3121  SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL  3180

Query  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240
             CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
Sbjct  3181  CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND  3240

Query  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300
             FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
Sbjct  3241  FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY  3300

Query  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360
             CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
Sbjct  3301  CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK  3360

Query  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420
             TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
Sbjct  3361  TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV  3420

Query  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480
             SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
Sbjct  3421  SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR  3480

Query  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540
             WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
Sbjct  3481  WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN  3540

Query  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600
             GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
Sbjct  3541  GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW  3600

Query  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660
             SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
Sbjct  3601  SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV  3660

Query  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720
             MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
Sbjct  3661  MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK  3720

Query  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780
             VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
Sbjct  3721  VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM  3780

Query  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840
             LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
Sbjct  3781  LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL  3840

Query  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900
             NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
Sbjct  3841  NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL  3900

Query  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960
             AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
Sbjct  3901  AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA  3960

Query  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020
             QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
Sbjct  3961  QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED  4020

Query  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080
             KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
Sbjct  4021  KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY  4080

Query  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140
             KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Sbjct  4081  KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ  4140

Query  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200
             NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
Sbjct  4141  NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD  4200

Query  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260
             GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
Sbjct  4201  GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV  4260

Query  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320
             PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
Sbjct  4261  PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES  4320

Query  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380
             FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
Sbjct  4321  FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG  4380

Query  4381  CSCDQLREPMLQSADAQSFLNGFAV  4405
             CSCDQLREPMLQSADAQSFLNGFAV
Sbjct  4381  CSCDQLREPMLQSADAQSFLNGFAV  4405


> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score = 6205 bits (16099),  Expect = 0.0, Method: Composition-based stats.
 Identities = 4401/4401 (100%), Positives = 4401/4401 (100%), Gaps = 0/4401 (0%)

Query  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60
             MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
Sbjct  1     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV  60

Query  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120
             LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
Sbjct  61    LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK  120

Query  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180
             VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
Sbjct  121   VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG  180

Query  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240
             AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
Sbjct  181   AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW  240

Query  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300
             YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
Sbjct  241   YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI  300

Query  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360
             RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
Sbjct  301   RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL  360

Query  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420
             PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
Sbjct  361   PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC  420

Query  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480
             AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
Sbjct  421   AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF  480

Query  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540
             SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
Sbjct  481   SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA  540

Query  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600
             ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
Sbjct  541   ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY  600

Query  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660
             ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
Sbjct  601   ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV  660

Query  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720
             GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
Sbjct  661   GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC  720

Query  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780
             VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
Sbjct  721   VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG  780

Query  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840
             TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
Sbjct  781   TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN  840

Query  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900
             ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
Sbjct  841   ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW  900

Query  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960
             SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
Sbjct  901   SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL  960

Query  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020
             EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
Sbjct  961   EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV  1020

Query  10