PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1

Length=73
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute ...   145    5e-45
  sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavir...   106    5e-30
  sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS co...   106    6e-30
  sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus aura...  30.4    1.2  
  sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9...  30.0    1.7  
  sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=1...  29.3    3.2  


> sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 
SV=1
Length=73

 Score =  145 bits (365),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM
Sbjct  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60

Query  61  AVMLLLLCCCLTD  73
           AVMLLLLCCCLTD
Sbjct  61  AVMLLLLCCCLTD  73


> sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=ORF14 PE=4 SV=1
Length=70

 Score =  106 bits (265),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 58/70 (83%), Gaps = 0/70 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           ML SCYNFLKEQHCQKASTQKGAEAAVKPLL  HHVVA +QEIQL AAVGE+L LEWLA 
Sbjct  1   MLPSCYNFLKEQHCQKASTQKGAEAAVKPLLALHHVVAVIQEIQLLAAVGEILQLEWLAE  60

Query  61  AVMLLLLCCC  70
           AV L    CC
Sbjct  61  AVKLPSRYCC  70


> sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS 
coronavirus OX=694009 GN=ORF14 PE=1 SV=1
Length=70

 Score =  106 bits (264),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           ML  CYNFLKEQHCQKASTQ+ AEAAVKPLL PHHVVA +QEIQL AAVGE+LLLEWLA 
Sbjct  1   MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAE  60

Query  61  AVMLLLLCCC  70
            V L    CC
Sbjct  61  VVKLPSRYCC  70


> sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus auratus 
OX=10036 GN=LY75 PE=2 SV=1
Length=1722

 Score = 30.4 bits (67),  Expect = 1.2, Method: Composition-based stats.
 Identities = 17/61 (28%), Positives = 30/61 (49%), Gaps = 0/61 (0%)

Query  4     SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM  63
             SCYNF+  ++  +  TQK   +  + L     +++   E +    V +LL   ++A  VM
Sbjct  1254  SCYNFMITKNRHRTITQKEVHSLCQKLHSKAQILSIRNEEENNFVVEQLLYFNYIASWVM  1313

Query  64    L  64
             L
Sbjct  1314  L  1314


> sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 
GN=LY75 PE=1 SV=3
Length=1722

 Score = 30.0 bits (66),  Expect = 1.7, Method: Composition-based stats.
 Identities = 16/60 (27%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  5     CYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVML  64
             CYNF+  ++   A+TQ       + L    H+++   E +    + +LL   ++A  VML
Sbjct  1255  CYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVML  1314


> sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 
GN=Ly75 PE=1 SV=2
Length=1723

 Score = 29.3 bits (64),  Expect = 3.2, Method: Composition-based stats.
 Identities = 17/61 (28%), Positives = 29/61 (48%), Gaps = 0/61 (0%)

Query  4     SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM  63
             SCYNF+   +  K  T +  ++  + L    H ++   E +    V +LL   ++A  VM
Sbjct  1255  SCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVM  1314

Query  64    L  64
             L
Sbjct  1315  L  1315



Lambda      K        H        a         alpha
   0.327    0.134    0.412    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968890528
Results from round 2


Query= sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 SV=1

Length=73
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS co...   106    7e-30
  sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavir...   105    2e-29
  sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute ...   101    8e-28

Sequences not found previously or not previously below threshold:

  sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus aura...  30.8    1.0  
  sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9...  30.4    1.3  
  sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=1...  30.0    1.5  
  sp|P44240|VG47_HAEIN Mu-like prophage FluMu protein gp47 OS=Hae...  28.1    6.0  


> sp|Q7TLC7|Y14_CVHSA Uncharacterized protein 14 OS=Human SARS 
coronavirus OX=694009 GN=ORF14 PE=1 SV=1
Length=70

 Score =  106 bits (264),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           ML  CYNFLKEQHCQKASTQ+ AEAAVKPLL PHHVVA +QEIQL AAVGE+LLLEWLA 
Sbjct  1   MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAE  60

Query  61  AVMLLLLCCC  70
            V L    CC
Sbjct  61  VVKLPSRYCC  70


> sp|Q3I5I5|Y14_BCRP3 Uncharacterized protein 14 OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=ORF14 PE=4 SV=1
Length=70

 Score =  105 bits (261),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 58/70 (83%), Gaps = 0/70 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           ML SCYNFLKEQHCQKASTQKGAEAAVKPLL  HHVVA +QEIQL AAVGE+L LEWLA 
Sbjct  1   MLPSCYNFLKEQHCQKASTQKGAEAAVKPLLALHHVVAVIQEIQLLAAVGEILQLEWLAE  60

Query  61  AVMLLLLCCC  70
           AV L    CC
Sbjct  61  AVKLPSRYCC  70


> sp|P0DTD3|Y14_SARS2 Uncharacterized protein 14 OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=ORF14 PE=3 
SV=1
Length=73

 Score =  101 bits (251),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 73/73 (100%), Positives = 73/73 (100%), Gaps = 0/73 (0%)

Query  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60
           MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM
Sbjct  1   MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM  60

Query  61  AVMLLLLCCCLTD  73
           AVMLLLLCCCLTD
Sbjct  61  AVMLLLLCCCLTD  73


> sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 OS=Mesocricetus auratus 
OX=10036 GN=LY75 PE=2 SV=1
Length=1722

 Score = 30.8 bits (68),  Expect = 1.0, Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 31/65 (48%), Gaps = 0/65 (0%)

Query  4     SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM  63
             SCYNF+  ++  +  TQK   +  + L     +++   E +    V +LL   ++A  VM
Sbjct  1254  SCYNFMITKNRHRTITQKEVHSLCQKLHSKAQILSIRNEEENNFVVEQLLYFNYIASWVM  1313

Query  64    LLLLC  68
             L +  
Sbjct  1314  LGVTY  1318


> sp|O60449|LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 
GN=LY75 PE=1 SV=3
Length=1722

 Score = 30.4 bits (67),  Expect = 1.3, Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 30/64 (47%), Gaps = 0/64 (0%)

Query  5     CYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVML  64
             CYNF+  ++   A+TQ       + L    H+++   E +    + +LL   ++A  VML
Sbjct  1255  CYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVML  1314

Query  65    LLLC  68
              +  
Sbjct  1315  GITY  1318


> sp|Q60767|LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 
GN=Ly75 PE=1 SV=2
Length=1723

 Score = 30.0 bits (66),  Expect = 1.5, Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 0/65 (0%)

Query  4     SCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVM  63
             SCYNF+   +  K  T +  ++  + L    H ++   E +    V +LL   ++A  VM
Sbjct  1255  SCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVM  1314

Query  64    LLLLC  68
             L +  
Sbjct  1315  LGITY  1319


> sp|P44240|VG47_HAEIN Mu-like prophage FluMu protein gp47 OS=Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 
/ Rd) OX=71421 GN=HI_1520 PE=3 SV=1
Length=355

 Score = 28.1 bits (61),  Expect = 6.0, Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  29  PLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAV  62
           P L  H+V+  +  I    + GE + L+WLA  +
Sbjct  24  PTLKRHNVIGVINRICAALSAGEHMHLDWLARQI  57



Lambda      K        H        a         alpha
   0.323    0.137    0.427    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0412    0.140     1.90     42.6     43.6 

Effective search space used: 4968890528

Search has CONVERGED!


  Database: uniprot_sprot.fasta
    Posted date:  Aug 19, 2020  9:15 PM
  Number of letters in database: 202,799,066
  Number of sequences in database:  563,082



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40