PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens
OX=9606 GN=KPNA2 PE=1 SV=1

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens O...  1089    0.0   
  sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus O...  1038    0.0   
  sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis...   672    0.0   
  sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis...   659    0.0   
  sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens O...   561    0.0   
  sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus OX=...   543    0.0   
  sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa OX=98...   537    0.0   
  sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus O...   528    0.0   
  sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens O...   526    0.0   
  sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens O...   511    5e-175
  sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus O...   511    5e-175
  sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melano...   484    2e-164
  sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus O...   480    3e-163
  sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharo...   474    1e-160
  sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio OX...   455    6e-153
  sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii O...   450    7e-151
  sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens O...   450    7e-151
  sp|G5EB89|KAPA_EMENI Importin subunit alpha OS=Emericella nidul...   449    2e-150
  sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis t...   448    3e-150
  sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus OX=...   448    4e-150
  sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicu...   446    1e-149
  sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus O...   446    2e-149
  sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens O...   442    1e-147
  sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis t...   441    1e-147
  sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces ce...   442    1e-147
  sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis...   439    5e-147
  sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa...   437    6e-146
  sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis t...   436    1e-145
  sp|B6HJ92|KAPA_PENRW Importin subunit alpha OS=Penicillium rube...   436    4e-145
  sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium ...   432    2e-144
  sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus ...   432    9e-144
  sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis t...   431    3e-143
  sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersi...   429    6e-143
  sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharo...   429    1e-142
  sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa...   426    1e-141
  sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus OX=...   426    1e-141
  sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii O...   425    3e-141
  sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicu...   424    5e-141
  sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus O...   424    1e-140
  sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens O...   423    2e-140
  sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis t...   421    1e-139
  sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis t...   400    5e-132
  sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis t...   355    5e-114
  sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis...   346    1e-110
  sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dict...   330    2e-104
  sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis t...   267    2e-81 
  sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis t...   172    9e-46 
  sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa ...   162    3e-42 
  sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis...  85.5    3e-16 
  sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoform...  72.8    3e-12 
  sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoform...  72.8    3e-12 
  sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 O...  71.2    1e-11 
  sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Ar...  70.5    2e-11 
  sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis...  69.7    3e-11 
  sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculu...  68.6    6e-11 
  sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (str...  67.4    1e-10 
  sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapien...  63.5    2e-09 
  sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata...  63.2    3e-09 
  sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastori...  61.2    1e-08 
  sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (...  59.7    4e-08 
  sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hanseni...  59.3    5e-08 
  sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (st...  57.8    1e-07 
  sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevi...  57.8    2e-07 
  sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (st...  57.4    2e-07 
  sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (str...  56.6    3e-07 
  sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (s...  55.8    6e-07 
  sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica ...  53.9    3e-06 
  sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Ara...  51.2    2e-05 
  sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum ...  50.8    2e-05 
  sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabid...  50.4    4e-05 
  sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus OX=1011...  50.1    4e-05 
  sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus OX=10090 G...  50.1    5e-05 
  sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 GN...  49.7    6e-05 
  sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris ...  49.7    6e-05 
  sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=C...  49.7    6e-05 
  sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=...  49.3    7e-05 
  sp|F1QGH7|CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=...  48.5    1e-04 
  sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=...  47.0    4e-04 
  sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoide...  47.0    4e-04 
  sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabi...  46.6    5e-04 
  sp|P26233|CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 ...  46.6    5e-04 
  sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces ...  46.2    5e-04 
  sp|Q8IUR7|ARMC8_HUMAN Armadillo repeat-containing protein 8 OS=...  45.8    9e-04 
  sp|Q2KI54|ARMC8_BOVIN Armadillo repeat-containing protein 8 OS=...  45.4    0.001 
  sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabi...  45.1    0.002 
  sp|Q5R6S3|ARMC8_PONAB Armadillo repeat-containing protein 8 OS=...  44.7    0.002 
  sp|Q7Z5J8|ANKAR_HUMAN Ankyrin and armadillo repeat-containing p...  45.1    0.002 
  sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabi...  44.3    0.003 
  sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing p...  44.3    0.003 
  sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=...  44.3    0.003 
  sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes...  43.5    0.005 
  sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=...  43.5    0.006 
  sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattu...  43.1    0.008 
  sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus...  43.1    0.008 
  sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos...  42.7    0.008 
  sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Hom...  42.7    0.009 
  sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xen...  42.0    0.018 
  sp|Q9SV36|KINUC_ARATH Kinesin-like protein KIN-UC OS=Arabidopsi...  41.6    0.019 
  sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thali...  41.2    0.022 
  sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 1 ...  41.2    0.023 
  sp|Q9U308|JAC1_CAEEL Juxtamembrane domain-associated catenin OS...  41.2    0.028 
  sp|Q9DBR3|ARMC8_MOUSE Armadillo repeat-containing protein 8 OS=...  40.8    0.028 
  sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis OX=...  40.4    0.039 
  sp|Q68FK4|ARMC8_XENLA Armadillo repeat-containing protein 8 OS=...  40.0    0.049 
  sp|O13986|YEG4_SCHPO Uncharacterized protein C26H5.04 OS=Schizo...  40.0    0.050 
  sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabi...  40.0    0.051 
  sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca...  40.0    0.055 
  sp|Q05AL1|ARMC8_DANRE Armadillo repeat-containing protein 8 OS=...  40.0    0.058 
  sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo OX=6431 PE=2...  40.0    0.060 
  sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anoph...  39.7    0.068 
  sp|Q5VQ09|KINUB_ORYSJ Kinesin-like protein KIN-UB OS=Oryza sati...  39.7    0.070 
  sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Droso...  39.7    0.080 
  sp|Q99569|PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=P...  39.7    0.084 
  sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Droso...  39.7    0.084 
  sp|Q68FH0|PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=...  39.3    0.11  
  sp|P52306|GDS1_HUMAN Rap1 GTPase-GDP dissociation stimulator 1 ...  38.9    0.11  
  sp|F4I718|CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 O...  39.3    0.12  
  sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Ara...  38.9    0.12  
  sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabid...  38.5    0.18  
  sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus OX=9913...  38.5    0.18  
  sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus OX...  38.1    0.21  
  sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10...  38.1    0.22  
  sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa OX=9823 G...  38.1    0.23  
  sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=96...  38.1    0.23  
  sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Dan...  37.7    0.29  
  sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thali...  37.4    0.35  
  sp|O93614|GDS1A_XENLA Rap1 GTPase-GDP dissociation stimulator 1...  37.4    0.39  
  sp|O34808|UXAC_BACSU Uronate isomerase OS=Bacillus subtilis (st...  37.0    0.42  
  sp|Q5EBP3|ARMC5_MOUSE Armadillo repeat-containing protein 5 OS=...  37.0    0.59  
  sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio O...  36.6    0.61  
  sp|A7Z3M5|UXAC_BACVZ Uronate isomerase OS=Bacillus velezensis (...  36.6    0.61  
  sp|Q0DV28|KINUA_ORYSJ Kinesin-like protein KIN-UA OS=Oryza sati...  36.6    0.64  
  sp|P36144|RL1D1_YEAST Ribosome biogenesis protein UTP30 OS=Sacc...  35.8    0.70  
  sp|P80911|IORB_METTM Indolepyruvate oxidoreductase subunit IorB...  35.4    0.71  
  sp|Q54VU5|Y0038_DICDI Probable inactive serine/threonine-protei...  36.2    0.92  
  sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Ara...  35.8    1.1   
  sp|Q9LPC6|KINUB_ARATH Kinesin-like protein KIN-UB OS=Arabidopsi...  35.8    1.2   
  sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevi...  35.4    1.4   
  sp|Q55BR7|RPTOR_DICDI Protein raptor homolog OS=Dictyostelium d...  35.4    1.6   
  sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=...  34.7    2.3   
  sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-prot...  34.7    2.6   
  sp|Q5PPZ9|GDS1B_XENLA Rap1 GTPase-GDP dissociation stimulator 1...  34.7    2.8   
  sp|E4NKF8|PUB1_MEDTR U-box domain-containing protein 1 OS=Medic...  34.3    2.9   
  sp|Q9FZ06|KINUA_ARATH Kinesin-like protein KIN-UA OS=Arabidopsi...  34.3    3.4   
  sp|Q9VM21|GUDU_DROME Armadillo repeat-containing protein gudu O...  33.9    4.2   
  sp|O27881|IORB_METTH Indolepyruvate oxidoreductase subunit IorB...  33.1    4.6   
  sp|Q8BJY1|PSMD5_MOUSE 26S proteasome non-ATPase regulatory subu...  33.9    4.7   
  sp|Q10FT0|PUB24_ORYSJ U-box domain-containing protein 24 OS=Ory...  33.9    4.7   
  sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47...  33.5    6.3   
  sp|Q8CPZ0|UVRB_STAES UvrABC system protein B OS=Staphylococcus ...  33.5    6.4   
  sp|Q5HQX0|UVRB_STAEQ UvrABC system protein B OS=Staphylococcus ...  33.5    6.4   
  sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabi...  33.1    7.0   
  sp|Q640C5|DOPDB_XENLA D-dopachrome decarboxylase-B OS=Xenopus l...  31.2    8.3   
  sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Ara...  32.7    8.8   


> sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens 
OX=9606 GN=KPNA2 PE=1 SV=1
Length=529

 Score = 1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/529 (100%), Positives = 529/529 (100%), Gaps = 0/529 (0%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA
Sbjct  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL
Sbjct  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
Sbjct  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK
Sbjct  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK
Sbjct  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS
Sbjct  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG
Sbjct  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE
Sbjct  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF
Sbjct  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529


> sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus 
OX=10090 GN=Kpna2 PE=1 SV=2
Length=529

 Score = 1038 bits (2685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/529 (95%), Positives = 519/529 (98%), Gaps = 0/529 (0%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MSTNENAN PAARL+RFKNKGKDSTEMRRRRIEVNVELRKAKKD+QMLKRRNVSSFPDDA
Sbjct  1    MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDA  60

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            TSPLQENRNNQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGL
Sbjct  61   TSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGL  120

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            IPKFVSFLG+TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
Sbjct  121  IPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNK
Sbjct  181  QAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNK  240

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            NPAPP+DAVEQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVK
Sbjct  241  NPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVK  300

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LLGA+ELPIVTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMS
Sbjct  301  LLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAGRQDQIQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCG
Sbjct  361  NITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCG  420

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            IIEPLMNLL+AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HE
Sbjct  421  IIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHE  480

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            NESVYKASL+LIEKYFSVEEEEDQNVVPETTSEG+ FQVQDGAPGTFNF
Sbjct  481  NESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF  529


> sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis 
OX=8355 GN=kpna1 PE=1 SV=2
Length=522

 Score =  672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/517 (63%), Positives = 407/517 (79%), Gaps = 4/517 (1%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQG  72
            R+ +FKNKGKD+ E+RRRR+EV+VELRKAKKD+Q+LKRRNV    +   SP +    +  
Sbjct  10   RMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNVCLPEELILSPEKNAMQSVQ  69

Query  73   TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD  132
                S+++IV+G+NS + EN+L+ TQAARK+LSRE+ PP+++II AGLIPK V FL R D
Sbjct  70   VPPLSLEEIVQGMNSGDPENELRCTQAARKMLSRERNPPLNDIIEAGLIPKLVEFLSRHD  129

Query  133  CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD  192
             S +QFE+AWALTNIASGTS+QTK+VVDGGAIPAFISL++SPH HISEQAVWALGNIAGD
Sbjct  130  NSTLQFEAAWALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVWALGNIAGD  189

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
            G ++RD +I    + PLLAL+          GYLRN+TW LSNLCRNKNP PP+ AV QI
Sbjct  190  GPLYRDALINCNVIPPLLALVN----PQTPLGYLRNITWMLSNLCRNKNPYPPMSAVLQI  245

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            LP L +L+HHDD ++L+DTCWA+SYLTDG N+RI +VVKTG+V +L++L+ + EL IVTP
Sbjct  246  LPVLTQLMHHDDKDILSDTCWAMSYLTDGSNDRIDVVVKTGIVDRLIQLMYSPELSIVTP  305

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            +LR +GNIVTGTD+QTQ  IDAG L+V P LL + K +IQKEA W +SNI AG   QIQQ
Sbjct  306  SLRTVGNIVTGTDKQTQAAIDAGVLSVLPQLLRHQKPSIQKEAAWAISNIAAGPAPQIQQ  365

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            ++  GL+  LV +L+K DFK QKEAVWAVTNYTSGGTVEQ+V LV CG++EPL+NLLT K
Sbjct  366  MITCGLLSPLVDLLNKGDFKAQKEAVWAVTNYTSGGTVEQVVQLVQCGVLEPLLNLLTIK  425

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI  492
            D+K ILVILDAISNIF AAEKLGE EKL +++EE GGL+KIEALQ H+N  VY A+L+LI
Sbjct  426  DSKTILVILDAISNIFLAAEKLGEQEKLCLLVEELGGLEKIEALQTHDNHMVYHAALALI  485

Query  493  EKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            EKYFS EE +D  + PE   + YTFQV +    +FNF
Sbjct  486  EKYFSGEEADDIALEPEMGKDAYTFQVPNMQKESFNF  522


> sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis 
OX=8355 GN=kpna2 PE=1 SV=2
Length=523

 Score =  659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/524 (62%), Positives = 410/524 (78%), Gaps = 7/524 (1%)

Query  8    NTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT-SPLQE  66
            N    R+ +FKNKGKD+ E+RRRR+EV+VELRKAKKD+Q+LKRRNV  FP++   SP + 
Sbjct  5    NEADERMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNVC-FPEELILSPEKN  63

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVS  126
               +      S+++IV+G+NS + EN+L++TQAARK+LS+E+ PP+++II AGLIPK V 
Sbjct  64   AMQSIQVPQLSLEEIVQGMNSGDNENELRSTQAARKMLSKERNPPLNDIIEAGLIPKLVE  123

Query  127  FLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL  186
            FL   + S +QFE+AWALTNIASGTS+QTK+VVDGGAIPAFISL++SPH HISEQAVWAL
Sbjct  124  FLSYHNNSTLQFEAAWALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVWAL  183

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            GNIAGDG ++RD +I    + PLL L+          GYLRN+TWTLSNLCRNKNP PP+
Sbjct  184  GNIAGDGPLYRDALISCNVIPPLLTLVN----PQTPLGYLRNITWTLSNLCRNKNPYPPM  239

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
             AV QILP L +L+ H+D ++L+DTCWA+SYLTDG N+RI +VVKTG+V +L++L+ + E
Sbjct  240  SAVLQILPVLTQLMLHEDKDILSDTCWAMSYLTDGSNDRIDVVVKTGLVERLIQLMYSPE  299

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
            L I+TP+LR +GNIVTGTD+QTQ  IDAG L+V P LL + K +IQKEA W +SNI AG 
Sbjct  300  LSILTPSLRTVGNIVTGTDKQTQAAIDAGVLSVLPQLLRHQKPSIQKEAAWALSNIAAGP  359

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
              QIQQ++  GL+  LV +L K DFK QKEAVWAVTNYTSGGTVEQ+V LV CG++EPL+
Sbjct  360  APQIQQMITCGLLSPLVDLLKKGDFKAQKEAVWAVTNYTSGGTVEQVVQLVQCGVLEPLL  419

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK  486
            NLLT KD+K ILVILDAISNIF AAEKLGE EKL +++EE GGL+KIEALQ H+N  VY 
Sbjct  420  NLLTIKDSKTILVILDAISNIFLAAEKLGEQEKLCLLVEELGGLEKIEALQTHDNRMVYH  479

Query  487  ASLSLIEKYFSVEEEEDQNVV-PETTSEGYTFQVQDGAPGTFNF  529
            A+L+LIEKYFS EE ++ N + PE  ++ YTFQV +    +F F
Sbjct  480  AALALIEKYFSGEEADEMNALEPEVGNDAYTFQVPNMQKESFKF  523


> sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens 
OX=9606 GN=KPNA7 PE=1 SV=1
Length=516

 Score =  561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/510 (55%), Positives = 371/510 (73%), Gaps = 7/510 (1%)

Query  8    NTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQEN  67
            + P  R  +FK +GKD +  R++R+ V++ELRKAKKD+Q LKRRN++SF  D  S   E 
Sbjct  5    DAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPS---EK  61

Query  68   RNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSF  127
                  V+ ++ +I+KG+NSS+     QATQ ARK+LS+EK PP+  +I AGLIP+ V F
Sbjct  62   TAKGVAVSLTLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRMVEF  121

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L  +    +QFE+AWALTNIASGTSEQT+AVV+GGAI   I LL+S +  + EQAVWALG
Sbjct  122  LKSSLYPCLQFEAAWALTNIASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVWALG  181

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGDG  FRD VI   A+  LLAL++     +L   +LRN+TWTLSNLCRNKNP P   
Sbjct  182  NIAGDGPEFRDNVITSNAIPHLLALIS----PTLPITFLRNITWTLSNLCRNKNPYPCDT  237

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
            AV+QILP L+ LL H D EVL+D CWA+SYLTDG N+RIG VV TGV+P+LV L+ +SEL
Sbjct  238  AVKQILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVVNTGVLPRLVVLMTSSEL  297

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             ++TP+LR +GNIVTGTDEQTQ+ IDAG L V P LL + K +IQKEA W +SN+ AG  
Sbjct  298  NVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALSNVAAGPC  357

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
              IQQ++ + ++P LV++L   +FK QKEAVW V N+ +G T++Q++ LVH G++EPL+N
Sbjct  358  HHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVN  417

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKA  487
            LLTA D KI+L+ILD IS I QAAEK  E E L ++IEE GG+D+IEALQ HEN  + ++
Sbjct  418  LLTAPDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQS  477

Query  488  SLSLIEKYFSVEEEEDQNVVPETTSEGYTF  517
            +L++IEK+F  EE+E Q ++ +   + Y F
Sbjct  478  ALNIIEKHFGEEEDESQTLLSQVIDQDYEF  507


> sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus OX=9913 
GN=KPNA7 PE=1 SV=2
Length=522

 Score =  543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/494 (55%), Positives = 362/494 (73%), Gaps = 10/494 (2%)

Query  8    NTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQEN  67
            + P  RL +FK +GKD++  R++RI V++ELRKAKKD+Q LKRRN++    D +     +
Sbjct  5    DAPEERLRKFKYRGKDASARRQQRIAVSLELRKAKKDEQALKRRNITDVSLDPS-----D  59

Query  68   RNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSF  127
            +  +G V+ ++ +I+ G+N+S+ E   QATQAARK+LSREK PP+  I+ AGLIP+ V  
Sbjct  60   QQTKG-VSLTLQEIISGVNASDPELCFQATQAARKMLSREKNPPLKLIVDAGLIPRLVEL  118

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L  +    +QFE+AWALTNIASG SE T+AVV GGAI   + LL+SPH  + EQAVWALG
Sbjct  119  LKSSLHPRLQFEAAWALTNIASGASELTRAVVVGGAIQPLVELLSSPHMTVCEQAVWALG  178

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGDG  FRD VI   A+  LL L++    SS+   +LRN+ WTLSNLCRNKNP P   
Sbjct  179  NIAGDGPEFRDNVIASDAIPHLLTLVS----SSIPVPFLRNIAWTLSNLCRNKNPYPSDH  234

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
            AV+Q+LP L  LL H D EVL+DTCWA+SYLTDG + RIG VV TGV+P+LV+L+ +SEL
Sbjct  235  AVKQMLPALFYLLGHPDREVLSDTCWALSYLTDGCDARIGQVVDTGVLPRLVELMSSSEL  294

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             I+TP+LR +GNIVTGTD QTQ+ +DAG L V P LLT+P+ +IQKEA W +SN+ AG +
Sbjct  295  NILTPSLRTVGNIVTGTDHQTQLALDAGILGVLPQLLTHPRPSIQKEAAWALSNVAAGPR  354

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
              IQ+++  G +P LV+VL   +FK QKEAVW V N+T+GG+VEQ++ LV  G++EPL+N
Sbjct  355  QHIQRLIACGALPPLVAVLKNGEFKVQKEAVWTVANFTTGGSVEQLIQLVQAGVLEPLIN  414

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKA  487
            LLT  D K++++ILD +  I QAAEK+ + E + ++IE  GGLD+IEALQ HEN  V   
Sbjct  415  LLTIPDNKMVIIILDVLFFILQAAEKISQKENMCLLIEGLGGLDRIEALQLHENHQVALT  474

Query  488  SLSLIEKYFSVEEE  501
            +L++IE++FS EEE
Sbjct  475  ALNIIERHFSEEEE  488


> sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa OX=9823 
GN=KPNA7 PE=2 SV=2
Length=507

 Score =  537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/495 (55%), Positives = 366/495 (74%), Gaps = 15/495 (3%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRN  69
            P  RL +FK +GKD++  R++R+ V++ELRKAKKD+Q LKRRN+++    A+ P  +  N
Sbjct  7    PEERLRKFKYRGKDASVRRQQRLAVSLELRKAKKDEQALKRRNITT----ASDPFVQQTN  62

Query  70   NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG  129
                   ++ +I+ G+N+S+ E   QATQAARK+LS+E+ PP+  ++ AGLIP+ V  L 
Sbjct  63   G---AKLTLQEIIHGVNASDPEQCFQATQAARKMLSQERNPPLKLMVEAGLIPRLVQLL-  118

Query  130  RTDCSP-IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN  188
            R+   P +QFE+AWALTNIASG SE T+AVV+GGAI   + LLAS H  + EQAVWALGN
Sbjct  119  RSSLHPCLQFEAAWALTNIASGASELTRAVVEGGAIQPLVELLASSHMSVCEQAVWALGN  178

Query  189  IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
            IAGDG+ FRD+VI   A+  LLAL +    S++   +LRN+ WTLSNLCRNKNP P  +A
Sbjct  179  IAGDGAEFRDIVISSNAIPHLLALAS----SNVPVTFLRNIVWTLSNLCRNKNPCPCDNA  234

Query  249  VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP  308
            V+Q+LP L  LL H D EVL+DTCWA+SYLTDG +ERIG VV  GV+P+LV+L+ +SEL 
Sbjct  235  VKQMLPVLSHLLQHRDSEVLSDTCWALSYLTDGCDERIGQVVDMGVLPRLVELMTSSELN  294

Query  309  IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            ++TP+LR +GNIVTGTD QTQ+ IDAG L+V P LL +P+++IQKEA W +SN+ AG   
Sbjct  295  VLTPSLRTVGNIVTGTDPQTQLAIDAGLLSVLPHLLLHPRSSIQKEAAWALSNVAAGPHQ  354

Query  369  QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNL  428
             IQQ++  G +P LV++L   +FK QKEAVW V N+T+GGTV+Q+V LV  G++EPL+NL
Sbjct  355  HIQQLIACGALPPLVALLKNGEFKVQKEAVWTVANFTTGGTVDQLVQLVQAGVLEPLINL  414

Query  429  LTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS  488
            L  +DTK++++ILD I  I QAAEK+ + E + ++IE  GG+DKIEALQ HEN  V   +
Sbjct  415  LDIQDTKMVIIILDVIFFILQAAEKISQKENMCLLIEGLGGIDKIEALQLHENRQVALTA  474

Query  489  LSLIEKYFSVEEEED  503
            LS+IE+YFS  EEED
Sbjct  475  LSIIERYFS--EEED  487


> sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus 
OX=10090 GN=Kpna4 PE=1 SV=1
Length=521

 Score =  528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/518 (51%), Positives = 360/518 (69%), Gaps = 13/518 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M+ NE  +    RL  FKNKG+D   MRR+R EV VELRK K+D+ +LKRRNV   P + 
Sbjct  1    MADNEKLDN--QRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNV---PQED  55

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                 +   +    N S++ IV+  +S N   QL A QAARKLLS ++ PPID++I++G+
Sbjct  56   ICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGI  115

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P  V  L R D   +QFE+AWALTNIASGTSEQT+AVV   A+P F+ LL SPH ++ E
Sbjct  116  LPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCE  175

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCR+K
Sbjct  176  QAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHK  231

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +P PP++ +++ILP L  L+HH D  +L DT WA+SYLTD  NE+I MV+ +G+VP LV 
Sbjct  232  DPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVP  291

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL   E+ + T ALRA+GNIVTGTDEQTQVV++  AL+ FP+LLT+PK  I KEA W +S
Sbjct  292  LLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLS  351

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAG Q Q+Q V++  LVP ++ +L K DF TQKEA WA++N T  G  +Q+ YL+   
Sbjct  352  NITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQN  411

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            +I P  NLLT KD +++ V+LD +SNI + AE   ET  ++ +IEECGGL+KIE LQNHE
Sbjct  412  VIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAET--IANLIEECGGLEKIEQLQNHE  469

Query  481  NESVYKASLSLIEKYFSVEE-EEDQNVVPETTSEGYTF  517
            NE +YK +  +I+++FS ++ +ED ++VPE+  +G TF
Sbjct  470  NEDIYKLAYEIIDQFFSSDDIDEDPSLVPESV-QGGTF  506


> sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens 
OX=9606 GN=KPNA4 PE=1 SV=1
Length=521

 Score =  526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/518 (51%), Positives = 358/518 (69%), Gaps = 13/518 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M+ NE  +    RL  FKNKG+D   MRR+R EV VELRK K+D+ +LKRRNV   P + 
Sbjct  1    MADNEKLDN--QRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNV---PHED  55

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                 +   +    N S++ IV+  +S N   QL A QAARKLLS ++ PPID++I++G+
Sbjct  56   ICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGI  115

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P  V  L R D   +QFE+AWALTNIASGTSEQT+AVV   A+P F+ LL SPH ++ E
Sbjct  116  LPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCE  175

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCR+K
Sbjct  176  QAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHK  231

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +P PP++ +++ILP L  L+HH D  +L DT WA+SYLTD  NE+I MV+ +G+VP LV 
Sbjct  232  DPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVP  291

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL   E+ + T ALRA+GNIVTGTDEQTQVV++  AL+ FP+LLT+PK  I KEA W +S
Sbjct  292  LLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLS  351

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAG Q Q+Q V++  LVP ++ +L K DF TQKEA WA++N T  G  +Q+ YL+   
Sbjct  352  NITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQN  411

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            +I P  NLLT KD +++ V+LD +SNI + AE   E E +  +IEECGGL+KIE LQNHE
Sbjct  412  VIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQLQNHE  469

Query  481  NESVYKASLSLIEKYFSVEE-EEDQNVVPETTSEGYTF  517
            NE +YK +  +I+++FS ++ +ED ++VPE   +G TF
Sbjct  470  NEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAI-QGGTF  506


> sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens 
OX=9606 GN=KPNA3 PE=1 SV=2
Length=521

 Score =  511 bits (1316),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 350/515 (68%), Gaps = 11/515 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
            EN +    R+  FKNKG+D   MRR R EV VELRK K+D+ +LK+RNV        S +
Sbjct  3    ENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDV  62

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
              +   Q   N +++ I++   S N   QL A QAARKLLS ++ PPID++I++G++P  
Sbjct  63   DADFKAQ---NVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPIL  119

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L R D   +QFE+AWALTNIASGTS QT+AVV   A+P F+ LL SPH ++ EQAVW
Sbjct  120  VKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVW  179

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCRNK+P P
Sbjct  180  ALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVIVNLCRNKDPPP  235

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P++ V++ILP L  L++H D  +L DT WA+SYLTDG NE+I MV+ +GVVP LV LL  
Sbjct  236  PMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSH  295

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             E+ + T ALRA+GNIVTGTDEQTQVV++   L+ FP+LL++PK  I KEA W +SNITA
Sbjct  296  QEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITA  355

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G Q Q+Q V++ GL+P ++  L+K DF TQKEA WA++N T  G  +Q+ YLV   +I P
Sbjct  356  GNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPP  415

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
              NLL+ KD++++ V+LD + NI   A    E   ++ +IEECGGL+KIE LQ HENE +
Sbjct  416  FCNLLSVKDSQVVQVVLDGLKNILIMAGD--EASTIAEIIEECGGLEKIEVLQQHENEDI  473

Query  485  YKASLSLIEKYFSVEE-EEDQNVVPETTSEG-YTF  517
            YK +  +I++YFS ++ +ED  ++PE T  G Y F
Sbjct  474  YKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNF  508


> sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus 
OX=10090 GN=Kpna3 PE=1 SV=1
Length=521

 Score =  511 bits (1316),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 349/515 (68%), Gaps = 11/515 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
            EN      R+  FKNKG+D   MRR R EV VELRK K+D+ +LK+RNV        S +
Sbjct  3    ENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDV  62

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
              +   Q   N +++ I++   S N   QL A QAARKLLS ++ PPID++I++G++P  
Sbjct  63   DADFKAQ---NVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPIL  119

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L R D   +QFE+AWALTNIASGTS QT+AVV   A+P F+ LL SPH ++ EQAVW
Sbjct  120  VKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVW  179

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNI GDG   RD VI  G V PLL+ +      S+   +LRN+TW + NLCRNK+P P
Sbjct  180  ALGNIIGDGPQCRDYVISLGVVKPLLSFIN----PSIPITFLRNVTWVIVNLCRNKDPPP  235

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P++ V++ILP L  L++H D  +L DT WA+SYLTDG NE+I MV+ +GVVP LV LL  
Sbjct  236  PMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSH  295

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             E+ + T ALRA+GNIVTGTDEQTQVV++   L+ FP+LL++PK  I KEA W +SNITA
Sbjct  296  QEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITA  355

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G Q Q+Q V++ GL+P ++  L+K DF TQKEA WA++N T  G  +Q+ YLV   +I P
Sbjct  356  GNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPP  415

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
              NLL+ KD++++ V+LD + NI   A    E   ++ +IEECGGL+KIE LQ HENE +
Sbjct  416  FCNLLSVKDSQVVQVVLDGLKNILIMAGD--EASTIAEIIEECGGLEKIEVLQQHENEDI  473

Query  485  YKASLSLIEKYFSVEE-EEDQNVVPETTSEG-YTF  517
            YK +  +I++YFS ++ +ED +++PE T  G Y F
Sbjct  474  YKLAFEIIDQYFSGDDIDEDPSLIPEATQGGTYNF  508


> sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster 
OX=7227 GN=Pen PE=1 SV=2
Length=522

 Score =  484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 264/522 (51%), Positives = 355/522 (68%), Gaps = 11/522 (2%)

Query  12   ARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQ  71
            +R   +K    ++ + R RR EV +ELRK+KK+DQM KRRN++   +D TSPL+E  N Q
Sbjct  8    SRQGSYKANSINTQDSRMRRHEVTIELRKSKKEDQMFKRRNIND--EDLTSPLKE-LNGQ  64

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT  131
              V  SVD+IV  +NS + E Q    Q+ARK+LSRE+ PPID +I  G++P  + FL  T
Sbjct  65   SPVQLSVDEIVAAMNSEDQERQFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNT  124

Query  132  DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG  191
            + S +QFE+AWALTNIASGTS+QT+ V++  A+P F++LL S   +++EQAVWALGNIAG
Sbjct  125  NNSMLQFEAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAG  184

Query  192  DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ  251
            DG+  RD+VI +  +D +L L+     +     +LRN+ W +SNLCRNKNP+PP D V++
Sbjct  185  DGAAARDIVIHHNVIDGILPLIN----NETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKR  240

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT  311
            +LP L +LL   D +VLAD CWA+SY+TD  N +I  VV +  VP+LVKLL   E  I+ 
Sbjct  241  LLPVLSQLLLSQDIQVLADACWALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIV  300

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
            PALR++GNIVTGTD+QT VVI +G L     LL + K+NI KEA WT+SNITAG Q QIQ
Sbjct  301  PALRSVGNIVTGTDQQTDVVIASGGLPRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQ  360

Query  372  QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH-CGIIEPLMNLLT  430
             V+  G+   L +VL K DFK QKEA WAVTN T+ GT EQIV L+    I++P ++LL 
Sbjct  361  AVIQAGIFQQLRTVLEKGDFKAQKEAAWAVTNTTTSGTPEQIVDLIEKYKILKPFIDLLD  420

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
             KD + I V+   +SN+F  AEKLG TE L +M+EE GGLDK+E LQ HENE VYK + +
Sbjct  421  TKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEEMGGLDKLETLQQHENEEVYKKAYA  480

Query  491  LIEKYFSV-EEEEDQNVVPETTSEGYTFQ-VQDGAP-GTFNF  529
            +I+ YFS  ++E +Q + P+  +    F   Q  AP G + F
Sbjct  481  IIDTYFSNGDDEAEQELAPQEVNGALEFNATQPKAPEGGYTF  522


> sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus 
OX=10090 GN=Kpna7 PE=1 SV=1
Length=499

 Score =  480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 342/502 (68%), Gaps = 12/502 (2%)

Query  7    ANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE  66
            +  P  RL  +K +GK+ +  R++RI  +++LRK +KD+Q+LKRRN+  F  D  S    
Sbjct  4    SKAPKERLKNYKYRGKEMSLPRQQRIASSLQLRKTRKDEQVLKRRNIDLFSSDMVS----  59

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVS  126
             +     VN+++DDI++ +NSS+     +AT+AAR+++S+E  PP++ II AGLIPK V 
Sbjct  60   -QALVKEVNFTLDDIIQAVNSSDPILHFRATRAAREMISQENTPPLNLIIEAGLIPKLVD  118

Query  127  FLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL  186
            FL  T    +QFE+AW LTNIASGTSEQT+AVV  GAI   I LL SPH  +SEQAVWAL
Sbjct  119  FLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWAL  178

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            GNIAGD + FRD VI   A+  L+ L++      +   +LRN++WTLSNLCRNK+P P  
Sbjct  179  GNIAGDCAEFRDCVISNNAIPHLINLIS----KGIPITFLRNISWTLSNLCRNKDPYPSE  234

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
             AV Q+LP L +LL H D E+LADTCWA+SYLT G  E I  VV TG++P+LV+L+ +SE
Sbjct  235  SAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSE  294

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
            L I  P L  IGNIV GTDEQTQ+ IDAG L V   +L +PKT+IQ  A WTMSN+ AG 
Sbjct  295  LSISIPCLHTIGNIVAGTDEQTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAAGP  354

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
            + Q++Q++ + L+P LV +L  A+ K QKE V  V N  +G + +Q+  L H GI+EP++
Sbjct  355  RHQVEQLLCN-LLPILVDLLRNAELKVQKEVVCTVINIATGASQDQLTLLAHSGILEPML  413

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK  486
            +LL+A D ++++++LD IS + Q  + L E ++L   IE+ GG +KIE LQ+H N S+  
Sbjct  414  SLLSAPDLEVVIIVLDIISYLLQHIDNLQEKKRLYFQIEKFGGFEKIECLQHHHNISISN  473

Query  487  ASLSLIEKYFSVEEEEDQNVVP  508
            ++L +IEKYF   E+ D + +P
Sbjct  474  SALDIIEKYFC--EDGDGDSLP  493


> sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=1 
SV=1
Length=539

 Score =  474 bits (1221),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 249/529 (47%), Positives = 343/529 (65%), Gaps = 17/529 (3%)

Query  13   RLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQ  71
            R  RFK+KG   + E+RR+R E  +E+RK K+++ + KRRN+++   +     +E   +Q
Sbjct  9    RRSRFKSKGVFKADELRRQREEQQIEIRKQKREESLNKRRNLNAVLQNDIDVEEEADQSQ  68

Query  72   GTVNWSVDD----IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSF  127
              +   + D    +   + S ++E QL A    RK LS+E  PPID +I  G++ +FV F
Sbjct  69   VQMEQQMKDEFPKLTADVMSDDIELQLGAVTKFRKYLSKETHPPIDQVIACGVVDRFVQF  128

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L  ++   +QFE+AWALTNIASGT++QT+ VVD GA+P FI LL+SP   + EQ VWALG
Sbjct  129  L-ESEHHLLQFEAAWALTNIASGTTDQTRIVVDSGAVPRFIQLLSSPEKDVREQVVWALG  187

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGD S  RD V+  G + PLL +L     S+     LRN TWTLSNLCR KNP P   
Sbjct  188  NIAGDSSACRDYVLGNGVLQPLLNIL---QSSASDVSMLRNATWTLSNLCRGKNPPPNWS  244

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +   +P L +LL+ +D E++ D CWAISYL+DGPNE+IG ++  G  P+LV+LL +  +
Sbjct  245  TISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVGCAPRLVELLSSPSV  304

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             I TPALR++GNIVTGTD QTQ++ID GAL  FPSLL++ K NI+KEA WT+SNITAG  
Sbjct  305  NIQTPALRSVGNIVTGTDAQTQIIIDCGALNAFPSLLSHQKENIRKEACWTISNITAGNT  364

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG--GTVEQIVYLVHCGIIEPL  425
             QIQ ++   L+P LV +LS AD+KT+KEA WA++N TSG  G  +QI YLV  G+I+PL
Sbjct  365  QQIQAIIESNLIPPLVHLLSYADYKTKKEACWAISNATSGGLGQPDQIRYLVSQGVIKPL  424

Query  426  MNLLTAKDTKIILVILDAISNIFQAAE-----KLGETEKLSIMIEECGGLDKIEALQNHE  480
             ++L   D KII V LDAI NI +  E      L    + ++ +EE GG+D I  LQ+  
Sbjct  425  CDMLNGSDNKIIQVALDAIENILKVGEMDRTMDLENINQYAVYVEEAGGMDMIHDLQSSG  484

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            N  +Y  + S+IEKYFS +E+  +++ PET +  +TF     A G F F
Sbjct  485  NNDIYLKAYSIIEKYFS-DEDAVEDLAPETENGAFTFGNGPQAQGEFKF  532


> sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio 
OX=7955 GN=kpna5 PE=2 SV=2
Length=536

 Score =  455 bits (1171),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 254/535 (47%), Positives = 346/535 (65%), Gaps = 26/535 (5%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQENR-  68
            R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNVS  P D +    P+Q+   
Sbjct  10   RMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPPGDESMLECPIQDPDV  69

Query  69   ------NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII-RAGLI  121
                  + +G +     D+++ I S + + QL ATQ  RKLLS+E  PPID +I   G++
Sbjct  70   SSTVPVSGEGVI---TQDVIQMIFSEDPDQQLIATQKFRKLLSKEPNPPIDEVIGTPGVV  126

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ  181
             +FV FL R+D   +QFE+AWALTNIASGT + TK V++ GA+P FI LL S +  + EQ
Sbjct  127  NRFVEFLRRSDNCTLQFEAAWALTNIASGTFQHTKVVIETGAVPIFIELLNSEYEDVQEQ  186

Query  182  AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN  241
            AVWALGNIAGD +  RD V+  G +  L  LLA  +  +      RN  W LSNLCR KN
Sbjct  187  AVWALGNIAGDNAECRDYVLNCGILPSLQQLLAKSNRLTTT----RNAVWALSNLCRGKN  242

Query  242  PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL  301
            P P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I  V+ +GV  +LV+L
Sbjct  243  PPPDFAKVSPCLSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQTVIDSGVCRRLVEL  302

Query  302  LGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN  361
            L  S+  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SN
Sbjct  303  LMHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSN  362

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            ITAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV    
Sbjct  363  ITAGNRAQIQAVIDSNVFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLNT  422

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEAL  476
            I+P+ +LLT  D+KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE L
Sbjct  423  IKPMCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGTGINPYCALIEEAYGLDKIEFL  482

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQNVVPET-TSEG-YTFQVQDGAPGTFNF  529
            Q+HEN+ +Y+ +  LIE YF V EEED ++VP+   ++G Y FQ  +G    F  
Sbjct  483  QSHENQEIYQKAFDLIEHYFGV-EEEDASIVPQVDQNQGQYIFQQSEGPMEGFQL  536


> sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii 
OX=9601 GN=KPNA6 PE=2 SV=1
Length=536

 Score =  450 bits (1157),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 250/524 (48%), Positives = 338/524 (65%), Gaps = 18/524 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT--SPLQENRNN  70
            R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A     L  +   
Sbjct  13   RMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYV  72

Query  71   QGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSF  127
              T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I    ++ +FV F
Sbjct  73   SSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEF  132

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S    + EQAVWALG
Sbjct  133  LKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALG  192

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGD SV RD V+    ++PLL LL      S      RN  W LSNLCR KNP P   
Sbjct  193  NIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFA  248

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV  +LV+LL  ++ 
Sbjct  249  KVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDY  308

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             + +PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNITAG +
Sbjct  309  KVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNR  368

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
             QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I+PL +
Sbjct  369  AQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCD  428

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENE  482
            LLT  D+KI+ V L+ + NI +  E+ G+     +     +IEE  GLDKIE LQ+HEN+
Sbjct  429  LLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQ  488

Query  483  SVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
             +Y+ +  LIE YF V E++D ++ P+   T + + FQ Q  AP
Sbjct  489  EIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQ-QPEAP  530


> sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens 
OX=9606 GN=KPNA6 PE=1 SV=1
Length=536

 Score =  450 bits (1157),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 250/524 (48%), Positives = 338/524 (65%), Gaps = 18/524 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT--SPLQENRNN  70
            R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A     L  +   
Sbjct  13   RMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYV  72

Query  71   QGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSF  127
              T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I    ++ +FV F
Sbjct  73   SSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEF  132

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S    + EQAVWALG
Sbjct  133  LKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALG  192

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGD SV RD V+    ++PLL LL      S      RN  W LSNLCR KNP P   
Sbjct  193  NIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFA  248

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV  +LV+LL  ++ 
Sbjct  249  KVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDY  308

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             + +PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNITAG +
Sbjct  309  KVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNR  368

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
             QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I+PL +
Sbjct  369  AQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCD  428

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENE  482
            LLT  D+KI+ V L+ + NI +  E+ G+     +     +IEE  GLDKIE LQ+HEN+
Sbjct  429  LLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQ  488

Query  483  SVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
             +Y+ +  LIE YF V E++D ++ P+   T + + FQ Q  AP
Sbjct  489  EIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQ-QPEAP  530


> sp|G5EB89|KAPA_EMENI Importin subunit alpha OS=Emericella nidulans 
(strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / 
M139) OX=227321 GN=kapA PE=1 SV=1
Length=553

 Score =  449 bits (1155),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 343/547 (63%), Gaps = 38/547 (7%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNV--------------S  54
            P  R  ++K + +    E+RRRR E  VE+RK K+++ + KRR +              +
Sbjct  7    PEHRRTQYKARNQFRPDELRRRREEQQVEIRKQKREENLAKRRGIQTRDGGIGVGGGMAA  66

Query  55   SFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDN  114
            +  DD  S ++        +N  + ++VKG+ S  +E Q+QAT   RKLLS+E+ PPI+ 
Sbjct  67   AESDDEASAIESE------LNVELPEMVKGVFSDQIEAQIQATTKFRKLLSKERNPPIER  120

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            +I  G++ +FV FL R+  + +QFE+AWALTNIASG+++QT+ V++ GA+P F+ LL+SP
Sbjct  121  VIETGVVSRFVEFL-RSPHTLVQFEAAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSP  179

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
               + EQAVWALGNIAGD    RD V+  GA+ PLL L+      S+    LRN TWTLS
Sbjct  180  EPDVREQAVWALGNIAGDSPQCRDFVLNAGALRPLLTLINDGRKISM----LRNATWTLS  235

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            N CR K P P  + +   LP L +L++  D EVL D CWAISYL+DGPNE+I  V++ G+
Sbjct  236  NFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGPNEKIQAVIEAGI  295

Query  295  VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
              +LV+LL  +   + TPALR++GNIVTG D QTQV+I+ GAL    SLL++ K  I+KE
Sbjct  296  PRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPALLSLLSSTKDGIRKE  355

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQ  412
            A WT+SNITAG   QIQ V++ G++P LV +L+  DFKT+KEA WA++N TSGG    +Q
Sbjct  356  ACWTISNITAGNSSQIQSVIDAGIIPPLVHLLANGDFKTRKEACWAISNATSGGLQKPDQ  415

Query  413  IVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-------EKLSIMIE  465
            I YLV  G I+PL +LL   D KII V LD + NI +  E   E         + ++ IE
Sbjct  416  IRYLVTQGCIKPLCDLLACPDNKIIQVALDGLENILKVGEMDKEAGQGDAHVNRYALFIE  475

Query  466  ECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNV---VPETTSEGYTFQVQDG  522
            E GG++KI   QN+ NE +Y  + ++IEKYFS E+E   ++    P+ T  G+T      
Sbjct  476  EAGGMEKIHDCQNNANEEIYMKAYNIIEKYFSDEDEAAGDIDELAPQQTQTGFTLGATQQ  535

Query  523  APGTFNF  529
             PG F+F
Sbjct  536  QPGGFSF  542


> sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA1 PE=1 SV=2
Length=532

 Score =  448 bits (1152),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 254/547 (46%), Positives = 351/547 (64%), Gaps = 34/547 (6%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRN-----VSS  55
            MS   NA T   R +R+K    D+ E RRRR +  VE+RK+K+++ ++K+R      +  
Sbjct  1    MSLRPNAKTEVRR-NRYK-VAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQG  58

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
            FP  + + + +  +       S+ D+V G+ S +   QL++T   RKLLS E+ PPI+ +
Sbjct  59   FPSASAASVDKKLD-------SLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEV  111

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
            I AG++P+FV FL + D   IQFE+AWALTNIASGTS+ TK V+D  A+P F+ LLASP 
Sbjct  112  ISAGVVPRFVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPS  171

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGN+AGD    RDLV+  GA+ PLL  L      S+    LRN TWTLSN
Sbjct  172  DDVREQAVWALGNVAGDSPRCRDLVLGCGALLPLLNQLNEHAKLSM----LRNATWTLSN  227

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
             CR K P P  D V+  LP L RL+H DD EVL D CWA+SYL+DG N++I  V++ GVV
Sbjct  228  FCRGK-PQPHFDQVKPALPALERLIHSDDEEVLTDACWALSYLSDGTNDKIQTVIQAGVV  286

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKE  354
            P+LV+LL      ++ PALR +GNIVTG D QTQ VI++GAL    +LLT N K +I+KE
Sbjct  287  PKLVELLLHHSPSVLIPALRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKSIKKE  346

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV  414
            A WT+SNITAG +DQIQ VV   L+  LVS+L  A+F  +KEA WA++N TSGG+ +QI 
Sbjct  347  ACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIK  406

Query  415  YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSI---MIEECG  468
            YLV  G I+PL +LL   D +II V L+ + NI +  E    LG T  ++    +I++  
Sbjct  407  YLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAE  466

Query  469  GLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVP---ETTSEGYTFQVQDGAP-  524
            GL+KIE LQ+H+N  +Y+ ++ ++E Y+ +EEE+D+   P   + +  G+ F   + AP 
Sbjct  467  GLEKIENLQSHDNNEIYEKAVKILETYW-LEEEDDETQQPPGVDGSQAGFQFG-GNQAPV  524

Query  525  --GTFNF  529
              G FNF
Sbjct  525  PSGGFNF  531


> sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus OX=9913 
GN=KPNA6 PE=2 SV=1
Length=536

 Score =  448 bits (1152),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 250/524 (48%), Positives = 338/524 (65%), Gaps = 18/524 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT--SPLQENRNN  70
            R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A     L  +   
Sbjct  13   RMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYV  72

Query  71   QGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSF  127
              T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I   G++ +FV F
Sbjct  73   SSTTGESVITREMVEMLFSDDPDLQLATTQKFRKLLSKEPSPPIDEVINTPGVVDRFVEF  132

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S    + EQAVWALG
Sbjct  133  LKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALG  192

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGD SV RD V+    ++PLL LL      S      RN  W LSNLCR KNP P   
Sbjct  193  NIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFA  248

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV  +LV+LL  ++ 
Sbjct  249  KVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDN  308

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             + +PALRA+GNIVTG D QTQV+++  AL     LL++ K +I+KEA WT+SNITAG +
Sbjct  309  KVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNR  368

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
             QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I+PL +
Sbjct  369  AQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCD  428

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENE  482
            LLT  D+KI+ V L+ + NI +  E+ G+     +     +IEE  GLDKIE LQ+HEN+
Sbjct  429  LLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQ  488

Query  483  SVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
             +Y+ +  LIE YF V E++D ++ P+   T + + FQ Q  AP
Sbjct  489  EIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQ-QPEAP  530


> sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus 
OX=10116 GN=Kpna5 PE=2 SV=1
Length=536

 Score =  446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 252/528 (48%), Positives = 341/528 (65%), Gaps = 21/528 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQENRN  69
            R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNVS   +D     SP+Q+  +
Sbjct  10   RMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPRNDDCMLESPIQDP-D  68

Query  70   NQGTV-----NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII-RAGLIPK  123
               TV     +    D+++ I S+N E QL ATQ  RKLLS+E  PPID +I + G++ +
Sbjct  69   VSSTVPIPEEDMITADMIQMIFSNNAEQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQR  128

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV FL R +   +QFE+AWALTNIASGT   TK V++ GA+P FI LL S H  + EQAV
Sbjct  129  FVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIRLLTSEHEDVQEQAV  188

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
            WALGNIAGD +  RD V+    +      L     +S      RN  W LSNLCR KNP 
Sbjct  189  WALGNIAGDNAECRDFVLNCEIL----PPLLELLTNSNRLTTTRNAVWALSNLCRGKNPP  244

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
            P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I +V+ +GV  +LV+LL 
Sbjct  245  PNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQVVIDSGVCRRLVELLM  304

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL +PK +++KEA WT+SNIT
Sbjct  305  HNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLGSPKESVRKEACWTISNIT  364

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIE  423
            AG + QIQ V++  + P L+ VL KA+F+T+KEA WA+TN TSGG  EQI YLV  G I+
Sbjct  365  AGNRMQIQAVIDGSIFPVLIEVLQKAEFRTRKEAAWAITNATSGGAPEQIRYLVTLGCIK  424

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQN  478
            PL +LLT  D+KI+ V L+ + NI +  E+  +   + I     +IEE  GLDKIE LQ+
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILRLGERESKQNGVGINPYCALIEEAYGLDKIEFLQS  484

Query  479  HENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDG-APG  525
            HEN+ +Y+ +  LIE+YF V EE+D ++VP+   +   F  Q   APG
Sbjct  485  HENQEIYQKAFDLIERYFGV-EEDDPSLVPQVDEQQRQFLFQQCEAPG  531


> sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus 
OX=10090 GN=Kpna6 PE=1 SV=2
Length=536

 Score =  446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 337/524 (64%), Gaps = 18/524 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT--SPLQENRNN  70
            R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A     L  +   
Sbjct  13   RMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYV  72

Query  71   QGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSF  127
              T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I   G++ +FV F
Sbjct  73   SSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPGVVDRFVEF  132

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S    + EQAVWALG
Sbjct  133  LKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALG  192

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            NIAGD S+ RD V+    ++PLL LL      S      RN  W LSNLCR KNP P   
Sbjct  193  NIAGDSSLCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFA  248

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV  +LV+LL  ++ 
Sbjct  249  KVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDY  308

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQ  367
             + +PALRA+GNIVTG D QTQV+++  AL     LL++ K +I+KEA WT+SNITAG +
Sbjct  309  KVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNR  368

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
             QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I+PL +
Sbjct  369  AQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCD  428

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENE  482
            LLT  D+KI+ V L+ + NI +  E+  +     +     +IEE  GLDKIE LQ+HEN+
Sbjct  429  LLTVMDSKIVQVALNGLENILRLGEQESKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQ  488

Query  483  SVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
             +Y+ +  LIE YF V E++D ++ P+   T + + FQ Q  AP
Sbjct  489  EIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQ-QPEAP  530


> sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens 
OX=9606 GN=KPNA5 PE=1 SV=2
Length=536

 Score =  442 bits (1136),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 247/511 (48%), Positives = 334/511 (65%), Gaps = 20/511 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQENRN  69
            R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV    +D +   SP+Q+  +
Sbjct  10   RMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQD-PD  68

Query  70   NQGTV-----NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII-RAGLIPK  123
               TV          D+V+ I S+N + QL ATQ  RKLLS+E  PPID +I + G++ +
Sbjct  69   ISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQR  128

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV FL R +   +QFE+AWALTNIASGT   TK V++ GA+P FI LL S H  + EQAV
Sbjct  129  FVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAV  188

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
            WALGNIAGD +  RD V+    +      L     +S      RN  W LSNLCR KNP 
Sbjct  189  WALGNIAGDNAECRDFVLNCEIL----PPLLELLTNSNRLTTTRNAVWALSNLCRGKNPP  244

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
            P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I  V+ +GV  +LV+LL 
Sbjct  245  PNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLM  304

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNIT
Sbjct  305  HNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNIT  364

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIE  423
            AG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I+
Sbjct  365  AGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIK  424

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQN  478
            PL +LLT  D+KI+ V L+ + NI +  E+  +   + I     +IEE  GLDKIE LQ+
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQS  484

Query  479  HENESVYKASLSLIEKYFSVEEEEDQNVVPE  509
            HEN+ +Y+ +  LIE YF V EE+D ++VP+
Sbjct  485  HENQEIYQKAFDLIEHYFGV-EEDDPSIVPQ  514


> sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA2 PE=1 SV=1
Length=535

 Score =  441 bits (1135),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 256/548 (47%), Positives = 352/548 (64%), Gaps = 33/548 (6%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRR----NVSSF  56
            MS   NA T   R +R+K    D+ E RRRR +  VE+RK+K+++ + K+R      +  
Sbjct  1    MSLRPNAKT-EVRRNRYK-VAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQL  58

Query  57   PDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
            P  A SP+  +   +  +  S+  +V G+ S +   QL+AT   RKLLS E+ PPI+ +I
Sbjct  59   PQFAPSPVPASSTVEKKLE-SLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVI  117

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA  176
             AG++P+FV FL R D   +QFE+AWALTNIASGTSE TK V++ GA+P F+ LLAS   
Sbjct  118  DAGVVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSD  177

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             + EQAVWALGN+AGD    RDLV+  GA+ PLL+ L      S+    LRN TWTLSN 
Sbjct  178  DVREQAVWALGNVAGDSPRCRDLVLGQGALIPLLSQLNEHAKLSM----LRNATWTLSNF  233

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
            CR K P PP D V   LP L RL+H  D EVL D CWA+SYL+DG N++I  V++ GVVP
Sbjct  234  CRGK-PQPPFDQVRPALPALERLIHSTDEEVLTDACWALSYLSDGTNDKIQSVIEAGVVP  292

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEA  355
            +LV+LL      ++ PALR+IGNIVTG D QTQ VI  GAL    SLLT N K +I+KEA
Sbjct  293  RLVELLQHQSPSVLIPALRSIGNIVTGDDLQTQCVISHGALLSLLSLLTHNHKKSIKKEA  352

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG +DQIQ V   GL+  LV++L  A+F  +KEA WA++N TSGG+ +QI Y
Sbjct  353  CWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSGGSPDQIKY  412

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS----------IMIE  465
            +V  G+++PL +LL   D +II V L+ + NI     K+GE EK++           +I+
Sbjct  413  MVEQGVVKPLCDLLVCPDPRIITVCLEGLENIL----KVGEAEKVTGNTGDVNFYAQLID  468

Query  466  ECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVP-ETTSEGYTFQVQDGA-  523
            +  GL+KIE LQ+H+N  +Y+ ++ ++E Y+   EEED+ + P + +++G+ F   + A 
Sbjct  469  DAEGLEKIENLQSHDNSEIYEKAVKILETYWL--EEEDETLPPGDPSAQGFQFGGGNDAA  526

Query  524  --PGTFNF  529
              PG FNF
Sbjct  527  VPPGGFNF  534


> sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP1 PE=1 
SV=1
Length=542

 Score =  442 bits (1136),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 242/535 (45%), Positives = 330/535 (62%), Gaps = 22/535 (4%)

Query  10   PAARLHRFKNKGKDST-EMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE--  66
            P  R   FKNKG+ S  E+RRRR    VELRKAK+D+ + KRRN     D A S  ++  
Sbjct  14   PEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDES  73

Query  67   ----NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIP  122
                ++     +   +  + + +NS +++ QL AT   R++LSRE +PPID +I+AG++P
Sbjct  74   SVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVP  133

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + V F+       +Q E+AWALTNIASGTS QTK VVD  A+P FI LL +    + EQA
Sbjct  134  RLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQA  193

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            +WALGN+AGD + +RD V++  A++P+L L      +S     +R  TWTLSNLCR K P
Sbjct  194  IWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKP  248

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V Q LPTL +L++  D E L D CWAISYL+DGP E I  V+   +  +LV+LL
Sbjct  249  QPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELL  308

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
                  + TPALRA+GNIVTG D QTQVVI+AG L     LL++PK NI+KEA WT+SNI
Sbjct  309  SHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNI  368

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCG  420
            TAG  +QIQ V++  L+P LV +L  A++KT+KEA WA++N +SGG    + I YLV  G
Sbjct  369  TAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQG  428

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEA  475
             I+PL +LL   D +II V LDA+ NI +  E   E   L+I      IE+ GG++KI  
Sbjct  429  CIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFN  488

Query  476  LQNHENESVYKASLSLIEKYFSVEEEE-DQNVVPETTSEGYTFQVQDGAPGTFNF  529
             Q +EN+ +Y+ +  +IE YF  EE+  D+ + P+    G TF         FNF
Sbjct  489  CQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNA--GNTFGFGSNVNQQFNF  541


> sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis 
elegans OX=6239 GN=ima-3 PE=1 SV=2
Length=514

 Score =  439 bits (1129),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 238/521 (46%), Positives = 334/521 (64%), Gaps = 17/521 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQG  72
            R   +KN  K+     +R  EV V +RK K+++ + KRRN+++  +D +   + +    G
Sbjct  5    RQAYYKNNAKEQIGKEKRNEEV-VSIRKDKREEAISKRRNINTQIEDDS---ETSTTPPG  60

Query  73   TVNWSVDDI-VKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT  131
              + ++  + V    SS+   QL A Q ARK+LS ++ PPID++I +G++P  V  L  T
Sbjct  61   PFDANLLRLTVAAAQSSDPAEQLTAVQQARKMLSTDRNPPIDDLIGSGILPVLVQCLSST  120

Query  132  DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAG  191
            D + +QFE+AWALTNIASGTSEQT+AVV+ GA+P F+ LL+  + ++ EQ+VWALGNI G
Sbjct  121  DPN-LQFEAAWALTNIASGTSEQTQAVVNAGAVPLFLQLLSCGNLNVCEQSVWALGNIIG  179

Query  192  DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ  251
            DG  FRD  ++ G + PLL  +       +  G+LRN+TW + NLCR K+PAP    V  
Sbjct  180  DGPHFRDYCLELGILQPLLQFIN----PEIPIGFLRNVTWVIVNLCRCKDPAPSPAVVRT  235

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT  311
            ILP L  L+HH D  +L DT WA+SYLTDG NE I MV++  VV  LV LLG  ++ + T
Sbjct  236  ILPALSLLIHHQDTNILIDTVWALSYLTDGGNEHIQMVIEAQVVTHLVPLLGHVDVKVQT  295

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
             ALRA+GNIVTGTDEQTQ+V+D+G L   P LL + K  I KEA W +SNITAG Q Q+Q
Sbjct  296  AALRAVGNIVTGTDEQTQLVLDSGVLRFMPGLLAHYKEKINKEAVWFVSNITAGNQQQVQ  355

Query  372  QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA  431
             V + G++P ++ +L + DF TQKEA WA++N T  G   Q+  +V  G++ P   +L+ 
Sbjct  356  DVFDAGIMPMIIHLLDRGDFPTQKEAAWAISNVTISGRPNQVEQMVKLGVLRPFCAMLSC  415

Query  432  KDTKIILVILDAISNIFQAAEKLGE-TEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
             D++II V+LD I+NI + A   GE  E+++  IEECGGLDKIE LQNHENE +YK +  
Sbjct  416  TDSQIIQVVLDGINNILKMA---GEAAEQVTSEIEECGGLDKIENLQNHENEDIYKLAFE  472

Query  491  LIEKYFSVEEEEDQNVVPETTSE--GYTFQVQDGAPGTFNF  529
            +I+ +FS  ++E  NV    +S   G    V D   G +NF
Sbjct  473  IIDNFFS-SDDETGNVEGAQSSAFGGDVPPVPDAPNGGWNF  512


> sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os01g0253300 PE=1 SV=2
Length=526

 Score =  437 bits (1123),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 242/535 (45%), Positives = 338/535 (63%), Gaps = 31/535 (6%)

Query  10   PAARLHRFKNKGK---DSTEMRRRRIEVNVELRKAKKDDQMLKRRN---VSSFPDDATSP  63
            P+ R+   +N+ K   D+ E RRRR +  VE+RK+++++ +LK+R     +  P  A++ 
Sbjct  5    PSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVPASAA  64

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
               ++  +     S+  ++ G+ S +   QL+AT   RKLLS E+ PPI+ +I++G++P+
Sbjct  65   TGVDKKLE-----SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV FL R D   +QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S    + EQAV
Sbjct  120  FVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
            WALGN+AGD    RDLV+  GA+ PLLA L      S+    LRN TWTLSN CR K P 
Sbjct  180  WALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQ  234

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
            P  +     LP L RL+H +D EVL D CWA+SYL+DG N++I  V++ GV P+LV+LL 
Sbjct  235  PSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLL  294

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNI  362
                 ++ PALR +GNIVTG D QTQ +ID  AL    SLLT N K +I+KEA WT+SNI
Sbjct  295  HPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNI  354

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG +DQIQ V+N G++  LV++L  A+F  +KEA WA++N TSGG+ +QI YLV  G I
Sbjct  355  TAGNKDQIQAVINAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCI  414

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGLDKI  473
            +PL +LL   D +I+ V L+ + NI     K+GET+K          S MI+E  GL+KI
Sbjct  415  KPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGLEKI  470

Query  474  EALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQV-QDGAPGTF  527
            E LQ+H+N  +Y+ ++ ++E Y+  EE++          +G TF   Q G    F
Sbjct  471  ENLQSHDNNEIYEKAVKILEAYWMDEEDDTMGATTVAAPQGATFDFGQGGGAAQF  525


> sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA3 PE=1 SV=2
Length=531

 Score =  436 bits (1121),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 237/531 (45%), Positives = 342/531 (64%), Gaps = 16/531 (3%)

Query  10   PAARLHRFKNKGK---DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFP-DDATSPLQ  65
            P+A+    +N+ K   D+ E RRRR +  VE+RK K+++ + K+R  SS     AT   +
Sbjct  5    PSAKTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGSATGQTE  64

Query  66   ENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV  125
            ++ ++   +  ++  +V GI S +  +QL+AT   RKLLS E+ PPI+ ++++G++P+ V
Sbjct  65   QDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVV  124

Query  126  SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA  185
             FL R D   +QFE+AWALTNIASGTSE T  +++ GA+P FI LL+S    + EQAVWA
Sbjct  125  KFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWA  184

Query  186  LGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPP  245
            LGN+AGD    RDLV+ YGA+ PLL+        +     LRN TWTLSN CR K P P 
Sbjct  185  LGNVAGDSPKCRDLVLSYGAMTPLLSQFN----ENTKLSMLRNATWTLSNFCRGK-PPPA  239

Query  246  IDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS  305
             +  +  LP L RL+   D EVL D CWA+SYL+D  N++I  V++ GVVP+L++LLG S
Sbjct  240  FEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHS  299

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITA  364
               ++ PALR IGNIVTG D QTQ+V+D  AL    +LL  N K +I+KEA WT+SNITA
Sbjct  300  SPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITA  359

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G  DQIQ V++ G++  LV VL  A+F+ +KEA W ++N TSGGT +QI ++V  G I+P
Sbjct  360  GNADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVSQGCIKP  419

Query  425  LMNLLTAKDTKIILVILDAISNIF---QAAEKLGETEKLSI---MIEECGGLDKIEALQN  478
            L +LLT  D K++ V L+A+ NI    +A + LG T + ++   MI+E  GL+KIE LQ+
Sbjct  420  LCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQS  479

Query  479  HENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            H+N  +Y  ++ ++E +++ + EE+ N        G+ F   +  PG FNF
Sbjct  480  HDNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNF  530


> sp|B6HJ92|KAPA_PENRW Importin subunit alpha OS=Penicillium rubens 
(strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) 
OX=500485 GN=kapA PE=1 SV=1
Length=552

 Score =  436 bits (1120),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 242/530 (46%), Positives = 339/530 (64%), Gaps = 27/530 (5%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDD--------A  60
            P  R  +FK K +    E+RRRR E  VE+RKAK+D+ + KRR + +            A
Sbjct  7    PEHRRTQFKAKNQFKPDELRRRREEQQVEIRKAKRDENLAKRRGIQTQDGRIGVGGMAAA  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            T    E    +  +N  +  +VKG+ S  VE Q+QAT   RKLLS+E+ PPI+ +I  G+
Sbjct  67   TESDDEASAIESELNVELPQMVKGVFSDQVEEQIQATTKFRKLLSKERNPPIERVIETGV  126

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + +FV FL R+  + +QFESAWALTNIASG+++QT+ V++ GA+P F+ LL+SP   + E
Sbjct  127  VARFVEFL-RSPHTLVQFESAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVRE  185

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGD    RD V+  GA+ PLL L  + D   L+   LRN TWTLSN CR K
Sbjct  186  QAVWALGNIAGDSPHCRDFVLGAGALRPLLNL--INDGRKLS--MLRNATWTLSNFCRGK  241

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P P  + +   LP L +L++  D EVL D CWAISYL+DG N++I  V++ G+  +LV+
Sbjct  242  TPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGANDKIQAVIEAGIPRRLVE  301

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL  +   + TPALR++GNIVTG D QTQV+I+ G+L    SLL++ K  I+KEA WT+S
Sbjct  302  LLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGSLPALLSLLSSTKDGIRKEACWTIS  361

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVH  418
            N+TAG   QIQ V++ G++  L+++L+  DFKT+KEA WA++N TSGG    +QI YLV 
Sbjct  362  NVTAGNSSQIQAVIDAGIIAPLINLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVS  421

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQA------AEKLGETE--KLSIMIEECGGL  470
             G I+PL +LL   D KII V LD + NI +       A + GE    + ++ IEE GG+
Sbjct  422  QGCIKPLCDLLACPDNKIIQVALDGLENILKVGDMDKEAGQPGEARVNRYALFIEEAGGM  481

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEE---EDQNVVPETTSEGYTF  517
            +KI   QN+ NE +Y  + ++IEKYFS E+E   + + + P+ T  G+T 
Sbjct  482  EKIHDCQNNANEEIYMKAYNIIEKYFSDEDEAGGDIEELAPQQTQTGFTL  531


> sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium 
discoideum OX=44689 GN=DDB_G0272318 PE=3 SV=1
Length=516

 Score =  432 bits (1112),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/512 (45%), Positives = 336/512 (66%), Gaps = 17/512 (3%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQG  72
            R  ++K K  DS E RR+R E ++ +RK K+++ +LK+R   + P   ++P++ +     
Sbjct  9    RKSQYK-KSIDSDESRRKREEASLSIRKNKREESLLKKR-TQAVP--GSTPVKVD----S  60

Query  73   TVNWSVDDI---VKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG  129
             +N  ++ +   V  INS N +  L++T A RKLLS EK PPI+ +I+ G++P+ V FL 
Sbjct  61   LINQRLEQLPSLVAEINSENPDLILKSTTAFRKLLSIEKSPPIEEVIKTGIVPRLVKFLY  120

Query  130  RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI  189
              D   +QFE+AWALTNIASGT EQT+ V++ GAI  F+ LL+SPH  + EQAVWALGNI
Sbjct  121  MQDFPQLQFEAAWALTNIASGTPEQTRVVIENGAIQVFVLLLSSPHDDVREQAVWALGNI  180

Query  190  AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
            AGD    RDLV+ + A+ PLL+LL  P  +++    +RN TWTLSN CR K P PP + V
Sbjct  181  AGDSHYCRDLVLSHNALPPLLSLLQNP--AAIKVSMVRNATWTLSNFCRGK-PQPPFEIV  237

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI  309
               LP L +L+++ D EVL D CWA+SYL+DG NERI  V+   V  ++V+LLG   + +
Sbjct  238  RASLPVLAKLIYYQDEEVLIDACWALSYLSDGSNERIQEVIDAKVCRKMVELLGHPTIAV  297

Query  310  VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ  369
             TPALR IGNIVTG D QTQ+V+   AL+   +LL +PK  I+KEA WT+SNITAG ++Q
Sbjct  298  QTPALRTIGNIVTGDDNQTQIVLSVQALSHLLNLLQSPKRAIRKEACWTISNITAGDKNQ  357

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
            IQQV++  ++P LV +L+ A+F+ QKEA WA++N TS GT +QI +LV  G ++PL +LL
Sbjct  358  IQQVIDANIIPSLVYLLANAEFEIQKEAAWAISNATSCGTPQQIHFLVSQGCVKPLCDLL  417

Query  430  TAKDTKIILVILDAISNIFQAAEKLGETEKLS---IMIEECGGLDKIEALQNHENESVYK  486
               D +II V L+ I NI  A +K  +   ++    +IE+  GL KI  LQ+H N+  ++
Sbjct  418  KVSDPRIINVALEGIENILVAGKKEAQVTGVNPYKKIIEDADGLGKIYDLQHHMNKDTFE  477

Query  487  ASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQ  518
                +I  Y   E+E++ +++PE +S  ++ Q
Sbjct  478  KVSRIISTYLEDEQEDEGDLMPEGSSFSFSNQ  509


> sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus 
OX=9031 GN=KPNA1 PE=2 SV=1
Length=538

 Score =  432 bits (1110),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 245/529 (46%), Positives = 336/529 (64%), Gaps = 23/529 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEEAEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q N     +      D+++ I S++ E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQMNNMEMTSSAVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFE+AW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFEAAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL LL+  +  ++     RN  W LSNLCR KNP
Sbjct  190  VWALGNIAGDSTMCRDYVLDCNILPPLLQLLSKQNRITMT----RNAVWALSNLCRGKNP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL  +D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPDFAKVSPCLSVLSWLLFVNDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+++L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDAHIFPALINILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L  + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDSKIVQVALSGLENILRLGEQESKRSGAGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ Q  AP
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQ-QCEAP  532


> sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA4 PE=1 SV=1
Length=538

 Score =  431 bits (1107),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/538 (45%), Positives = 345/538 (64%), Gaps = 22/538 (4%)

Query  8    NTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQEN  67
            +T A    +    G D+ E RRRR +  VE+RK K++D +LK+R           PL   
Sbjct  6    STRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQL-PLGAG  64

Query  68   RNNQGT---VNWSVDDI---VKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLI  121
             +   T   V   ++ I   V+G+ S + + QL+AT   RKLLS E+ PPID +I+AG+I
Sbjct  65   LDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIKAGVI  124

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ  181
            P+FV FLGR D   +QFE+AWALTN+ASGTS+ T+ V++ GA+P F+ LL S    + EQ
Sbjct  125  PRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSASDDVREQ  184

Query  182  AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN  241
            AVWALGN+AGD    R+LV+ YGA++PLLA L      S+    LRN TWTLSN CR K 
Sbjct  185  AVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNENSKLSM----LRNATWTLSNFCRGKP  240

Query  242  PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL  301
            P  P + V+  LP L +L++ +D EVL D CWA+SYL+DGPN++I  V++ GV P+LV+L
Sbjct  241  PT-PFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGVCPRLVEL  299

Query  302  LGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMS  360
            LG     ++ PALR +GNIVTG D QTQ +I++G L    +LLT N K +I+KEA WT+S
Sbjct  300  LGHQSPTVLIPALRTVGNIVTGDDSQTQFIIESGVLPHLYNLLTQNHKKSIKKEACWTIS  359

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAG + QI+ VV  G++  LV +L  A+F  +KEA WA++N TSGG+ EQI YLV  G
Sbjct  360  NITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQG  419

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSI---MIEECGGLDKIE  474
             I+PL +LL   D +I+ V L+ + NI +  E   ++G    +++   +IEE  GLDK+E
Sbjct  420  CIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVE  479

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEED--QNVVPETTSEGYTFQVQDGAP-GTFNF  529
             LQ+H+N  +Y+ ++ ++E+Y++ EEEE   Q+   + + + + F     AP G F F
Sbjct  480  NLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNNPAAPVGGFKF  537


> sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum 
OX=4081 PE=2 SV=2
Length=527

 Score =  429 bits (1103),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 248/544 (46%), Positives = 348/544 (64%), Gaps = 33/544 (6%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRR-----NVSS  55
            MS   N+ T A R  R+K    D+ E RRRR +  VE+RK K+++ +LK+R         
Sbjct  1    MSLRPNSRTEARR-SRYK-VAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLQAQQ  58

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
            FP  A     + +        ++ +++ G+ S +   QL+ T   RKLLS E+ PPI+ +
Sbjct  59   FPSTAAVSHLDKKLE------TLPELIAGVWSDDSSLQLECTTQFRKLLSIERNPPIEEV  112

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
            I++G++P+FV FL R D   +QFE+AWALTNIASGTSE TK V+D G++P FI LL+SP 
Sbjct  113  IQSGVVPRFVEFLARDDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFIRLLSSPS  172

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGNIAGD   +RDLV+ +GA   L+ALLA  +  +     LRN TWTLSN
Sbjct  173  DDVREQAVWALGNIAGDSPKYRDLVLGHGA---LVALLAQFNEQA-KLSMLRNATWTLSN  228

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
             CR K P P  +  +  LPTL RL+H +D EVL D CWA+SYL+DG N++I  V++ GV 
Sbjct  229  FCRGK-PQPLFEQTKAALPTLGRLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVC  287

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKE  354
             +LV+LL  S   ++ PALR +GNIVTG D QTQV+ID  AL    +LLT N K +I+KE
Sbjct  288  SRLVELLLHSSPSVLIPALRTVGNIVTGDDIQTQVMIDHHALPCLVNLLTQNYKKSIKKE  347

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV  414
            A WT+SNITAG ++QIQ V+  G++  LV +L  A+F+ +KEA WA++N TSGG  +QI 
Sbjct  348  ACWTISNITAGNRNQIQIVIEAGIIAPLVYLLQNAEFEIKKEAAWAISNATSGGNHDQIK  407

Query  415  YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSI---MIEECG  468
            +LV  G I+PL +LL   D +I+ V L+ + NI +  E    LG TE +++   +I+E  
Sbjct  408  FLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAE  467

Query  469  GLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEG-YTFQVQDGA--PG  525
            GL+KIE LQ+H+N  +Y+ ++ ++E Y+   EEED   VP + +E  + F   D +   G
Sbjct  468  GLEKIENLQSHDNTEIYEKAVKILETYWL--EEED---VPVSLNEDQFEFGGADISLPSG  522

Query  526  TFNF  529
             FNF
Sbjct  523  GFNF  526


> sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=cut15 PE=1 
SV=1
Length=542

 Score =  429 bits (1102),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 232/530 (44%), Positives = 341/530 (64%), Gaps = 16/530 (3%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSF--PDDATSPLQE  66
            P  R   +K KG   + E+RRRR    +E+RK K+++ + KRRN+     P + T PL++
Sbjct  9    PEHRRQNYKGKGTFQADELRRRRETQQIEIRKQKREENLNKRRNLVDVQEPAEETIPLEQ  68

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVS  126
            ++ N   +   + D++K + S ++E Q+QAT   RK LS+E  PPI  +I AG++P+FV 
Sbjct  69   DKENDLELELQLPDLLKALYSDDIEAQIQATAKFRKALSKETNPPIQKVIDAGVVPRFVE  128

Query  127  FLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL  186
            FL   + + ++FE++WALTN+ASG+S QT  VV+  A+P F+SLL+S    + EQAVWAL
Sbjct  129  FLSHEN-NLLKFEASWALTNVASGSSNQTHVVVEANAVPVFVSLLSSSEQDVREQAVWAL  187

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            GNIAGD  + RD V++ G ++PLL ++     S+     LRN TWTLSN+CR KNP P  
Sbjct  188  GNIAGDSPMCRDHVLQCGVLEPLLNIIE----SNRRLSMLRNSTWTLSNMCRGKNPQPDW  243

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
            +++ Q++P L +L++  D +VL D  WAISYL+DG NE+I  ++  G+  +LV+LL    
Sbjct  244  NSISQVIPVLSKLIYTLDEDVLVDALWAISYLSDGANEKIQAIIDAGIPRRLVELLMHPS  303

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
              + TPALR++GNIVTG D QTQV+I+ GAL+   SLL++P+  ++KEA WT+SNITAG 
Sbjct  304  AQVQTPALRSVGNIVTGDDVQTQVIINCGALSALLSLLSSPRDGVRKEACWTISNITAGN  363

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEP  424
              QIQ V+   ++P L+ +L+ ADFK QKEA WA++N TSGG    +QI YLV  G I+P
Sbjct  364  SSQIQYVIEANIIPPLIHLLTTADFKIQKEACWAISNATSGGARRPDQIRYLVEQGAIKP  423

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAE--KLGETEKL---SIMIEECGGLDKIEALQNH  479
            L NLL  +D KII V LD I NI +  E  +    +K+   ++ +E+ GG+D I   QN 
Sbjct  424  LCNLLACQDNKIIQVALDGIENILRVGELDRANNPDKINLYAVYVEDAGGMDLIHECQNS  483

Query  480  ENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
             N  +Y+ + ++IEK+F  E+E ++    ET  + +TF       G F F
Sbjct  484  SNSEIYQKAYNIIEKFFGEEDEIEELEP-ETVGDTFTFGTTQEPAGDFQF  532


> sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os05g0155601 PE=1 SV=2
Length=534

 Score =  426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 236/529 (45%), Positives = 333/529 (63%), Gaps = 19/529 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRN----VSSFPDDATSPLQENR  68
            R  R+K    D+ E RRRR +  VE+RK+++++ +LK+R      ++    A SPL  + 
Sbjct  12   RRSRYK-VAVDADEGRRRREDNMVEIRKSRREESLLKKRRDGLPAAAAAAAAASPLLAHS  70

Query  69   NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL  128
            +        +  +V+ + S +   QL+AT   RKLLS E+ PPI+ +I  G++P+F++FL
Sbjct  71   SALQQKLEGLPAMVQAVQSDDSAVQLEATTQFRKLLSIERSPPIEEVINTGVVPRFIAFL  130

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN  188
             R D   +QFE+AWALTNIASGTS+ TK VV+ GA+P F+ LL+SP   + EQAVWALGN
Sbjct  131  QREDYPQLQFEAAWALTNIASGTSDNTKVVVESGAVPIFVKLLSSPSEDVREQAVWALGN  190

Query  189  IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
            +AGD    RDLV+  G + PLL  L      S+    LRN TWTLSN CR K P P  + 
Sbjct  191  VAGDSPKCRDLVLASGGLYPLLQQLNEHAKLSM----LRNATWTLSNFCRGK-PQPNFEQ  245

Query  249  VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP  308
            V+  L  L RL+H  D EVL D CWA+SYL+DG N++I  V+++GV P+LV+LL      
Sbjct  246  VKPALSALQRLIHSQDEEVLTDACWALSYLSDGTNDKIQAVIESGVFPRLVELLMHPSAS  305

Query  309  IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQ  367
            ++ PALR +GNIVTG D QTQ VID  AL    +LLT N K +I+KEA WT+SNITAG +
Sbjct  306  VLIPALRTVGNIVTGDDMQTQCVIDHQALPCLLNLLTNNHKKSIKKEACWTISNITAGNR  365

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
            +QIQ V+N  ++  LV +L  A+F  +KEA WA++N TSGGT +QI YLV  G I+PL +
Sbjct  366  EQIQAVINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCD  425

Query  428  LLTAKDTKIILVILDAISNIFQAAEK-----LGETEKLSIMIEECGGLDKIEALQNHENE  482
            LL   D +I+ V L+ + NI +  E       G+    + MI++  GL+KIE LQ+H+N 
Sbjct  426  LLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNSYAQMIDDAEGLEKIENLQSHDNT  485

Query  483  SVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTF--QVQDGAPGTFNF  529
             +Y+ ++ ++E Y+ +EEE+D     +    G+ F  Q  +   G FNF
Sbjct  486  EIYEKAVKMLESYW-LEEEDDAMPSGDNAQNGFNFGNQQPNVPSGGFNF  533


> sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus OX=9913 
GN=KPNA1 PE=2 SV=1
Length=538

 Score =  426 bits (1096),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 331/523 (63%), Gaps = 22/523 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q N            D+++ I S++ E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQINNMEMAPGGVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL L +  +  ++     RN  W LSNLCR K+P
Sbjct  190  VWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDVQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQ  518
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQ  527


> sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii 
OX=9601 GN=KPNA1 PE=2 SV=1
Length=538

 Score =  425 bits (1092),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 245/529 (46%), Positives = 332/529 (63%), Gaps = 23/529 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q N            D+++ I S + E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL L +  +  ++     RN  W LSNLCR K+P
Sbjct  190  VWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAP  524
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+     + Y FQ Q  AP
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLNQQQYIFQ-QCEAP  532


> sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus 
OX=10116 GN=Kpna1 PE=1 SV=1
Length=538

 Score =  424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 329/523 (63%), Gaps = 22/523 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q N            D+ + I S++ E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQINNMEMAPGGVITSDMTEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL L +  +  ++     RN  W LSNLCR K+P
Sbjct  190  VWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQ  518
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQ  527


> sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus 
OX=10090 GN=Kpna1 PE=1 SV=2
Length=538

 Score =  424 bits (1089),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 328/523 (63%), Gaps = 22/523 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q N            D+   I S++ E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQINNMEMAPGGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRNVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL L +  +  ++     RN  W LSNLCR K+P
Sbjct  190  VWALGNIAGDSTMCRDYVLNCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQ  518
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQ  527


> sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens 
OX=9606 GN=KPNA1 PE=1 SV=3
Length=538

 Score =  423 bits (1088),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 241/523 (46%), Positives = 329/523 (63%), Gaps = 22/523 (4%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDATSP  63
            RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D     
Sbjct  10   RLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHE  69

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
             Q +            D+++ I S + E QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  70   AQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVA  129

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + EQA
Sbjct  130  RFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQA  189

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD ++ RD V+    + PLL L +  +  ++     RN  W LSNLCR K+P
Sbjct  190  VWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSP  245

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV+LL
Sbjct  246  PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL  305

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  306  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI  365

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  G I
Sbjct  366  TAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI  425

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L+ + NI +  E+  +     I     +IEE  GLDKIE LQ
Sbjct  426  KPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQ  485

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQ  518
            +HEN+ +Y+ +  LIE YF   E+ED ++ P+     + Y FQ
Sbjct  486  SHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLNQQQYIFQ  527


> sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA6 PE=1 SV=1
Length=538

 Score =  421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 340/542 (63%), Gaps = 31/542 (6%)

Query  10   PAARLHRFKNKGK---DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE  66
            P+A+    +N+ K   D+ E RRRR +  VE+RK K+++ + K+R     P  A+ P Q+
Sbjct  5    PSAKTEVRRNRYKVSVDADEGRRRREDNMVEIRKNKREENLQKKRREGFNPSMASQPGQD  64

Query  67   NRNNQGTVNW--SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
              ++  T     ++  ++ G+ S + + QL+AT + R+LLS E+ PPI+ ++++G++P  
Sbjct  65   FSSSLPTETRLENIQQMIAGVMSEDRDLQLEATASFRRLLSIERNPPINEVVQSGVVPHI  124

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V FL R D + +QFE+AWALTNIASGTSE T+ ++D GA+P F+ LL+S    + EQAVW
Sbjct  125  VQFLSRDDFTQLQFEAAWALTNIASGTSENTRVIIDSGAVPLFVKLLSSASEEVREQAVW  184

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGN+AGD    RD V+   A+  LLA     + S L+   LRN TWTLSN CR K P P
Sbjct  185  ALGNVAGDSPKCRDHVLSCEAMMSLLAQFH--EHSKLS--MLRNATWTLSNFCRGK-PQP  239

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
              +  +  LP L RLLH  D EVL D  WA+SYL+DG NE+I  V+  GV+P+LV+LL  
Sbjct  240  AFEQTKAALPALERLLHSTDEEVLTDASWALSYLSDGTNEKIQTVIDAGVIPRLVQLLAH  299

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNIT  363
                ++ PALR IGNIVTG D QTQ VI + AL    +LL N  K +I+KEA WT+SNIT
Sbjct  300  PSPSVLIPALRTIGNIVTGDDIQTQAVISSQALPGLLNLLKNTYKKSIKKEACWTISNIT  359

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIE  423
            AG   QIQ+V   G++  L+++L   +F+ +KEAVWA++N TSGG  +QI +LV  G I 
Sbjct  360  AGNTSQIQEVFQAGIIRPLINLLEIGEFEIKKEAVWAISNATSGGNHDQIKFLVSQGCIR  419

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK----------LSIMIEECGGLDKI  473
            PL +LL   D +++ V L+ + NI     K+GE EK           + MIE+  GLDKI
Sbjct  420  PLCDLLPCPDPRVVTVTLEGLENIL----KVGEAEKNLGNTGNDNLYAQMIEDADGLDKI  475

Query  474  EALQNHENESVYKASLSLIEKYFSV-EEEEDQNVV--PETT-SEGYTFQVQDG-AP-GTF  527
            E LQ+H+N  +Y+ ++ ++E Y++  +EEED   V  PE   S G+ F  Q G AP G F
Sbjct  476  ENLQSHDNNEIYEKAVKILESYWAADDEEEDIGGVDAPENVQSSGFQFGNQSGNAPTGGF  535

Query  528  NF  529
            NF
Sbjct  536  NF  537


> sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA5 PE=2 SV=1
Length=519

 Score =  400 bits (1029),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 220/505 (44%), Positives = 314/505 (62%), Gaps = 15/505 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   +  T   R+ R+K    D+ E RRRR +  VE+RK+K+++ ++K+R V   P D 
Sbjct  1    MSLRPSTKTEIRRI-RYK-VSVDAEEGRRRREDFLVEIRKSKRNENLMKKRRVKVLPPDY  58

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
               L  N   +  +   + +++ G+ S +   QL+ T   R +LS ++ PP DN+I++G+
Sbjct  59   K--LISNDPFESLL--EIANMITGVFSDDPSLQLEYTTRFRVVLSFDRSPPTDNVIKSGV  114

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P+FV FL + D   +QFE+AWALTNIASG SE TK V+D G +P F+ LLASP   + E
Sbjct  115  VPRFVEFLKKDDNPKLQFEAAWALTNIASGASEHTKVVIDHGVVPLFVQLLASPDDDVRE  174

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QA+W LGN+AGD    RD V+  GA  PLL  L     +      LRN TWTLSN  R K
Sbjct  175  QAIWGLGNVAGDSIQCRDFVLNSGAFIPLLHQLN----NHATLSILRNATWTLSNFFRGK  230

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P+PP D V+ +LP L RL++ DD +VL D CWA+S L+D  NE I  V++ GVVP+LV+
Sbjct  231  -PSPPFDLVKHVLPVLKRLVYSDDEQVLIDACWALSNLSDASNENIQSVIEAGVVPRLVE  289

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTM  359
            LL  +   ++ PALR IGNIV+G  +QT  VI+ G L V   LLT N    I++EA WT+
Sbjct  290  LLQHASPVVLVPALRCIGNIVSGNSQQTHCVINCGVLPVLADLLTQNHMRGIRREACWTI  349

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG ++QIQ V++  L+P LV++   A+F  +KEA+WA++N + GG+  QI YLV  
Sbjct  350  SNITAGLEEQIQSVIDANLIPSLVNLAQHAEFDIKKEAIWAISNASVGGSPNQIKYLVEQ  409

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSIMIEECGGLDKIEAL  476
              I+ L ++L   D +IILV L  +  I  A E    L +    S MIE+  GL+KIE L
Sbjct  410  NCIKALCDILVCPDLRIILVSLGGLEMILIAGEVDKNLRDVNCYSQMIEDAEGLEKIENL  469

Query  477  QNHENESVYKASLSLIEKYFSVEEE  501
            Q+H N  +Y+ ++ +++ Y  VEE+
Sbjct  470  QHHGNNEIYEKAVKILQTYGLVEED  494


> sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA7 PE=2 SV=1
Length=528

 Score =  355 bits (910),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 204/489 (42%), Positives = 289/489 (59%), Gaps = 33/489 (7%)

Query  23   DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIV  82
            D    RRRR +  VE+RKAK+++ +LK+R   + P    SP  ++ + +         ++
Sbjct  19   DGVGGRRRREDDMVEIRKAKREESLLKKRR-EALPH---SPSADSLDQK---------LI  65

Query  83   KGINSSNVENQLQATQAARKLLSREK-QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESA  141
              I S   +  ++AT   R LL  E     ++ +I+AGL+P+FV FL   D   +QFE+A
Sbjct  66   SCIWSDERDLLIEATTQIRTLLCGEMFNVRVEEVIQAGLVPRFVEFLTWDDSPQLQFEAA  125

Query  142  WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVI  201
            WALTNIASGTSE T+ V+D GA+   + LL SP+  + EQ VWALGNI+GD    RD+V+
Sbjct  126  WALTNIASGTSENTEVVIDHGAVAILVRLLNSPYDVVREQVVWALGNISGDSPRCRDIVL  185

Query  202  KYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH  261
             + A+  LL  L      S+    L N  WTLSNLCR K P PP D V   LP L +L+ 
Sbjct  186  GHAALPSLLLQLNHGAKLSM----LVNAAWTLSNLCRGK-PQPPFDQVSAALPALAQLIR  240

Query  262  HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
             DD E+LA TCWA+ YL+DG NE+I  V++  V  +L+ L       ++TPALR IGNIV
Sbjct  241  LDDKELLAYTCWALVYLSDGSNEKIQAVIEANVCARLIGLSIHRSPSVITPALRTIGNIV  300

Query  322  TGTDEQTQVVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP  380
            TG D QTQ +ID  AL    +LL       I+KEA WT+SNITAG Q QIQ V +  + P
Sbjct  301  TGNDSQTQHIIDLQALPCLVNLLRGSYNKTIRKEACWTVSNITAGCQSQIQAVFDADICP  360

Query  381  FLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVI  440
             LV++L  ++   +KEA WA+ N  +GG+ +QI++LV    I+PL +LLT  DT++++V 
Sbjct  361  ALVNLLQNSEGDVKKEAAWAICNAIAGGSYKQIMFLVKQECIKPLCDLLTCSDTQLVMVC  420

Query  441  LDAISNIFQAAEKLGETEKLSI-------------MIEECGGLDKIEALQNHENESVYKA  487
            L+A+  I +  E         I             +IEE  GL+KIE LQ+HEN  +Y+ 
Sbjct  421  LEALKKILKVGEVFSSRHAEGIYQCPQTNVNPHAQLIEEAEGLEKIEGLQSHENNDIYET  480

Query  488  SLSLIEKYF  496
            ++ ++E Y+
Sbjct  481  AVKILETYW  489


> sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis 
elegans OX=6239 GN=ima-2 PE=1 SV=1
Length=531

 Score =  346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 198/520 (38%), Positives = 299/520 (58%), Gaps = 22/520 (4%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPD--DATS  62
            E       RL ++KN  K   E+RRRR E +VE+RK K  D M+KRRN+    +  ++ S
Sbjct  13   EEGKDEGGRLQQYKNLTKHE-ELRRRRTECSVEIRKQKGADMMMKRRNIVDVDEGGNSES  71

Query  63   PLQENR---NNQGTVNWSVDDIVKGINSSN--VENQLQATQAARKLLSREKQPPIDNIIR  117
             L+E     + Q +   S D+I + I S+N   ++ ++  ++ RK LS+ K PPID +I 
Sbjct  72   ELEEPEKISHQQSSTRLSNDEI-RAILSNNPSEDDMVRCFESLRKSLSKTKNPPIDEVIH  130

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
             GL+   V  L   +   +Q+E+AWALTNI SG++EQT A V+ G     I L     A 
Sbjct  131  CGLLQALVQALS-VENERVQYEAAWALTNIVSGSTEQTIAAVEAGVTIPLIHLSVHQSAQ  189

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
            ISEQA+WA+ NIAGD S  RD VIK   V+ L+ L+   D   L   ++R + W  SN+C
Sbjct  190  ISEQALWAVANIAGDSSQLRDYVIKCHGVEALMHLMEKVD--QLGDSHVRTIAWAFSNMC  247

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
            R+KNP  P++ +  +   LV+L+ H D +V  D CWA+SYLTDGP+E+I +  ++GV+P 
Sbjct  248  RHKNPHAPLEVLRVLSKGLVKLVQHTDRQVRQDACWAVSYLTDGPDEQIELARESGVLPH  307

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEAT  356
            +V     +E  +V PALR +GN+ TG D  TQ VID G+L  + P +     ++I KE  
Sbjct  308  VVAFFKEAE-NLVAPALRTLGNVATGNDSLTQAVIDLGSLDEILPLMEKTRSSSIVKECC  366

Query  357  WTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL  416
            W +SNI AG Q QIQ V++  L+P L++VL   D K Q EA WA++N   GGT  Q+V +
Sbjct  367  WLVSNIIAGTQKQIQAVLDANLLPVLINVLKSGDHKCQFEASWALSNLAQGGTNRQVVAM  426

Query  417  VHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM---IEECGGLDKI  473
            +   ++  L   L   +T ++   L+ +  +    +  G   K+ I+   +EE GGLD +
Sbjct  427  LEDNVVPALCQALLQTNTDMLNNTLETLYTLMLTVQN-GYPHKVDILHDQVEENGGLDSL  485

Query  474  EALQNHENESVYKASLSLIEKYFS----VEEEEDQNVVPE  509
            E LQ  ++E +Y  +  +I ++F+     E+E  +N  P+
Sbjct  486  ERLQESQSEQIYTQAYRIITQFFTDDDAGEKESHENADPQ  525


> sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dictyostelium 
discoideum OX=44689 GN=DDB_G0273149 PE=3 SV=1
Length=550

 Score =  330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 204/535 (38%), Positives = 302/535 (56%), Gaps = 33/535 (6%)

Query  12   ARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATS-----PLQE  66
            +R   FK K  DS   RR+R E ++ +RK  +++ MLKRR +   P+ +TS     P + 
Sbjct  9    SRKKEFK-KSLDSETARRKREENSIGIRKNAREELMLKRRGIVQ-PNPSTSYQIIVPPEV  66

Query  67   NRNNQGTVNWSVDDIVK-------GINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG  119
                Q   N ++++ +K        +NS++      +    RKLLS    PPID +I  G
Sbjct  67   QEQFQKYENETMENKIKNLPGLVTALNSNDQAYVYSSLVQFRKLLSIHAYPPIDQVIECG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL-ASPHAHI  178
            +IPK    L + +   +QFESAWALTNIASG + QT+ V++ G++P FI LL A     +
Sbjct  127  IIPKLNQLL-QCNNPKVQFESAWALTNIASGNNRQTQTVMESGSVPIFIQLLCAETTDEV  185

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD---------MSSLACGYLRNL  229
             EQ  WALGNIAGD    R+ ++KYGA++ L+ LL   +          S    G ++N+
Sbjct  186  KEQCAWALGNIAGDTVDSRNYLLKYGAMNALIPLLHYGEDNGATTTSANSERKIGLIQNV  245

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDD--PEVLADTCWAISYLTDGPNERIG  287
             WT+SNLCR K P P    V Q LP +  L+  ++   E+  D CWA+SYL DGPN +I 
Sbjct  246  VWTISNLCRGK-PQPDFSVVSQCLPAINELIRIENLPSEIYGDLCWALSYLCDGPNTKIQ  304

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP  347
             V+ +GVVP+LVKLL   +  + TPALRA+GNIVTG   QTQ+VID   + +   LL   
Sbjct  305  AVIDSGVVPRLVKLLEYPDSIVFTPALRAVGNIVTGESSQTQIVIDNNGVELITRLLAVQ  364

Query  348  KTNIQKEATWTMSNITAGRQDQIQQVV-NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
            K +I+KE+ W +SNITAG   QI  VV N   V  L+S+LS ++   ++EA WA++N T+
Sbjct  365  KKSIRKESCWALSNITAGEPSQIDVVVSNPKTVTTLISLLSHSEHDIKREACWALSNSTN  424

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI---M  463
              + + I  LV   I++  ++LL ++D  I+ ++L+ + NI +  EK      ++    +
Sbjct  425  NSSTKSIQTLVRHNILKHFIDLLNSQDLVILKIVLEGLINIIKEGEKTKTKTGVNPYVNL  484

Query  464  IEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEG-YTF  517
            I E  G   I  LQ H+++ VYK +  LIE + S +  + +N  P     G Y F
Sbjct  485  ISEMQGESIIYDLQEHQSKDVYKKAFELIEFFESSDYSDSENSEPNINQNGQYEF  539


> sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA8 PE=3 SV=1
Length=441

 Score =  267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/429 (38%), Positives = 243/429 (57%), Gaps = 20/429 (5%)

Query  74   VNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDC  133
            VN   DDI+ G+ S +   QL++    R++ S   Q  I  +IR+G++P+ V  L     
Sbjct  7    VNEVSDDIIDGLWSDDPPLQLESVTKIRRITS---QRDISCVIRSGVVPRLVQLLKNQVF  63

Query  134  SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG  193
              +Q+E AWALTNIA               +   I L+ASP  ++ EQA+W L N+AG  
Sbjct  64   PKLQYEVAWALTNIAVDNPGVVVNNNAVPVL---IQLIASPKDYVREQAIWTLSNVAGHS  120

Query  194  SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
              +RD V+  G + PLL LL   D +      LR  TW L NLCR K P P  D V+  L
Sbjct  121  IHYRDFVLNSGVLMPLLRLL-YKDTT------LRIATWALRNLCRGK-PHPAFDQVKPAL  172

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
            P L  LLH  D +VL + C A+ +L++G  + I  V++ G VP+LV++L      ++ PA
Sbjct  173  PALEILLHSHDEDVLKNACMALCHLSEGSEDGIQSVIEAGFVPKLVQILQLPSPVVLVPA  232

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQ  372
            L  IG +  G  +QTQ VI++GAL +  ++LT N +  I+K A W +SNITAG ++QIQ 
Sbjct  233  LLTIGAMTAGNHQQTQCVINSGALPIISNMLTRNHENKIKKCACWVISNITAGTKEQIQS  292

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V++  L+P LV++    DF  +KEAVWA++N    G+ +QI Y+     I+ L ++L   
Sbjct  293  VIDANLIPILVNLAQDTDFYMKKEAVWAISNMALNGSHDQIKYMAEQSCIKQLCDILVYS  352

Query  433  DTK-IILVILDAISNIFQAAEKLGETEKLS---IMIEECGGLDKIEALQNHENESVY-KA  487
            D +  IL  LD + N+ +A E    +E ++   ++IE+  GL+KI  LQ ++N+ +Y KA
Sbjct  353  DERTTILKCLDGLENMLKAGEAEKNSEDVNPYCLLIEDAEGLEKISKLQMNKNDDIYEKA  412

Query  488  SLSLIEKYF  496
               L+  +F
Sbjct  413  YKILVTNWF  421


> sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA9 PE=3 SV=1
Length=519

 Score =  172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 125/426 (29%), Positives = 209/426 (49%), Gaps = 30/426 (7%)

Query  90   VENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIAS  149
            ++ ++ A +  R+LLS+ + PP++  +RAG IP  V  L          ESAW LTNIA+
Sbjct  97   MQKRVTALRELRRLLSKSEFPPVEAALRAGAIPLLVQCLSFGSPDEQLLESAWCLTNIAA  156

Query  150  GTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPL  209
            G  E+TKA++          L     A ++EQ  WA+GN+AG+G   R++++  GA+ P 
Sbjct  157  GKPEETKALLP-ALPLLIAHLGEKSSAPVAEQCAWAIGNVAGEGEDLRNVLLSQGALPP-  214

Query  210  LALLAVPDMSSLACGYLRNLTWTLSNLCRN--KNPAPPIDAVEQILPTLVRLLHHDDPEV  267
            LA +  PD  S     +R   W LSNL +      A  +  ++ IL  ++R L   D E 
Sbjct  215  LARMIFPDKGS----TVRTAAWALSNLIKGPESKAAAQLVKIDGILDAILRHLKKTDEET  270

Query  268  LADTCWAISYLTDGPNERIGMVVKTGVVPQLV-KLLGASELPIVTPALRAIGNIVTGTDE  326
              +  W I YL+   +    M++K G++  L+ +L  +S L ++ P LR++GN V   D 
Sbjct  271  ATEIAWIIVYLSALSDIATSMLLKGGILQLLIDRLATSSSLQLLIPVLRSLGNFVA-VDP  329

Query  327  QTQVVI-------DAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            +  + I       +   + V    L +    ++KEA W +SNI AG  +  + + +  ++
Sbjct  330  KAVLTILIREQNTEESIIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVM  389

Query  380  PFLVSVLSKADFKTQKEAVWAVTNYTSGGT---------VEQIVYLVHCGIIEPLMNLLT  430
            P L+ +LS + F  +KE  + + N                E +V +V  G +   + L+ 
Sbjct  390  PLLLRILSTSPFDIRKEVAYVLGNLCVESAEGDRKPRIIQEHLVSIVSGGCLRGFIELVR  449

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            + D +   + L  I  + +     GE  KL   +E   G+D +E  Q HENE +   + S
Sbjct  450  SPDIEAARLGLQFIELVLRGMPN-GEGPKL---VEGEDGIDAMERFQFHENEELRVMANS  505

Query  491  LIEKYF  496
            L++KYF
Sbjct  506  LVDKYF  511


> sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os01g0158000 PE=2 SV=1
Length=528

 Score =  162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/434 (26%), Positives = 207/434 (48%), Gaps = 36/434 (8%)

Query  83   KGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAW  142
            KG+    +E    A +  R+LLS+ + P +D  I+AG +P  V +L          E+AW
Sbjct  103  KGVQKKKIE----ALRDLRRLLSQPEVPLVDTAIKAGAVPLLVQYLSFGSSDEQLLEAAW  158

Query  143  ALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK  202
             LTNIA+G  E+TK+++          L       ++EQ  WA+GN+AG+G+  R  ++ 
Sbjct  159  CLTNIAAGEPEETKSLLP-ALPLLIAHLGEKSSTLVAEQCAWAIGNVAGEGAELRSTLLA  217

Query  203  YGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP--APPIDAVEQILPTLVRLL  260
             GA+ PL  L     M S      R   W +SNL +  +P  A  +  ++ +L  ++  L
Sbjct  218  QGALRPLTRL-----MFSSKGSTARTAAWAMSNLIKGPDPKAANELITIDGVLNAIIASL  272

Query  261  HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV--KLLGASELPIVTPALRAIG  318
              +D E+  +  W + YL+   +  I ++V++  VPQL+  +L  +  L ++ P LR +G
Sbjct  273  EKEDEELATEVAWVVVYLSALSDRGISLIVRSS-VPQLLIGRLFSSENLQLLIPVLRGLG  331

Query  319  NIVTGTDEQTQVVIDAG------ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            N++   D     V+  G      AL+     L +    ++KE++W +SNI AG  +  + 
Sbjct  332  NLIAADDYMVDSVLTVGHNIIDQALSGLIKCLKSDNRVLRKESSWALSNIAAGSFEHKKL  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT---------VEQIVYLVHCGIIE  423
            +      P L+ +++   F  ++EA + + N     T         VE +V +V  G + 
Sbjct  392  IFASEATPVLIRLVTSMQFDIRREAAYTLGNLCVVPTGNCELPKIIVEHLVAIVDGGALP  451

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAA-EKLGETEKLSIMIEECGGLDKIEALQNHENE  482
              ++L+ + D     + L  +  + +    K G       ++E   G++ +E  Q HENE
Sbjct  452  GFIHLVRSADVDTAGLGLQFLELVMRGYPNKQGPK-----LVEMEDGIEAMERFQFHENE  506

Query  483  SVYKASLSLIEKYF  496
             +   +  L+++YF
Sbjct  507  QMRNMANGLVDEYF  520


> sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis 
elegans OX=6239 GN=ima-1 PE=1 SV=1
Length=524

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 112/525 (21%), Positives = 225/525 (43%), Gaps = 92/525 (18%)

Query  13   RLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS---------------SFP  57
            R   +K+  +D  EMRR+R E  V++RK ++D++  + R ++               S  
Sbjct  12   RSKMYKSNVRDQNEMRRKRREDEVQIRKNRRDEKFERNRQITVQRSLSHEETSELLKSVA  71

Query  58   D-----------DATSPLQENRNNQGTVNWSVDDIVKG---INSSNVENQLQATQAARKL  103
            D           +A + L EN NN  TV W++  +VK       S+V      +Q  R L
Sbjct  72   DGLQSMQETTIHEALTVLHENLNN--TV-WTIHVLVKVQILHKLSDVYCNRVISQTTRLL  128

Query  104  LSRE--KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDG  161
            +SR   K   ID +       K+  +     C  IQ      + NI++  S +       
Sbjct  129  ISRTLLKISGIDEV-------KYERYSSDDRC--IQ----SLVFNISTYGSSEDILCDTF  175

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             +I  FI                 + +I      +R+L +    V  L+      D S++
Sbjct  176  QSIACFI-----------------IRSIT-----YRNLALDCAIVSELI------DASTI  207

Query  222  ACGYL--RNLTWTLSNLCRNKNPAPP-IDAVEQILPTLVRLLHHDDPEVLADTCWAISYL  278
                +  R+L W +   C   +   P +D +  +L  +   +   D  V  D   + + L
Sbjct  208  NMSIILHRSLMWLVFLFCEKLDRCSPHVDEIAPLLEIISNGIQSTDAMVQTDAASSCASL  267

Query  279  TDGP---NERIGMVVKTGVVPQLVKLLGASELPIVTPALRA-IGNIVTGTDEQTQVVIDA  334
             + P   +    + + + +V  L    G +      P ++A I +I+  T   T+ +IDA
Sbjct  268  AEWPPIYHYMSDLKLCSKLVANLRNDKGNAR-----PKVKAGINSIIQATGYFTEEMIDA  322

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ  394
            G L V    +    + + +E  + +SNI    +  I ++++ G++  +  V+  ++++++
Sbjct  323  GLLEVLKGFVN--VSYMSQEVCFIISNICVEGEQTIDKLISSGVLREVARVMEASEYRSR  380

Query  395  KEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL  454
            +EA + + +  +    + + Y+V  G++    +LLT  D  ++  ILDAI  + Q  E  
Sbjct  381  REAAFVICHCCASANQKHLEYVVELGMLSAFTDLLTCMDVSLVSYILDAIYLLLQFGEMR  440

Query  455  ---GETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYF  496
                 +  ++I +EE G  +K+E L   ++  ++  + ++I++++
Sbjct  441  LLPDNSNPVAIKLEEIGCREKLEFLCESQSVDIHARAYTIIDRFY  485


> sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans 
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) 
OX=214684 GN=VAC8 PE=3 SV=1
Length=630

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 139/301 (46%), Gaps = 29/301 (10%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGAIPAFISLLAS  173
            ++ AG IP  VS L   D + +Q+    AL+NIA   + + K A  +   + + + L+ S
Sbjct  205  LVAAGAIPVLVSLLNSPD-TDVQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDS  263

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA---VP-DMSSLACGYLRNL  229
                +  QA  AL N+A D S ++  ++K+G + PLL LL    +P  +S+ AC  +RN+
Sbjct  264  QSLKVQCQAALALRNLASD-SKYQLEIVKFGGLKPLLRLLHSSYLPLILSAAAC--VRNV  320

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD---GPNERI  286
            +          N +P I++    L  L+ LL  D+ E +   C AIS L +      +  
Sbjct  321  SI------HPANESPIIES--GFLQPLIELLSFDENEEV--QCHAISTLRNLAASSEKNK  370

Query  287  GMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
            G +V+ G V ++  L+    L + +     +  +    D + Q+ ++ G   V   L  +
Sbjct  371  GAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKPQL-LEMGICEVLIPLTNS  429

Query  347  PKTNIQKEATWTMSNITAGRQDQ------IQQVVNHGLVPFLVSVLSKADFKTQKEAVWA  400
            P   +Q  +   + N+++   +       +    + GL  +LV  LS AD   Q  AVW 
Sbjct  430  PSVEVQGNSAAALGNLSSKAAEDYAPFNAVWNKPDGGLHAYLVRFLSSADITFQHIAVWT  489

Query  401  V  401
            +
Sbjct  490  I  490


 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 114/244 (47%), Gaps = 13/244 (5%)

Query  206  VDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
            +DP+L LL+  D         R  +  L NL  N      + ++  + P L+R +   + 
Sbjct  88   LDPVLYLLSSHDPE-----VQRAASAALGNLAVNAENKLLVVSLGGLEP-LIRQMLSPNV  141

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            EV  +    I+ L    +E    + K+G +  L +L  + ++ +   A  A+ N+ T +D
Sbjct  142  EVQCNAVGCITNLATH-DENKTQIAKSGALVPLTRLAKSKDMRVQRNATGALLNM-THSD  199

Query  326  EQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPFLV  383
            E  Q ++ AGA+ V  SLL +P T++Q   T  +SNI   A  + ++ Q     LV  LV
Sbjct  200  ENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDAANRKKLAQ-SEPKLVQSLV  258

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDA  443
             ++     K Q +A  A+ N  S    +  + +V  G ++PL+ LL +    +IL     
Sbjct  259  QLMDSQSLKVQCQAALALRNLASDSKYQ--LEIVKFGGLKPLLRLLHSSYLPLILSAAAC  316

Query  444  ISNI  447
            + N+
Sbjct  317  VRNV  320


 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 125/296 (42%), Gaps = 14/296 (5%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            +Q  +   +TN+A+    +T+    G  +P    L  S    +   A  AL N+      
Sbjct  143  VQCNAVGCITNLATHDENKTQIAKSGALVP-LTRLAKSKDMRVQRNATGALLNMTHSDE-  200

Query  196  FRDLVIKYGAVDPLLALLAVPDMS-SLACGYLRNLTWTLSNLCRNKNPAPPIDAVE-QIL  253
             R  ++  GA+  L++LL  PD      C      T  LSN+  +      +   E +++
Sbjct  201  NRQQLVAAGAIPVLVSLLNSPDTDVQYYC------TTALSNIAVDAANRKKLAQSEPKLV  254

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
             +LV+L+     +V      A+  L      ++  +VK G +  L++LL +S LP++  A
Sbjct  255  QSLVQLMDSQSLKVQCQAALALRNLASDSKYQL-EIVKFGGLKPLLRLLHSSYLPLILSA  313

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQ  372
               + N+      ++  +I++G L     LL+ +    +Q  A  T+ N+ A  +     
Sbjct  314  AACVRNVSIHPANESP-IIESGFLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNKGA  372

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE-QIVYLVHCGIIEPLMN  427
            +V  G V  + S++       Q E    V        ++ Q++ +  C ++ PL N
Sbjct  373  IVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKPQLLEMGICEVLIPLTN  428


 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 88/376 (23%), Positives = 155/376 (41%), Gaps = 33/376 (9%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGIN----SSNVENQLQATQAARKLLSREKQPPIDN  114
            +A + L +   N+ T N+     +  +     S NV+ Q  A  A  ++  +E    +  
Sbjct  27   EAVADLLQYLENRSTTNFFAGSPLAALTTLSFSENVDLQRSAALAFAEITEKE----VRE  82

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            + R  L P  V +L  +    +Q  ++ AL N+A   +E    VV  G +   I  + SP
Sbjct  83   VGRDTLDP--VLYLLSSHDPEVQRAASAALGNLAV-NAENKLLVVSLGGLEPLIRQMLSP  139

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
            +  +   AV  + N+A      +  + K GA+ PL  L    DM        RN T  L 
Sbjct  140  NVEVQCNAVGCITNLATHDE-NKTQIAKSGALVPLTRLAKSKDMR-----VQRNATGALL  193

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT-DGPNERIGMVVKTG  293
            N+  +      + A   I P LV LL+  D +V      A+S +  D  N +     +  
Sbjct  194  NMTHSDENRQQLVAAGAI-PVLVSLLNSPDTDVQYYCTTALSNIAVDAANRKKLAQSEPK  252

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            +V  LV+L+ +  L +   A  A+ N+ + +  Q ++V   G L     LL +    +  
Sbjct  253  LVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIV-KFGGLKPLLRLLHSSYLPLIL  311

Query  354  EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS-KADFKTQKEAVWAVTNYTS------  406
             A   + N++    ++   ++  G +  L+ +LS   + + Q  A+  + N  +      
Sbjct  312  SAAACVRNVSIHPANE-SPIIESGFLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNK  370

Query  407  -----GGTVEQIVYLV  417
                  G VE+I  LV
Sbjct  371  GAIVEAGAVEKIKSLV  386


> sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans 
var. neoformans serotype D (strain B-3501A) OX=283643 
GN=VAC8 PE=3 SV=1
Length=630

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 139/301 (46%), Gaps = 29/301 (10%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGAIPAFISLLAS  173
            ++ AG IP  VS L   D + +Q+    AL+NIA   + + K A  +   + + + L+ S
Sbjct  205  LVAAGAIPVLVSLLNSPD-TDVQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDS  263

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA---VP-DMSSLACGYLRNL  229
                +  QA  AL N+A D S ++  ++K+G + PLL LL    +P  +S+ AC  +RN+
Sbjct  264  QSLKVQCQAALALRNLASD-SKYQLEIVKFGGLKPLLRLLHSSYLPLILSAAAC--VRNV  320

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD---GPNERI  286
            +          N +P I++    L  L+ LL  D+ E +   C AIS L +      +  
Sbjct  321  SI------HPANESPIIES--GFLQPLIELLSFDENEEV--QCHAISTLRNLAASSEKNK  370

Query  287  GMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
            G +V+ G V ++  L+    L + +     +  +    D + Q+ ++ G   V   L  +
Sbjct  371  GAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKPQL-LEMGICEVLIPLTNS  429

Query  347  PKTNIQKEATWTMSNITAGRQDQ------IQQVVNHGLVPFLVSVLSKADFKTQKEAVWA  400
            P   +Q  +   + N+++   +       +    + GL  +LV  LS AD   Q  AVW 
Sbjct  430  PSVEVQGNSAAALGNLSSKAAEDYAPFNAVWNKPDGGLHAYLVRFLSSADITFQHIAVWT  489

Query  401  V  401
            +
Sbjct  490  I  490


 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 114/244 (47%), Gaps = 13/244 (5%)

Query  206  VDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
            +DP+L LL+  D         R  +  L NL  N      + ++  + P L+R +   + 
Sbjct  88   LDPVLYLLSSHDPE-----VQRAASAALGNLAVNAENKLLVVSLGGLEP-LIRQMLSPNV  141

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            EV  +    I+ L    +E    + K+G +  L +L  + ++ +   A  A+ N+ T +D
Sbjct  142  EVQCNAVGCITNLATH-DENKTQIAKSGALVPLTRLAKSKDMRVQRNATGALLNM-THSD  199

Query  326  EQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPFLV  383
            E  Q ++ AGA+ V  SLL +P T++Q   T  +SNI   A  + ++ Q     LV  LV
Sbjct  200  ENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDAANRKKLAQ-SEPKLVQSLV  258

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDA  443
             ++     K Q +A  A+ N  S    +  + +V  G ++PL+ LL +    +IL     
Sbjct  259  QLMDSQSLKVQCQAALALRNLASDSKYQ--LEIVKFGGLKPLLRLLHSSYLPLILSAAAC  316

Query  444  ISNI  447
            + N+
Sbjct  317  VRNV  320


 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 125/296 (42%), Gaps = 14/296 (5%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            +Q  +   +TN+A+    +T+    G  +P    L  S    +   A  AL N+      
Sbjct  143  VQCNAVGCITNLATHDENKTQIAKSGALVP-LTRLAKSKDMRVQRNATGALLNMTHSDE-  200

Query  196  FRDLVIKYGAVDPLLALLAVPDMS-SLACGYLRNLTWTLSNLCRNKNPAPPIDAVE-QIL  253
             R  ++  GA+  L++LL  PD      C      T  LSN+  +      +   E +++
Sbjct  201  NRQQLVAAGAIPVLVSLLNSPDTDVQYYC------TTALSNIAVDAANRKKLAQSEPKLV  254

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
             +LV+L+     +V      A+  L      ++  +VK G +  L++LL +S LP++  A
Sbjct  255  QSLVQLMDSQSLKVQCQAALALRNLASDSKYQL-EIVKFGGLKPLLRLLHSSYLPLILSA  313

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQ  372
               + N+      ++  +I++G L     LL+ +    +Q  A  T+ N+ A  +     
Sbjct  314  AACVRNVSIHPANESP-IIESGFLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNKGA  372

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE-QIVYLVHCGIIEPLMN  427
            +V  G V  + S++       Q E    V        ++ Q++ +  C ++ PL N
Sbjct  373  IVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKPQLLEMGICEVLIPLTN  428


 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 88/376 (23%), Positives = 155/376 (41%), Gaps = 33/376 (9%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGIN----SSNVENQLQATQAARKLLSREKQPPIDN  114
            +A + L +   N+ T N+     +  +     S NV+ Q  A  A  ++  +E    +  
Sbjct  27   EAVADLLQYLENRSTTNFFAGSPLAALTTLSFSENVDLQRSAALAFAEITEKE----VRE  82

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            + R  L P  V +L  +    +Q  ++ AL N+A   +E    VV  G +   I  + SP
Sbjct  83   VGRDTLDP--VLYLLSSHDPEVQRAASAALGNLAV-NAENKLLVVSLGGLEPLIRQMLSP  139

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
            +  +   AV  + N+A      +  + K GA+ PL  L    DM        RN T  L 
Sbjct  140  NVEVQCNAVGCITNLATHDE-NKTQIAKSGALVPLTRLAKSKDMR-----VQRNATGALL  193

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT-DGPNERIGMVVKTG  293
            N+  +      + A   I P LV LL+  D +V      A+S +  D  N +     +  
Sbjct  194  NMTHSDENRQQLVAAGAI-PVLVSLLNSPDTDVQYYCTTALSNIAVDAANRKKLAQSEPK  252

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            +V  LV+L+ +  L +   A  A+ N+ + +  Q ++V   G L     LL +    +  
Sbjct  253  LVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIV-KFGGLKPLLRLLHSSYLPLIL  311

Query  354  EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS-KADFKTQKEAVWAVTNYTS------  406
             A   + N++    ++   ++  G +  L+ +LS   + + Q  A+  + N  +      
Sbjct  312  SAAACVRNVSIHPANE-SPIIESGFLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNK  370

Query  407  -----GGTVEQIVYLV  417
                  G VE+I  LV
Sbjct  371  GAIVEAGAVEKIKSLV  386


> sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 
OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
Length=710

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 118/259 (46%), Gaps = 16/259 (6%)

Query  158  VVDGGAIPAFISLLASP-----------HAH-ISEQAVWALGNIAGDGSVFRDLVIKYGA  205
            +VDGGA+PA ++ L +P           + H + + + +ALG +A     ++ L++  GA
Sbjct  91   IVDGGAVPALMTHLQAPPYNDGDLAEKPYEHEVEKGSAFALGLLAIKPE-YQKLIVDKGA  149

Query  206  VDPLLALLAV-PDMSSLAC--GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHH  262
            +  L+ LL    D SS       +R     ++NL    +       VE  +P LV LL  
Sbjct  150  LPHLVNLLKRNKDGSSSRAVNSVIRRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEF  209

Query  263  DDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVT  322
             D +V      A+  L    ++    +V+   +P L+ +LG+ +  I   A+  IGN+V 
Sbjct  210  SDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVH  269

Query  323  GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFL  382
             +    + V+ AGAL     LL++     Q+EA   +    +   D    +V  G V  L
Sbjct  270  SSPHIKKEVLTAGALQPVIGLLSSCCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPL  329

Query  383  VSVLSKADFKTQKEAVWAV  401
            + +L   D + ++ + +A+
Sbjct  330  IEMLQSPDVQLKEMSAFAL  348


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query  119  GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI  178
            G IP  V  L  +D S +Q  +A AL  +A    +    +V+  A+P  I +L S  A I
Sbjct  198  GGIPPLVELLEFSD-SKVQRAAAGALRTLAFKNDDNKNQIVECNALPTLILMLGSEDAAI  256

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA  214
              +AV  +GN+       +  V+  GA+ P++ LL+
Sbjct  257  HYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLS  292


> sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis 
thaliana OX=3702 GN=ABAP1 PE=1 SV=1
Length=737

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 78/313 (25%), Positives = 137/313 (44%), Gaps = 27/313 (9%)

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP-----------HAHISEQAVWALG  187
            E+A  + ++A    E  + +V+ GAIPA +  L SP              + +    ALG
Sbjct  100  EAAADIADLAK-IDENVEIIVENGAIPALVRYLESPLVVCGNVPKSCEHKLEKDCALALG  158

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS---LACGYLRNLTWTLSNLCRNKNPAP  244
             IA     ++ L++  GA+ P + LL           A   +R     ++N+  + NP  
Sbjct  159  LIAAIQPGYQQLIVDAGAIVPTVKLLKRRGECGECMFANAVIRRAADIITNIAHD-NPRI  217

Query  245  PID-AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
              +  VE  +  LV LL+  D +V      A+  ++   +E    +V+   +P LV +L 
Sbjct  218  KTNIRVEGGIAPLVELLNFPDVKVQRAAAGALRTVSFRNDENKSQIVELNALPTLVLMLQ  277

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
            + +  +   A+ AIGN+V  + +  + VI AGAL     LL++     Q+EA   +    
Sbjct  278  SQDSTVHGEAIGAIGNLVHSSPDIKKEVIRAGALQPVIGLLSSTCLETQREAALLIGQFA  337

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY----LVHC  419
            A   D    +   G +  L+ +L  +D +  + + +A+      G + Q  +    + H 
Sbjct  338  APDSDCKVHIAQRGAITPLIKMLESSDEQVVEMSAFAL------GRLAQDAHNQAGIAHR  391

Query  420  GIIEPLMNLLTAK  432
            G I  L+NLL  K
Sbjct  392  GGIISLLNLLDVK  404


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 80/190 (42%), Gaps = 16/190 (8%)

Query  114  NIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS  173
            NI   G I   V  L   D   +Q  +A AL  ++    E    +V+  A+P  + +L S
Sbjct  220  NIRVEGGIAPLVELLNFPDVK-VQRAAAGALRTVSFRNDENKSQIVELNALPTLVLMLQS  278

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTL  233
              + +  +A+ A+GN+       +  VI+ GA+ P++ LL     SS      R     +
Sbjct  279  QDSTVHGEAIGAIGNLVHSSPDIKKEVIRAGALQPVIGLL-----SSTCLETQREAALLI  333

Query  234  SNLCRNKNPAPPIDAVEQI-----LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM  288
                     AP  D    I     +  L+++L   D +V+  + +A+  L    + + G+
Sbjct  334  GQFA-----APDSDCKVHIAQRGAITPLIKMLESSDEQVVEMSAFALGRLAQDAHNQAGI  388

Query  289  VVKTGVVPQL  298
              + G++  L
Sbjct  389  AHRGGIISLL  398


> sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis 
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL 
Y-1140 / WM37) OX=284590 GN=VAC8 PE=3 SV=3
Length=579

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 91/318 (29%), Positives = 140/318 (44%), Gaps = 28/318 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIR----AGLIPKFVSFLGRTDC  133
            ++ +++ + S NVE Q  A      L +++     DN I       L+P  ++ L R+  
Sbjct  130  LEPLIEQMKSDNVEVQCNAVGCITNLATQD-----DNKIEIAQSGALVP--LTKLARSSN  182

Query  134  SPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG  193
              +Q  +  AL N+ + + E  K +VD GA+P  +SLL+S  A +      AL NIA D 
Sbjct  183  IRVQRNATGALLNM-THSGENRKELVDAGAVPVLVSLLSSMDADVQYYCTTALSNIAVDE  241

Query  194  SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
            S  R L  K+    P L    V  M+S +       T  L NL  + N    I      L
Sbjct  242  SNRRYLS-KHA---PKLVTKLVSLMNSTSPRVKCQATLALRNLASDTNYQLEIVRAGG-L  296

Query  254  PTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVT  311
            P LV+L+  D  P VLA      +      NE  G++V  G +P LVKLL   E   I  
Sbjct  297  PDLVQLIQSDSLPLVLASVACIRNISIHPLNE--GLIVDAGFLPPLVKLLDYQESEEIQC  354

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE-----ATWTMSNITAGR  366
             A+  + N+   +++       +G +  F  L      ++Q E     A   +S+ T  +
Sbjct  355  HAVSTLRNLAASSEKNRAEFFQSGVIEKFKQLALTCPISVQSEISACFAILALSDNT--K  412

Query  367  QDQIQQVVNHGLVPFLVS  384
             D +QQ V   L+P  +S
Sbjct  413  YDLLQQDVLKVLIPMTMS  430


 Score = 34.7 bits (78),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 95/259 (37%), Gaps = 52/259 (20%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            V  +V  +NS++   + QAT A R L S         I+RAG +P  V  + ++D  P+ 
Sbjct  255  VTKLVSLMNSTSPRVKCQATLALRNLASDTNYQL--EIVRAGGLPDLVQLI-QSDSLPLV  311

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH-ISEQAVWALGNIAGDGSVF  196
              S   + NI+     +   +VD G +P  + LL    +  I   AV  L N+A      
Sbjct  312  LASVACIRNISIHPLNE-GLIVDAGFLPPLVKLLDYQESEEIQCHAVSTLRNLAASSEKN  370

Query  197  RDLVIKYGAVDPL------------------LALLAVPD---------------------  217
            R    + G ++                     A+LA+ D                     
Sbjct  371  RAEFFQSGVIEKFKQLALTCPISVQSEISACFAILALSDNTKYDLLQQDVLKVLIPMTMS  430

Query  218  ----MSSLACGYLRNLTWTLSNLCRNKNP-APPIDAVEQILPTLVRLLHHDDPEVLADTC  272
                +S  +   + NL   +SNL +       P D ++  L   +R L  D P       
Sbjct  431  QDQEISGNSAAAVANLISRVSNLEKILEYWGQPNDGIKGFL---IRFLSSDFPTYEHIAL  487

Query  273  WAISYLTDGPNERIGMVVK  291
            W I  L +  NE I  ++K
Sbjct  488  WTILQLFECHNETIYKLIK  506


> sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus 
OX=10090 GN=Spag6 PE=1 SV=1
Length=507

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/247 (23%), Positives = 103/247 (42%), Gaps = 6/247 (2%)

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +AWAL  IA   +E ++AVVD GAIP  +  +  P   +   A  AL +I+         
Sbjct  145  AAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQT  204

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            V+  GA+  L  ++  PD         R +   LS + ++      +    +I P ++  
Sbjct  205  VVDAGAIAHLAQMILNPDAK-----LKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTC  259

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L   D  V  + C  I  +     E   ++V  G V  ++  +G+ +  I  P +  +G 
Sbjct  260  LKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGY  319

Query  320  IVTGTDE-QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL  378
            +   ++     V+I  G   +   L   P+ +I+  A W +  +     +  + V     
Sbjct  320  VAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWALGQLGRHTPEHARAVAVTNT  379

Query  379  VPFLVSV  385
            +P L+S+
Sbjct  380  LPVLLSL  386


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 69/304 (23%), Positives = 114/304 (38%), Gaps = 52/304 (17%)

Query  95   QATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSP-IQFESAWALTNIASGTSE  153
            Q  Q   +L +R +   I+ +  AG++      L   D  P IQ  +A AL  +A+   +
Sbjct  19   QFVQMVAELATRPQN--IETLQNAGVMSLLRPLL--LDVVPTIQQTAALALGRLANYNDD  74

Query  154  QTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL  213
              +AVV G  +P  +  LA  +    + A + L  +          ++  GA+D      
Sbjct  75   LAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALD------  128

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW  273
                                                     TLV  L   DP V     W
Sbjct  129  -----------------------------------------TLVICLEDFDPGVKEAAAW  147

Query  274  AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVID  333
            A+ Y+     E    VV  G +P LV  +   E+ +   A  A+ +I   + E  Q V+D
Sbjct  148  ALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVD  207

Query  334  AGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKT  393
            AGA+A    ++ NP   ++++    +S I     D  + VV   + P +++ L   D   
Sbjct  208  AGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYV  267

Query  394  QKEA  397
            +K A
Sbjct  268  KKNA  271


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/292 (21%), Positives = 127/292 (43%), Gaps = 11/292 (4%)

Query  113  DNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            + +++  ++P+ V  L   +    +  +A+ L  +   + +  +A+VD GA+   +  L 
Sbjct  77   EAVVKGDILPQLVYSLAEQN-RFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLE  135

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS--SLACGYLRNLT  230
                 + E A WALG IA   +     V+  GA+  L+  +  P+++   +A   L +++
Sbjct  136  DFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDIS  195

Query  231  WTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVV  290
                 L +       +DA    +  L +++ + D ++      A+S +     +   MVV
Sbjct  196  KHSPELAQTV-----VDA--GAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVV  248

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
            +  + P ++  L   +  +   A   I  I   T E +Q++++AG +A     + + K N
Sbjct  249  EAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGN  308

Query  351  IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS-KADFKTQKEAVWAV  401
            I+      +  + A  ++    V+    VP L   LS + +   +  A WA+
Sbjct  309  IRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWAL  360


> sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain 
PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 
GN=VAC8 PE=3 SV=4
Length=559

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 81/328 (25%), Positives = 139/328 (42%), Gaps = 14/328 (4%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++ + S NVE Q  A      L + E+      I R+G +          D   +Q  +
Sbjct  133  LIRQMMSPNVEVQCNAVGCITNLATHEENKA--KIARSGALGPLTRLAKSRDMR-VQRNA  189

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ + + E  + +V+ GAIP  + LL+SP   +      AL NIA D S  R   
Sbjct  190  TGALLNM-THSDENRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRR---  245

Query  201  IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
             K    +P L    V  M S +          L NL  ++     I     + P L+RLL
Sbjct  246  -KLAQSEPKLVQSLVNLMDSTSPKVQCQAALALRNLASDEKYQLDIVRANGLHP-LLRLL  303

Query  261  HHDDPEVLADTCWAISYLTDGP-NERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRAIG  318
                  ++      I  ++  P NE    +++T  +  LV LLG+++   I   A+  + 
Sbjct  304  QSSYLPLILSAVACIRNISIHPMNE--SPIIETNFLKPLVDLLGSTDNEEIQCHAISTLR  361

Query  319  NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL  378
            N+   +D    +V+DAGA+     L+ +    +Q E T  ++ + A   D    ++N G+
Sbjct  362  NLAASSDRNKALVLDAGAVQKCKQLVLDVPITVQSEMTAAIA-VLALSDDLKSHLLNLGV  420

Query  379  VPFLVSVLSKADFKTQKEAVWAVTNYTS  406
               L+ +      + Q  +  A+ N +S
Sbjct  421  CGVLIPLTHSPSIEVQGNSAAALGNLSS  448


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 123/280 (44%), Gaps = 12/280 (4%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM  218
            VD   +   + LL SP   +   A  ALGN+A D +  + L+++ G + PL+  +  P++
Sbjct  84   VDRDTLEPILFLLQSPDIEVQRAASAALGNLAVD-TENKVLIVQLGGLTPLIRQMMSPNV  142

Query  219  SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL  278
              + C    N    ++NL  ++     I A    L  L RL    D  V  +   A+  +
Sbjct  143  -EVQC----NAVGCITNLATHEENKAKI-ARSGALGPLTRLAKSRDMRVQRNATGALLNM  196

Query  279  TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI-VTGTDEQTQVVIDAGAL  337
            T     R   +V  G +P LV+LL + ++ +      A+ NI V  ++ +     +   +
Sbjct  197  THSDENR-QQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRRKLAQSEPKLV  255

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
                +L+ +    +Q +A   + N+ +  + Q+  V  +GL P L  +L  +       A
Sbjct  256  QSLVNLMDSTSPKVQCQAALALRNLASDEKYQLDIVRANGLHPLL-RLLQSSYLPLILSA  314

Query  398  VWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
            V  + N +     E  +  +    ++PL++LL + D + I
Sbjct  315  VACIRNISIHPMNESPI--IETNFLKPLVDLLGSTDNEEI  352


> sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens 
OX=9606 GN=SPAG6 PE=2 SV=1
Length=509

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 66/145 (46%), Gaps = 0/145 (0%)

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            L TLV  L   DP V     WA+ Y+     E    VV  G VP LV  +   E+ +   
Sbjct  127  LDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRI  186

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            A  A+ +I   + E  Q V+DAGA+A    ++ NP   ++ +    +S ++    D  + 
Sbjct  187  AASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEM  246

Query  373  VVNHGLVPFLVSVLSKADFKTQKEA  397
            VV   + P +++ L   D   +K A
Sbjct  247  VVEAEIFPVVLTCLKDKDEYVKKNA  271


 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/247 (23%), Positives = 100/247 (40%), Gaps = 6/247 (2%)

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +AWAL  IA   +E ++AVVD GA+P  +  +  P   +   A  AL +IA         
Sbjct  145  AAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQT  204

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            V+  GAV  L  ++  PD           +   LS + ++      +    +I P ++  
Sbjct  205  VVDAGAVAHLAQMILNPDAK-----LKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTC  259

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L   D  V  +    I  +     E   +VV  G V  ++  +G+ +     P +  +G 
Sbjct  260  LKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGY  319

Query  320  IVTGTDE-QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL  378
            +   ++     V+I  G   +   L   P+ +I+  A W +  I     +  + V     
Sbjct  320  VAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNT  379

Query  379  VPFLVSV  385
            +P L+S+
Sbjct  380  LPVLLSL  386


 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 91/206 (44%), Gaps = 8/206 (4%)

Query  255  TLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
            +L+R L  D  P +      A+  L +  ++    VVK  ++PQLV  L          A
Sbjct  44   SLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAA  103

Query  314  ---LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
               LRA+G     + +  Q ++D GAL      L +    +++ A W +  I     +  
Sbjct  104  AFVLRAVGK---HSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELS  160

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            Q VV+ G VP LV  + + +   ++ A  A+++  +  + E    +V  G +  L  ++ 
Sbjct  161  QAVVDAGAVPLLVLCIQEPEIALKRIAASALSD-IAKHSPELAQTVVDAGAVAHLAQMIL  219

Query  431  AKDTKIILVILDAISNIFQAAEKLGE  456
              D K+   IL A+S + + +  L E
Sbjct  220  NPDAKLKHQILSALSQVSKHSVDLAE  245


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 122/290 (42%), Gaps = 7/290 (2%)

Query  113  DNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            + +++  ++P+ V  L   +    +  +A+ L  +   + +  +A+VD GA+   +  L 
Sbjct  77   EAVVKCDILPQLVYSLAEQN-RFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLE  135

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
                 + E A WAL  IA   +     V+  GAV  L+  +  P+++       R     
Sbjct  136  DFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIA-----LKRIAASA  190

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            LS++ ++             +  L +++ + D ++      A+S ++    +   MVV+ 
Sbjct  191  LSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA  250

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ  352
             + P ++  L   +  +   A   I  I   T E +Q+V++AG +A     + + K N +
Sbjct  251  EIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTR  310

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA-DFKTQKEAVWAV  401
                  +  + A  ++    V+    VP L   LS+  +   +  A WA+
Sbjct  311  LPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWAL  360


 Score = 37.4 bits (85),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 35/148 (24%), Positives = 66/148 (45%), Gaps = 1/148 (1%)

Query  289  VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPK  348
            +V  G +  LV  L   +  +   A  A+  I     E +Q V+DAGA+ +    +  P+
Sbjct  121  IVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPE  180

Query  349  TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG  408
              +++ A   +S+I     +  Q VV+ G V  L  ++   D K + + + A++   S  
Sbjct  181  IALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQ-VSKH  239

Query  409  TVEQIVYLVHCGIIEPLMNLLTAKDTKI  436
            +V+    +V   I   ++  L  KD  +
Sbjct  240  SVDLAEMVVEAEIFPVVLTCLKDKDEYV  267


> sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata 
(strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) 
OX=330879 GN=vac8 PE=3 SV=1
Length=578

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 147/336 (44%), Gaps = 30/336 (9%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++ + S NVE Q  A      L + E       I R+G +   +      D   +Q  +
Sbjct  152  LIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLIRLAKSKDMR-VQRNA  208

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ + + +  + +V+ GAIP  + LL+SP   +      AL NIA D S  + L 
Sbjct  209  TGALLNM-THSDDNRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRKRLA  267

Query  201  -IKYGAVDPLLALL--AVPDMSSLACGYLRNLT----WTLSNLCRNKNPAPPIDAVEQIL  253
              +   V  L+ L+  + P +   A   LRNL     + L  + R K            L
Sbjct  268  QTESRLVQSLVHLMDSSTPKVQCQAALALRNLASDEKYQL-EIVRAKG-----------L  315

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGP-NERIGMVVKTGVVPQLVKLLGASE-LPIVT  311
            P L+RLL      ++      I  ++  P NE    ++  G +  LV LLG+++   I  
Sbjct  316  PPLLRLLQSSYLPLILSAVACIRNISIHPLNE--SPIIDAGFLKPLVDLLGSTDNEEIQC  373

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
             A+  + N+   +D   ++V+ AGA+     L+     ++Q E T  ++ +     D+++
Sbjct  374  HAISTLRNLAASSDRNKELVLQAGAVQKCKDLVLRVPLSVQSEMTAAIAVLALS--DELK  431

Query  372  -QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
              ++N G+   L+ + +    + Q  +  A+ N +S
Sbjct  432  PHLLNLGVFDVLIPLTNSESIEVQGNSAAALGNLSS  467


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 116/244 (48%), Gaps = 13/244 (5%)

Query  206  VDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
            ++P+L LL   D+        R  +  L NL  N      I A+  + P L+R +   + 
Sbjct  108  LEPILFLLQSSDIE-----VQRAASAALGNLAVNAENKVLIVALGGLTP-LIRQMMSPNV  161

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            EV  +    I+ L    + +   + ++G +  L++L  + ++ +   A  A+ N+ T +D
Sbjct  162  EVQCNAVGCITNLATHEDNK-AKIARSGALGPLIRLAKSKDMRVQRNATGALLNM-THSD  219

Query  326  EQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPFLV  383
            +  Q +++AGA+ V   LL++P  ++Q   T  +SNI   A  + ++ Q  +  LV  LV
Sbjct  220  DNRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRKRLAQTESR-LVQSLV  278

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDA  443
             ++  +  K Q +A  A+ N  S    +  + +V    + PL+ LL +    +IL  +  
Sbjct  279  HLMDSSTPKVQCQAALALRNLASDEKYQ--LEIVRAKGLPPLLRLLQSSYLPLILSAVAC  336

Query  444  ISNI  447
            I NI
Sbjct  337  IRNI  340


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 64/280 (23%), Positives = 124/280 (44%), Gaps = 12/280 (4%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM  218
            VD   +   + LL S    +   A  ALGN+A +    + L++  G + PL+  +  P++
Sbjct  103  VDRDTLEPILFLLQSSDIEVQRAASAALGNLAVNAE-NKVLIVALGGLTPLIRQMMSPNV  161

Query  219  SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL  278
              + C    N    ++NL  +++    I A    L  L+RL    D  V  +   A+  +
Sbjct  162  -EVQC----NAVGCITNLATHEDNKAKI-ARSGALGPLIRLAKSKDMRVQRNATGALLNM  215

Query  279  TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI-VTGTDEQTQVVIDAGAL  337
            T   + R   +V  G +P LV+LL + ++ +      A+ NI V  ++ +     ++  +
Sbjct  216  THSDDNR-QQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRKRLAQTESRLV  274

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
                 L+ +    +Q +A   + N+ +  + Q++ V   GL P L  +L  +       A
Sbjct  275  QSLVHLMDSSTPKVQCQAALALRNLASDEKYQLEIVRAKGLPPLL-RLLQSSYLPLILSA  333

Query  398  VWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
            V  + N +     E  +  +  G ++PL++LL + D + I
Sbjct  334  VACIRNISIHPLNESPI--IDAGFLKPLVDLLGSTDNEEI  371


> sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris 
OX=4922 GN=VAC8 PE=3 SV=3
Length=556

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 76/307 (25%), Positives = 134/307 (44%), Gaps = 21/307 (7%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            +Q  +   +TN+A+    ++K    G  IP    L  S    +   A  AL N+      
Sbjct  143  VQCNAVGCITNLATQDQNKSKIATSGALIP-LTKLAKSKDLRVQRNATGALLNMTHSLEN  201

Query  196  FRDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE-QI  252
             ++LV   G+V  L+ LL+   PD+           T  LSN+  ++     + + E ++
Sbjct  202  RQELV-NAGSVPILVQLLSSTDPDVQYYC-------TTALSNIAVDEGNRKKLASTEPKL  253

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            +  LV+L+    P V      A+  L    N ++  +V+ G +P LV LL ++  P+V  
Sbjct  254  ISQLVQLMDSTSPRVQCQATLALRNLASDANYQLE-IVRAGGLPNLVTLLNSTHQPLVLA  312

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQ  371
            A+  I NI      +  ++IDAG L    SLL  N    IQ  A  T+ N+ A  +    
Sbjct  313  AVACIRNISIHPLNEA-LIIDAGFLKPLVSLLDYNDNVEIQCHAVSTLRNLAASSERNRL  371

Query  372  QVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
             ++  G V     ++  +    Q E  A +A+        ++    L+   IIE L+ L 
Sbjct  372  ALLESGAVEKCEKLVLNSPISVQSEISACFAILALADDLKMK----LLDSNIIEVLLPLT  427

Query  430  TAKDTKI  436
            ++++ ++
Sbjct  428  SSENGEV  434


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 150/342 (44%), Gaps = 19/342 (6%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            I  + + AL   A  T +  + V      P  I LL S  A +   A  ALGN+A + S 
Sbjct  62   IDLQRSAALA-FAEVTEKDVRPVTRDVLEPILI-LLQSSDAEVQRAACAALGNLAVNDS-  118

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
             + L++  G ++PL+  +  P++  + C    N    ++NL         I     ++P 
Sbjct  119  NKVLIVNMGGLEPLIRQMMSPNI-EVQC----NAVGCITNLATQDQNKSKIATSGALIP-  172

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            L +L    D  V  +   A+  +T     R   +V  G VP LV+LL +++  +      
Sbjct  173  LTKLAKSKDLRVQRNATGALLNMTHSLENR-QELVNAGSVPILVQLLSSTDPDVQYYCTT  231

Query  316  AIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
            A+ NI      + ++   +   ++    L+ +    +Q +AT  + N+ +    Q+ ++V
Sbjct  232  ALSNIAVDEGNRKKLASTEPKLISQLVQLMDSTSPRVQCQATLALRNLASDANYQL-EIV  290

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
              G +P LV++L+         AV  + N +     E ++  +  G ++PL++LL   D 
Sbjct  291  RAGGLPNLVTLLNSTHQPLVLAAVACIRNISIHPLNEALI--IDAGFLKPLVSLLDYNDN  348

Query  435  KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
              + +   A+S +   A     +E+  + + E G ++K E L
Sbjct  349  --VEIQCHAVSTLRNLA---ASSERNRLALLESGAVEKCEKL  385


 Score = 33.5 bits (75),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 39/80 (49%), Gaps = 2/80 (3%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL-LAS  173
            II AG +   VS L   D   IQ  +   L N+A+ +     A+++ GA+     L L S
Sbjct  330  IIDAGFLKPLVSLLDYNDNVEIQCHAVSTLRNLAASSERNRLALLESGAVEKCEKLVLNS  389

Query  174  PHAHISE-QAVWALGNIAGD  192
            P +  SE  A +A+  +A D
Sbjct  390  PISVQSEISACFAILALADD  409


> sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae 
(strain ATCC 42149 / RIB 40) OX=510516 GN=vac8 PE=3 SV=1
Length=578

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 80/336 (24%), Positives = 145/336 (43%), Gaps = 30/336 (9%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++ + S NVE Q  A      L + E       I R+G +   +      D   +Q  +
Sbjct  152  LIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLIRLAKSKDMR-VQRNA  208

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ + + +  + +V+ GAIP  + LL+S    +      AL NIA D S  + L 
Sbjct  209  TGALLNM-THSDDNRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRKRLA  267

Query  201  -IKYGAVDPLLALL--AVPDMSSLACGYLRNLT----WTLSNLCRNKNPAPPIDAVEQIL  253
              +   V  L+ L+  + P +   A   LRNL     + L  + R K            L
Sbjct  268  QTESRLVQSLVHLMDSSTPKVQCQAALALRNLASDEKYQL-EIVRAKG-----------L  315

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGP-NERIGMVVKTGVVPQLVKLLGASE-LPIVT  311
            P L+RLL      ++      I  ++  P NE    ++  G +  LV LLG+++   I  
Sbjct  316  PPLLRLLQSSYLPLILSAVACIRNISIHPLNE--SPIIDAGFLKPLVDLLGSTDNEEIQC  373

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
             A+  + N+   +D   ++V+ AGA+     L+     ++Q E T  ++ +     D+++
Sbjct  374  HAISTLRNLAASSDRNKELVLQAGAVQKCKDLVLKVPLSVQSEMTAAIAVLALS--DELK  431

Query  372  -QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
              ++N G+   L+ +      + Q  +  A+ N +S
Sbjct  432  PHLLNLGVFDVLIPLTESESIEVQGNSAAALGNLSS  467


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 125/282 (44%), Gaps = 16/282 (6%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSVFRDLVIKYGAVDPLLALLAVP  216
            VD   +   + LL S    +   A  ALGN+A   D  V   L++  G + PL+  +  P
Sbjct  103  VDRDTLEPILFLLQSSDIEVQRAASAALGNLAVNADNKV---LIVALGGLAPLIRQMMSP  159

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
            ++  + C    N    ++NL  +++    I A    L  L+RL    D  V  +   A+ 
Sbjct  160  NV-EVQC----NAVGCITNLATHEDNKAKI-ARSGALGPLIRLAKSKDMRVQRNATGALL  213

Query  277  YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI-VTGTDEQTQVVIDAG  335
             +T   + R   +V  G +P LV+LL +S++ +      A+ NI V  ++ +     ++ 
Sbjct  214  NMTHSDDNR-QQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRKRLAQTESR  272

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK  395
             +     L+ +    +Q +A   + N+ +  + Q++ V   GL P L  +L  +      
Sbjct  273  LVQSLVHLMDSSTPKVQCQAALALRNLASDEKYQLEIVRAKGLPPLL-RLLQSSYLPLIL  331

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
             AV  + N +     E  +  +  G ++PL++LL + D + I
Sbjct  332  SAVACIRNISIHPLNESPI--IDAGFLKPLVDLLGSTDNEEI  371


 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 116/244 (48%), Gaps = 13/244 (5%)

Query  206  VDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
            ++P+L LL   D+        R  +  L NL  N +    I A+  + P L+R +   + 
Sbjct  108  LEPILFLLQSSDIE-----VQRAASAALGNLAVNADNKVLIVALGGLAP-LIRQMMSPNV  161

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            EV  +    I+ L    + +   + ++G +  L++L  + ++ +   A  A+ N+ T +D
Sbjct  162  EVQCNAVGCITNLATHEDNK-AKIARSGALGPLIRLAKSKDMRVQRNATGALLNM-THSD  219

Query  326  EQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPFLV  383
            +  Q +++AGA+ V   LL++   ++Q   T  +SNI   A  + ++ Q  +  LV  LV
Sbjct  220  DNRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRKRLAQTESR-LVQSLV  278

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDA  443
             ++  +  K Q +A  A+ N  S    +  + +V    + PL+ LL +    +IL  +  
Sbjct  279  HLMDSSTPKVQCQAALALRNLASDEKYQ--LEIVRAKGLPPLLRLLQSSYLPLILSAVAC  336

Query  444  ISNI  447
            I NI
Sbjct  337  IRNI  340


 Score = 35.8 bits (81),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 46/192 (24%), Positives = 75/192 (39%), Gaps = 12/192 (6%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            II AG +   V  LG TD   IQ  +   L N+A+ +    + V+  GA+     L+   
Sbjct  350  IIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKELVLQAGAVQKCKDLVLKV  409

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL-----LAVPDMSSLACGYLRNL  229
               +  +   A+  +A      +  ++  G  D L+ L     + V   S+ A G L + 
Sbjct  410  PLSVQSEMTAAIAVLALSDE-LKPHLLNLGVFDVLIPLTESESIEVQGNSAAALGNLSSK  468

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER-IGM  288
                S   R+   A P   +   L    R L   DP       W +  L +  ++R I  
Sbjct  469  VGDYSIFVRDW--ADPNGGIHGYLK---RFLASGDPTFQHIAIWTLLQLLESEDKRLISY  523

Query  289  VVKTGVVPQLVK  300
            + K+  V  +VK
Sbjct  524  IAKSDDVVHMVK  535


> sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii 
(strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 
2968) OX=284592 GN=VAC8 PE=3 SV=4
Length=560

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 129/292 (44%), Gaps = 25/292 (9%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDG--SVFRDLVIKYGAVDPLLALLAVPD--  217
            G + A  +L+ S +  +   A  A   I       V RD++      +P+L LL   D  
Sbjct  49   GPLRALSTLVYSENIDLQRSAALAFAEITEKDVREVNRDVL------EPILILLQSADSE  102

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI-LPTLVRLLHHDDPEVLADTCWAIS  276
            +   ACG L NL         N+N    I  VE   L  L+R +   + EV  +    I+
Sbjct  103  VQRAACGALGNLAVN------NENK---ILIVEMGGLEPLIRQMMSTNIEVQCNAVGCIT  153

Query  277  YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGA  336
             L    + +   + K+G +  L KL  + ++ +   A  A+ N+ T + E  Q +++AGA
Sbjct  154  NLATQDDNKTK-IAKSGALIPLAKLAKSKDIRVQRNATGALLNM-THSGENRQELVNAGA  211

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVLSKADFKTQK  395
            + V  SLL+N   ++Q   T  +SNI     ++ +       LV  LV+++     + Q 
Sbjct  212  VPVLVSLLSNEDADVQYYCTTALSNIAVDEMNRKKLSTTEPKLVSQLVNLMDSPSPRVQC  271

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI  447
            +A  A+ N  S    +  V +V  G +  L+ LLT     ++L  +  I NI
Sbjct  272  QATLALRNLASDSGYQ--VEIVRAGGLPHLVQLLTCNHQPLVLAAVACIRNI  321


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 74/328 (23%), Positives = 132/328 (40%), Gaps = 57/328 (17%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPI  136
            ++ +++ + S+N+E Q  A      L +++       I ++G LIP  ++ L ++    +
Sbjct  130  LEPLIRQMMSTNIEVQCNAVGCITNLATQDDNKT--KIAKSGALIP--LAKLAKSKDIRV  185

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF  196
            Q  +  AL N+ + + E  + +V+ GA+P  +SLL++  A +      AL NIA D    
Sbjct  186  QRNATGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVDEMNR  244

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            +    K    +P                                          +++  L
Sbjct  245  K----KLSTTEP------------------------------------------KLVSQL  258

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
            V L+    P V      A+  L      ++  +V+ G +P LV+LL  +  P+V  A+  
Sbjct  259  VNLMDSPSPRVQCQATLALRNLASDSGYQVE-IVRAGGLPHLVQLLTCNHQPLVLAAVAC  317

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
            I NI      +  ++IDAG L     LL  N    IQ  A  T+ N+ A  +     ++ 
Sbjct  318  IRNISIHPLNEA-LIIDAGFLKPLVGLLDFNDSEEIQCHAVSTLRNLAASSERNRLALLA  376

Query  376  HGLVPFLVSVLSKADFKTQKE--AVWAV  401
             G V     ++ K     Q E  A +A+
Sbjct  377  AGAVDKCKELVLKVPLSVQSEISACFAI  404


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 77/342 (23%), Positives = 145/342 (42%), Gaps = 21/342 (6%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            +Q  +A A   I    +E+    V+   +   + LL S  + +   A  ALGN+A +   
Sbjct  65   LQRSAALAFAEI----TEKDVREVNRDVLEPILILLQSADSEVQRAACGALGNLAVNNE-  119

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
             + L+++ G ++PL     +  M S       N    ++NL    +    I     ++P 
Sbjct  120  NKILIVEMGGLEPL-----IRQMMSTNIEVQCNAVGCITNLATQDDNKTKIAKSGALIP-  173

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            L +L    D  V  +   A+  +T     R  + V  G VP LV LL   +  +      
Sbjct  174  LAKLAKSKDIRVQRNATGALLNMTHSGENRQEL-VNAGAVPVLVSLLSNEDADVQYYCTT  232

Query  316  AIGNI-VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
            A+ NI V   + +     +   ++   +L+ +P   +Q +AT  + N+ +    Q+ ++V
Sbjct  233  ALSNIAVDEMNRKKLSTTEPKLVSQLVNLMDSPSPRVQCQATLALRNLASDSGYQV-EIV  291

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
              G +P LV +L+         AV  + N +     E ++  +  G ++PL+ LL   D+
Sbjct  292  RAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEALI--IDAGFLKPLVGLLDFNDS  349

Query  435  KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            + I     A+S +   A     +E+  + +   G +DK + L
Sbjct  350  EEIQC--HAVSTLRNLA---ASSERNRLALLAAGAVDKCKEL  386


> sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain 
SC5314 / ATCC MYA-2876) OX=237561 GN=VAC8 PE=3 SV=3
Length=585

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 126/292 (43%), Gaps = 25/292 (9%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDG--SVFRDLVIKYGAVDPLLALLAVPD--  217
            G + A  +L+ S +  +   A  A   I       V RD++      +P+L LL   D  
Sbjct  49   GPLRALSTLVYSENIDLQRSAALAFAEITEKDVREVNRDVL------EPILILLQSADSE  102

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI-LPTLVRLLHHDDPEVLADTCWAIS  276
            +   ACG L NL     N          I  VE   L  L+R +   + EV  +    I+
Sbjct  103  VQRAACGALGNLAVNTEN---------KILIVEMGGLEPLIRQMMSTNIEVQCNAVGCIT  153

Query  277  YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGA  336
             L    + +   + K+G +  L KL  + ++ +   A  A+ N+ T + E  Q +++AGA
Sbjct  154  NLATQDDNK-SKIAKSGALIPLTKLAKSKDIRVQRNATGALLNM-THSGENRQELVNAGA  211

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH-GLVPFLVSVLSKADFKTQK  395
            + V  SLL+N   ++Q   T  +SNI     ++ +       LV  LV ++     + Q 
Sbjct  212  VPVLVSLLSNEDADVQYYCTTALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQC  271

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI  447
            +A  A+ N  S    +  V +V  G +  L+ LLT     ++L  +  I NI
Sbjct  272  QATLALRNLASDSGYQ--VEIVRAGGLPHLVQLLTCNHQPLVLAAVACIRNI  321


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 74/328 (23%), Positives = 134/328 (41%), Gaps = 57/328 (17%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPI  136
            ++ +++ + S+N+E Q  A      L +++       I ++G LIP  ++ L ++    +
Sbjct  130  LEPLIRQMMSTNIEVQCNAVGCITNLATQDDNK--SKIAKSGALIP--LTKLAKSKDIRV  185

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF  196
            Q  +  AL N+ + + E  + +V+ GA+P  +SLL++  A +      AL NIA D  V 
Sbjct  186  QRNATGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVD-EVN  243

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            R    K  + +P                                          +++  L
Sbjct  244  RK---KLASTEP------------------------------------------KLVGQL  258

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
            V L+    P V      A+  L      ++  +V+ G +P LV+LL  +  P+V  A+  
Sbjct  259  VHLMDSPSPRVQCQATLALRNLASDSGYQVE-IVRAGGLPHLVQLLTCNHQPLVLAAVAC  317

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVN  375
            I NI      +  ++I+AG L     LL    +  IQ  A  T+ N+ A  +     ++ 
Sbjct  318  IRNISIHPLNEA-LIIEAGFLKPLVGLLDYTDSEEIQCHAVSTLRNLAASSEKNRTALLA  376

Query  376  HGLVPFLVSVLSKADFKTQKE--AVWAV  401
             G V     ++ K     Q E  A +A+
Sbjct  377  AGAVDKCKELVLKVPLTVQSEISACFAI  404


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 78/342 (23%), Positives = 143/342 (42%), Gaps = 21/342 (6%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            +Q  +A A   I    +E+    V+   +   + LL S  + +   A  ALGN+A + + 
Sbjct  65   LQRSAALAFAEI----TEKDVREVNRDVLEPILILLQSADSEVQRAACGALGNLAVN-TE  119

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
             + L+++ G ++PL     +  M S       N    ++NL    +    I     ++P 
Sbjct  120  NKILIVEMGGLEPL-----IRQMMSTNIEVQCNAVGCITNLATQDDNKSKIAKSGALIP-  173

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            L +L    D  V  +   A+  +T     R  + V  G VP LV LL   +  +      
Sbjct  174  LTKLAKSKDIRVQRNATGALLNMTHSGENRQEL-VNAGAVPVLVSLLSNEDADVQYYCTT  232

Query  316  AIGNI-VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
            A+ NI V   + +     +   +     L+ +P   +Q +AT  + N+ +    Q+ ++V
Sbjct  233  ALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQCQATLALRNLASDSGYQV-EIV  291

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
              G +P LV +L+         AV  + N +     E ++  +  G ++PL+ LL   D+
Sbjct  292  RAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEALI--IEAGFLKPLVGLLDYTDS  349

Query  435  KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            + I     A+S +   A     +EK    +   G +DK + L
Sbjct  350  EEIQC--HAVSTLRNLA---ASSEKNRTALLAAGAVDKCKEL  386


 Score = 37.4 bits (85),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 73/189 (39%), Gaps = 23/189 (12%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL-LAS  173
            II AG +   V  L  TD   IQ  +   L N+A+ + +   A++  GA+     L L  
Sbjct  331  IIEAGFLKPLVGLLDYTDSEEIQCHAVSTLRNLAASSEKNRTALLAAGAVDKCKELVLKV  390

Query  174  PHAHISE-QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            P    SE  A +A+  +A D    +  + +   +D L+ L    +     CG   N    
Sbjct  391  PLTVQSEISACFAILALADD---LKPKLYESHIIDVLIPLTFSENGE--VCG---NSAAA  442

Query  233  LSNLCRN----------KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGP  282
            L+NLC             N A P    E I   L+R L    P       W I  L +  
Sbjct  443  LANLCSRVSNEHKQYILNNWAQP---NEGIYGFLIRFLESGSPTFEHIALWTILQLLESN  499

Query  283  NERIGMVVK  291
            N  I  ++K
Sbjct  500  NTEINALIK  508


> sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) OX=559292 GN=VAC8 PE=1 SV=3
Length=578

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 76/153 (50%), Gaps = 3/153 (2%)

Query  251  QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
            ++L  ++ LL   DP++    C A+  L    NE   ++V+ G +  L+  +    + + 
Sbjct  85   EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQ  143

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
              A+  I N+ T  D + ++   +GAL     L  +    +Q+ AT  + N+T   +++ 
Sbjct  144  CNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENR-  201

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            +++VN G VP LVS+LS  D   Q     A++N
Sbjct  202  KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN  234


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE  139
            ++  +   NVE Q  A      L +R+       I  +G LIP  ++ L ++    +Q  
Sbjct  131  LINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIP--LTKLAKSKHIRVQRN  186

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +  AL N+ + + E  K +V+ GA+P  +SLL+S    +      AL NIA D +  +  
Sbjct  187  ATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK--  243

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
              K    +P L    V  M S +       T  L NL  + +    I      LP LV+L
Sbjct  244  --KLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGG-LPHLVKL  300

Query  260  LHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRAI  317
            +  D  P VLA      +      NE  G++V  G +  LV+LL   +   I   A+  +
Sbjct  301  IQSDSIPLVLASVACIRNISIHPLNE--GLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTL  358

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQVV  374
             N+   +++  +   ++GA+     L  +   ++Q E +   + +      + D ++  +
Sbjct  359  RNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANI  418

Query  375  NHGLVPFLVS  384
               L+P   S
Sbjct  419  LDALIPMTFS  428


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 79/350 (23%), Positives = 151/350 (43%), Gaps = 17/350 (5%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            K ++ L  +D   +Q  +A A   I      Q    V    +   + LL S    I   A
Sbjct  50   KALTTLVYSDNLNLQRSAALAFAEITEKYVRQ----VSREVLEPILILLQSQDPQIQVAA  105

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + L+++ G ++PL+  + + D   + C    N    ++NL    + 
Sbjct  106  CAALGNLAVNNE-NKLLIVEMGGLEPLINQM-MGDNVEVQC----NAVGCITNLATRDDN  159

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I     ++P L +L       V  +   A+  +T     R   +V  G VP LV LL
Sbjct  160  KHKIATSGALIP-LTKLAKSKHIRVQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLL  217

Query  303  GASELPIVTPALRAIGNI-VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN  361
             +++  +      A+ NI V   + +     +   ++   SL+ +P + ++ +AT  + N
Sbjct  218  SSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRN  277

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +    Q++ +V  G +P LV ++          +V  + N +     E ++  V  G 
Sbjct  278  LASDTSYQLE-IVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLI--VDAGF  334

Query  422  IEPLMNLLTAKDTKIILV-ILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
            ++PL+ LL  KD++ I    +  + N+  ++EK  +    S  +E+C  L
Sbjct  335  LKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKEL  384


> sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain 
ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) 
OX=284593 GN=VAC8 PE=3 SV=3
Length=582

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 77/152 (51%), Gaps = 3/152 (2%)

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT  311
            +L  ++ LL   DP++    C A+  L      ++ +V   G+ P + +++G + + +  
Sbjct  86   VLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVDMGGLEPLINQMMG-TNVEVQC  144

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
             A+  I N+ T  D + ++   +GAL     L  +    +Q+ AT  + N+T   +++ +
Sbjct  145  NAVGCITNLATRDDNKHKIAT-SGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENR-R  202

Query  372  QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            ++VN G VP LVS+LS  D   Q     A++N
Sbjct  203  ELVNAGAVPVLVSLLSSNDPDVQYYCTTALSN  234


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 74/311 (24%), Positives = 138/311 (44%), Gaps = 20/311 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE  139
            ++  +  +NVE Q  A      L +R+       I  +G L+P  ++ L ++    +Q  
Sbjct  131  LINQMMGTNVEVQCNAVGCITNLATRDDNK--HKIATSGALVP--LTKLAKSKHIRVQRN  186

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +  AL N+ + + E  + +V+ GA+P  +SLL+S    +      AL NIA D +  + L
Sbjct  187  ATGALLNM-THSEENRRELVNAGAVPVLVSLLSSNDPDVQYYCTTALSNIAVDEANRKKL  245

Query  200  V-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR  258
               +   V  L++L+  P  S + C      T  L NL  + +    I      LP LV 
Sbjct  246  AQTEPRLVSKLVSLMDSPS-SRVKC----QATLALRNLASDTSYQLEI-VRAGGLPHLVN  299

Query  259  LLHHDDPEVLADTCWAISYLTDGP-NERIGMVVKTGVVPQLVKLLGASEL-PIVTPALRA  316
            L+  +   ++  +   I  ++  P NE  G++V  G +P LVKLL   +   I   A+  
Sbjct  300  LIQSESVPLILASVACIRNISIHPLNE--GLIVDAGFLPPLVKLLDYRDSEEIQCHAVST  357

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT---AGRQDQIQQV  373
            + N+   +++  +   ++GA+     L  +   ++Q E +   + +      +QD +   
Sbjct  358  LRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISACFAILALADVSKQDLLDAD  417

Query  374  VNHGLVPFLVS  384
            +   L+P   S
Sbjct  418  ILQALIPMTFS  428


> sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain 
ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 
GN=VAC8 PE=3 SV=3
Length=568

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 81/353 (23%), Positives = 144/353 (41%), Gaps = 61/353 (17%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPI  136
            ++ +++ + S+NVE Q  A      L +++       I  +G L+P  ++ L ++    +
Sbjct  128  LEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKA--KIAHSGALVP--LTKLAKSKNIRV  183

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF  196
            Q  +  AL N+ + + E  K +VD GA+P  +SLL+S  A +      AL NIA D S  
Sbjct  184  QRNATGALLNM-THSGENRKELVDAGAVPVLVSLLSSSDADVQYYCTTALSNIAVDESNR  242

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            R L      +   L +L     + + C      T  L NL                    
Sbjct  243  RKLSQTEPRLVSKLVVLTDSPSARVKC----QATLALRNLA-------------------  279

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
                        +DT + +             +V+ G +  LVKL+  + +P+V  ++  
Sbjct  280  ------------SDTGYQLE------------IVRAGGLSHLVKLIQCNSMPLVLASVAC  315

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
            I NI      +  +++DAG L     LL  N    IQ  A  T+ N+ A  +   Q+   
Sbjct  316  IRNISIHPLNEG-LIVDAGFLKPLVKLLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFE  374

Query  376  HGLVPFL--VSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
             G V     ++++S    +++  A +A+        +E    L+   I+E L+
Sbjct  375  SGAVEKCKQLALVSPISVQSEISACFAILALADNSKLE----LLDANILEALI  423


> sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa 
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 
987) OX=367110 GN=vac8 PE=3 SV=4
Length=559

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 135/328 (41%), Gaps = 14/328 (4%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++ + S NVE Q  A      L + E       I R+G +          D   +Q  +
Sbjct  133  LIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLTRLAKSRDMR-VQRNA  189

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ + + E  + +V+ GAIP  + LL+S    +      AL NIA D +  R   
Sbjct  190  TGALLNM-THSDENRQQLVNAGAIPVLVQLLSSTDVDVQYYCTTALSNIAVDANNRR---  245

Query  201  IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
             K    +P L    V  M S +          L NL  ++     I     + P L+RLL
Sbjct  246  -KLAQTEPRLVQSLVNLMDSSSPKVQCQAALALRNLASDEKYQLEIVRASGLGP-LLRLL  303

Query  261  HHDDPEVLADTCWAISYLTDGP-NERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRAIG  318
                  ++      I  ++  P NE    +++ G +  LV LLG+++   I   A+  + 
Sbjct  304  QSSYLPLILSAVACIRNISIHPMNE--SPIIEAGFLKPLVDLLGSTDNEEIQCHAISTLR  361

Query  319  NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL  378
            N+   +D    +V++AGA+     L+      +Q E T  ++ + A   +    ++  G+
Sbjct  362  NLAASSDRNKALVLEAGAVQKCKQLVLEVPVTVQSEMTAAIA-VLALSDELKTNLLELGV  420

Query  379  VPFLVSVLSKADFKTQKEAVWAVTNYTS  406
               L+ +      + Q  +  A+ N +S
Sbjct  421  FEVLIPLTKSPSIEVQGNSAAALGNLSS  448


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 114/244 (47%), Gaps = 13/244 (5%)

Query  206  VDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
            ++P+L LL   D+        R  +  L NL  N +    I  +  + P L+R +   + 
Sbjct  89   LEPILFLLQNSDIE-----VQRAASAALGNLAVNTDNKVLIVQLGGLAP-LIRQMMSPNV  142

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            EV  +    I+ L    + +   + ++G +  L +L  + ++ +   A  A+ N+ T +D
Sbjct  143  EVQCNAVGCITNLATHEDNK-AKIARSGALGPLTRLAKSRDMRVQRNATGALLNM-THSD  200

Query  326  EQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPFLV  383
            E  Q +++AGA+ V   LL++   ++Q   T  +SNI   A  + ++ Q     LV  LV
Sbjct  201  ENRQQLVNAGAIPVLVQLLSSTDVDVQYYCTTALSNIAVDANNRRKLAQ-TEPRLVQSLV  259

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDA  443
            +++  +  K Q +A  A+ N  S    +  + +V    + PL+ LL +    +IL  +  
Sbjct  260  NLMDSSSPKVQCQAALALRNLASDEKYQ--LEIVRASGLGPLLRLLQSSYLPLILSAVAC  317

Query  444  ISNI  447
            I NI
Sbjct  318  IRNI  321


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 143/328 (44%), Gaps = 21/328 (6%)

Query  152  SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSVFRDLVIKYGAVDPL  209
            +E+    VD   +   + LL +    +   A  ALGN+A   D  V   L+++ G + PL
Sbjct  77   TERDVRAVDRDTLEPILFLLQNSDIEVQRAASAALGNLAVNTDNKV---LIVQLGGLAPL  133

Query  210  LALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA  269
            +  +  P++  + C    N    ++NL  +++    I A    L  L RL    D  V  
Sbjct  134  IRQMMSPNV-EVQC----NAVGCITNLATHEDNKAKI-ARSGALGPLTRLAKSRDMRVQR  187

Query  270  DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ  329
            +   A+  +T     R   +V  G +P LV+LL ++++ +      A+ NI    + + +
Sbjct  188  NATGALLNMTHSDENR-QQLVNAGAIPVLVQLLSSTDVDVQYYCTTALSNIAVDANNRRK  246

Query  330  VV-IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK  388
            +   +   +    +L+ +    +Q +A   + N+ +  + Q++ V   GL P L  +L  
Sbjct  247  LAQTEPRLVQSLVNLMDSSSPKVQCQAALALRNLASDEKYQLEIVRASGLGPLL-RLLQS  305

Query  389  ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIF  448
            +       AV  + N +     E  +  +  G ++PL++LL + D + I     AIS + 
Sbjct  306  SYLPLILSAVACIRNISIHPMNESPI--IEAGFLKPLVDLLGSTDNEEIQC--HAISTLR  361

Query  449  QAAEKLGETEKLSIMIEECGGLDKIEAL  476
              A     +++   ++ E G + K + L
Sbjct  362  NLA---ASSDRNKALVLEAGAVQKCKQL  386


 Score = 38.9 bits (89),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 78/192 (41%), Gaps = 12/192 (6%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            II AG +   V  LG TD   IQ  +   L N+A+ +      V++ GA+     L+   
Sbjct  331  IIEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKALVLEAGAVQKCKQLVLEV  390

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM-----SSLACGYLRNL  229
               +  +   A+  +A    +  +L ++ G  + L+ L   P +     S+ A G L + 
Sbjct  391  PVTVQSEMTAAIAVLALSDELKTNL-LELGVFEVLIPLTKSPSIEVQGNSAAALGNLSSK  449

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER-IGM  288
                S    N N   P D +   L    R L   D        W +  L +  +++ IG+
Sbjct  450  VGDYSVFIHNWN--EPSDGIHGYLS---RFLASGDATFQHIAIWTLLQLLESEDKKLIGL  504

Query  289  VVKTGVVPQLVK  300
            + K+  +  +++
Sbjct  505  IGKSNDIVDMIR  516


> sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica 
(strain CLIB 122 / E 150) OX=284591 GN=VAC8 PE=3 SV=1
Length=573

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 160/368 (43%), Gaps = 34/368 (9%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDCSPIQFE  139
            +++ + S NVE Q  A      L + E       I R+G L+P  ++ L ++    +Q  
Sbjct  154  LIRQMMSPNVEVQCNAVGCITNLATHEANK--SKIARSGALLP--LTKLAKSKDMRVQRN  209

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +  AL N+ + + +  + +V+ GAIP  +SLL+S    +   +  AL NIA D S  +  
Sbjct  210  ATGALLNM-THSDQNRQELVNAGAIPILVSLLSSRDPDVQYYSTTALSNIAVDESNRK--  266

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
              K  + +P L    +  M S +          L NL  + +    I      LP L  L
Sbjct  267  --KLSSSEPRLVEHLIKLMDSGSPRVQCQAALALRNLASDSDYQLEIVKANG-LPHLFNL  323

Query  260  LHH-DDPEVLADTCW----AISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPA  313
                  P VLA        +I  L + P      +++ G +  LV+LLGAS+   I    
Sbjct  324  FQSTHTPLVLAAVACIRNISIHPLNETP------IIEAGFLKTLVELLGASDNEEIQCHT  377

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ-Q  372
            +  + N+   ++     +++AGA+     L+ +    +Q E T  ++ +  G  D+++  
Sbjct  378  ISTLRNLAASSERNKLEIVEAGAVQKCKELVLDAPRLVQSEMTACLAVLALG--DELKGT  435

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG-GTVEQIVYLVH-----CGIIEPLM  426
            ++  G+   L+ +    + + Q  +  A+ N +S  G  +  V   H      GI E L+
Sbjct  436  LLELGIAEVLIPLTLSDNIEVQGNSAAALGNLSSKVGNYDTFVN--HWNEPSGGIREFLI  493

Query  427  NLLTAKDT  434
              LT+ D+
Sbjct  494  RFLTSGDS  501


 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 147/327 (45%), Gaps = 23/327 (7%)

Query  70   NQGTVNWSVDDIVKGIN----SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV  125
            N+G V++  +  ++ ++    S N++ Q  A  A  ++  ++ +P    + R  L P  +
Sbjct  60   NRGEVDFFSNGPLRALSTLVYSDNIDLQRSAALAFAEITEKDIRP----VNRDCLEPVLL  115

Query  126  SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA  185
              L  TD   IQ  ++ AL N+A   +E    +V+ G     I  + SP+  +   AV  
Sbjct  116  -LLQNTD-PDIQRAASAALGNLAV-NNENKVLIVEMGGFEPLIRQMMSPNVEVQCNAVGC  172

Query  186  LGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR-NKNPAP  244
            + N+A      +  + + GA+ PL  L    DM        RN T  L N+   ++N   
Sbjct  173  ITNLATH-EANKSKIARSGALLPLTKLAKSKDMR-----VQRNATGALLNMTHSDQNRQE  226

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT-DGPNERIGMVVKTGVVPQLVKLLG  303
             ++A    +P LV LL   DP+V   +  A+S +  D  N +     +  +V  L+KL+ 
Sbjct  227  LVNA--GAIPILVSLLSSRDPDVQYYSTTALSNIAVDESNRKKLSSSEPRLVEHLIKLMD  284

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
            +    +   A  A+ N+ + +D Q ++V   G   +F +L  +  T +   A   + NI+
Sbjct  285  SGSPRVQCQAALALRNLASDSDYQLEIVKANGLPHLF-NLFQSTHTPLVLAAVACIRNIS  343

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKAD  390
                ++   ++  G +  LV +L  +D
Sbjct  344  IHPLNET-PIIEAGFLKTLVELLGASD  369


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/254 (23%), Positives = 114/254 (45%), Gaps = 13/254 (5%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            L+R +   + EV  +    I+ L      +   + ++G +  L KL  + ++ +   A  
Sbjct  154  LIRQMMSPNVEVQCNAVGCITNLATHEANK-SKIARSGALLPLTKLAKSKDMRVQRNATG  212

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
            A+ N+ T +D+  Q +++AGA+ +  SLL++   ++Q  +T  +SNI     ++ +   +
Sbjct  213  ALLNM-THSDQNRQELVNAGAIPILVSLLSSRDPDVQYYSTTALSNIAVDESNRKKLSSS  271

Query  376  H-GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
               LV  L+ ++     + Q +A  A+ N  S    +  + +V    +  L NL  +  T
Sbjct  272  EPRLVEHLIKLMDSGSPRVQCQAALALRNLASDSDYQ--LEIVKANGLPHLFNLFQSTHT  329

Query  435  KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK-IEALQNHENESVYKASLSLIE  493
             ++L  +  I NI  +   L ET      I E G L   +E L   +NE +   ++S + 
Sbjct  330  PLVLAAVACIRNI--SIHPLNETP-----IIEAGFLKTLVELLGASDNEEIQCHTISTLR  382

Query  494  KYFSVEEEEDQNVV  507
               +  E     +V
Sbjct  383  NLAASSERNKLEIV  396


> sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis 
thaliana OX=3702 GN=PUB13 PE=1 SV=1
Length=660

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 110/263 (42%), Gaps = 40/263 (15%)

Query  48   LKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSRE  107
            L+ R VSSF    +SP + N+         ++D++  +   N E+Q  A    R L  R 
Sbjct  337  LRPRKVSSF----SSPAEANK---------IEDLMWRLAYGNPEDQRSAAGEIRLLAKRN  383

Query  108  KQPPIDN---IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGA  163
                 DN   I  AG IP  V  L   D S IQ  S  AL N++    E  K A+V  GA
Sbjct  384  A----DNRVAIAEAGAIPLLVGLLSTPD-SRIQEHSVTALLNLS--ICENNKGAIVSAGA  436

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD---LVIKYGAVDPLLALLAVPDMSS  220
            IP  + +L        E A   L ++    SV  +    +   GA+ PL+ LL       
Sbjct  437  IPGIVQVLKKGSMEARENAAATLFSL----SVIDENKVTIGALGAIPPLVVLLNEGTQRG  492

Query  221  LACGYLRNLTWTLSNLC-RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                  ++    L NLC    N    I A   ++PTL RLL      ++ +    ++ L+
Sbjct  493  -----KKDAATALFNLCIYQGNKGKAIRA--GVIPTLTRLLTEPGSGMVDEALAILAILS  545

Query  280  DGPNERIGMVVKTGVVPQLVKLL  302
              P E   ++  +  VP LV+ +
Sbjct  546  SHP-EGKAIIGSSDAVPSLVEFI  567


> sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum 
(strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 
1970) OX=306901 GN=VAC8 PE=3 SV=3
Length=560

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/162 (27%), Positives = 74/162 (46%), Gaps = 7/162 (4%)

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL  S++ +   A  A+GN+   TD +  +++  G L      + +P   +Q  A   ++
Sbjct  95   LLENSDIEVQRAASAALGNLAVNTDNKV-LIVQLGGLQPLIKQMMSPNVEVQCNAVGCIT  153

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            N+ A  ++   ++   G +  L  +    D + Q+ A  A+ N T      Q   LV+ G
Sbjct  154  NL-ATHEENKAKIARSGALGPLTRLAKSKDMRVQRNATGALLNMTHSDENRQ--QLVNAG  210

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAA---EKLGETEK  459
             I  L+ LL++ D  +      A+SNI   A    KL ETE+
Sbjct  211  AIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLAETEQ  252


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 149/368 (40%), Gaps = 57/368 (15%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            ++K + S NVE Q  A      L + E+      I R+G +    + L ++    +Q  +
Sbjct  133  LIKQMMSPNVEVQCNAVGCITNLATHEENKA--KIARSGALGPL-TRLAKSKDMRVQRNA  189

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ + + E  + +V+ GAIP  + LL+S    +      AL NIA D +  R L 
Sbjct  190  TGALLNM-THSDENRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLA  248

Query  201  -IKYGAVDPLLALL--AVPDMSSLACGYLRNLT---------------------------  230
              +   V  L+ L   + P +   A   LRNL                            
Sbjct  249  ETEQRLVQYLVNLTESSSPKVQCQAALALRNLASDEKYQLEIVQAHGLGPLLRLLRSSYL  308

Query  231  -WTLSNLC--RN-----KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD--  280
               LS +   RN     +N +P I+A    L  LV LL   D E +   C AIS L +  
Sbjct  309  PLILSAVACIRNISIHPQNESPIIEA--GFLKPLVDLLGSTDNEEI--QCHAISTLRNLA  364

Query  281  -GPNERIGMVVKTGVVPQLVKLLGASELPI-VTPALRAIGNIVTGTDEQTQVVIDAGALA  338
               +    +V++ G V +  +L+   E+P+ V   + A   ++  +DE    +++ G   
Sbjct  365  ASSDRNKSLVLEAGAVQKCKQLV--LEVPVTVQSEMTAAIAVLALSDELKTHLLELGVFD  422

Query  339  VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN-----HGLVPFLVSVLSKADFKT  393
            V   L  +P   +Q  +   + N+++   D    V N      G+  +L   L+  D   
Sbjct  423  VLIPLTMSPSVEVQGNSAAALGNLSSKVGDYSIFVQNWMEPRDGIHGYLNRFLASGDATF  482

Query  394  QKEAVWAV  401
            Q  A+W +
Sbjct  483  QHIAIWTL  490


 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 68/138 (49%), Gaps = 4/138 (3%)

Query  272  CWAISYLTD--GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ  329
            C A+  +T+     E    + ++G +  L +L  + ++ +   A  A+ N+ T +DE  Q
Sbjct  146  CNAVGCITNLATHEENKAKIARSGALGPLTRLAKSKDMRVQRNATGALLNM-THSDENRQ  204

Query  330  VVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSK  388
             +++AGA+ V   LL++   ++Q   T  +SNI     ++ +       LV +LV++   
Sbjct  205  QLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLAETEQRLVQYLVNLTES  264

Query  389  ADFKTQKEAVWAVTNYTS  406
            +  K Q +A  A+ N  S
Sbjct  265  SSPKVQCQAALALRNLAS  282


 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 98/228 (43%), Gaps = 13/228 (6%)

Query  152  SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSVFRDLVIKYGAVDPL  209
            +E+    VD   +   + LL +    +   A  ALGN+A   D  V   L+++ G + PL
Sbjct  77   TERDVRAVDRDTLGPILFLLENSDIEVQRAASAALGNLAVNTDNKV---LIVQLGGLQPL  133

Query  210  LALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA  269
            +  +  P++  + C    N    ++NL  ++     I A    L  L RL    D  V  
Sbjct  134  IKQMMSPNV-EVQC----NAVGCITNLATHEENKAKI-ARSGALGPLTRLAKSKDMRVQR  187

Query  270  DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ  329
            +   A+  +T     R   +V  G +P LV+LL +S++ +      A+ NI    + + +
Sbjct  188  NATGALLNMTHSDENR-QQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRK  246

Query  330  VVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNH  376
            +      L  +   LT   +  +Q +A   + N+ +  + Q++ V  H
Sbjct  247  LAETEQRLVQYLVNLTESSSPKVQCQAALALRNLASDEKYQLEIVQAH  294


 Score = 38.9 bits (89),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 44/192 (23%), Positives = 77/192 (40%), Gaps = 12/192 (6%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            II AG +   V  LG TD   IQ  +   L N+A+ +      V++ GA+     L+   
Sbjct  331  IIEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKSLVLEAGAVQKCKQLVLEV  390

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM-----SSLACGYLRNL  229
               +  +   A+  +A      +  +++ G  D L+ L   P +     S+ A G L + 
Sbjct  391  PVTVQSEMTAAIAVLALSDE-LKTHLLELGVFDVLIPLTMSPSVEVQGNSAAALGNLSSK  449

Query  230  TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER-IGM  288
                S     +N   P D +   L    R L   D        W +  L +  +++ IG+
Sbjct  450  VGDYSIFV--QNWMEPRDGIHGYLN---RFLASGDATFQHIAIWTLLQLLESEDKKLIGL  504

Query  289  VVKTGVVPQLVK  300
            + K+  V  ++K
Sbjct  505  IGKSDGVVDMIK  516


> sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis 
thaliana OX=3702 GN=UPL3 PE=1 SV=1
Length=1888

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/237 (25%), Positives = 103/237 (43%), Gaps = 14/237 (6%)

Query  74   VNWSVDDIVKGINSSNVEN-QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD  132
            +N  +  I+ G+ +   E  Q++A     ++LS   +  +        +P  V  L    
Sbjct  191  LNGRMKKILSGLRAEGEEGKQVEALTQLCEMLSIGTEDSLSTFSVDSFVPVLVGLLNHES  250

Query  133  CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS-LLASPHAHISEQAVWALGNIAG  191
               I   +A ALT++         AVV  GA+   ++ LL   +  ++EQ++ AL  I+ 
Sbjct  251  NPDIMLLAARALTHLCDVLPSSCAAVVHYGAVSCLVARLLTIEYMDLAEQSLQALKKISQ  310

Query  192  DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ  251
            +        ++ GA   L+A+L+  D    + G  R    T +N+C+ K P+   D V +
Sbjct  311  EHPT---ACLRAGA---LMAVLSYLDF--FSTGVQRVALSTAANMCK-KLPSDASDYVME  361

Query  252  ILPTLVRLLHHDDPEVL--ADTCWAISYLTDGPN-ERIGMVVKTGVVPQLVKLLGAS  305
             +P L  LL + D +VL  A  C         P  E++  +   G+V Q   L+  S
Sbjct  362  AVPLLTNLLQYHDSKVLEYASICLTRIAEAFAPYPEKLDELCNHGLVTQAASLISTS  418


> sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus OX=10116 
GN=Ctnnb1 PE=1 SV=1
Length=781

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 130/313 (42%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L      P ++  +   ++N  WTL 
Sbjct  332  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-----GPHLTDPSQRLVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SMGGTQQQFV  561


 Score = 39.7 bits (91),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 122/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPA-PPIDAVEQILPTLV  257
                LA G                L WT S      ++C +  PA      ++ + P L 
Sbjct  312  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGPHLT  371

Query  258  RLLHHDDPEVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
                 D  + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  372  -----DPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  423

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q 
Sbjct  424  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  483

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  484  AVRLHYGLPVVVKLL  498


> sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus OX=10090 
GN=Ctnnb1 PE=1 SV=1
Length=781

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 128/313 (41%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L  P         ++N  WTL 
Sbjct  332  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SMGGTQQQFV  561


 Score = 41.6 bits (96),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 122/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA       Q L     
Sbjct  312  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG----  367

Query  259  LLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             LH  DP + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  368  -LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  423

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q 
Sbjct  424  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  483

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  484  AVRLHYGLPVVVKLL  498


> sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 
GN=CTNNB1 PE=1 SV=1
Length=781

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 128/313 (41%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L  P         ++N  WTL 
Sbjct  332  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SMGGTQQQFV  561


 Score = 41.2 bits (95),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 122/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA       Q L     
Sbjct  312  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG----  367

Query  259  LLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             LH  DP + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  368  -LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  423

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q 
Sbjct  424  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  483

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  484  AVRLHYGLPVVVKLL  498


> sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris 
OX=9615 GN=CTNNB1 PE=1 SV=1
Length=781

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 128/313 (41%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L  P         ++N  WTL 
Sbjct  332  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SMGGTQQQFV  561


 Score = 41.2 bits (95),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 122/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA       Q L     
Sbjct  312  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG----  367

Query  259  LLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             LH  DP + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  368  -LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  423

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q 
Sbjct  424  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  483

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  484  AVRLHYGLPVVVKLL  498


> sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=CTNNB1 
PE=1 SV=1
Length=781

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 128/313 (41%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L  P         ++N  WTL 
Sbjct  332  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SMGGTQQQFV  561


 Score = 41.2 bits (95),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 122/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA       Q L     
Sbjct  312  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG----  367

Query  259  LLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             LH  DP + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  368  -LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  423

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q 
Sbjct  424  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  483

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  484  AVRLHYGLPVVVKLL  498


> sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo 
sapiens OX=9606 GN=ARMC4 PE=1 SV=1
Length=1044

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 113/284 (40%), Gaps = 13/284 (5%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            I   +  L S +  + E    A+   A D    RDLV  +G + PL +LL   D      
Sbjct  675  IENLVKNLNSENEQLQEHCAMAIYQCAEDKET-RDLVRLHGGLKPLASLLNNTDNKE-RL  732

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
              +    W  S    N        A+E    TLV LL     EVL +   A+        
Sbjct  733  AAVTGAIWKCSISKENVTKFREYKAIE----TLVGLLTDQPEEVLVNVVGALGECCQERE  788

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPS  342
             R+ +V K G +  LV LL      ++    +A+G      + ++ ++ID    + +  S
Sbjct  789  NRV-IVRKCGGIQPLVNLLVGINQALLVNVTKAVG--ACAVEPESMMIIDRLDGVRLLWS  845

Query  343  LLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH-GLVPFLVSVLSKADFKTQKEAVWAV  401
            LL NP  +++  A W +       +D  + V +  G +  +V++L   + +       A+
Sbjct  846  LLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAI  905

Query  402  TNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAIS  445
            TN       E +  +   G++  L  L    + K+   + +AIS
Sbjct  906  TNIAKDQ--ENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAIS  947


 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 119/311 (38%), Gaps = 44/311 (14%)

Query  158  VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV--  215
            +VD G +P  +++L SPH  +   A   + N+A      R +V ++G +  L+ALL    
Sbjct  531  IVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRA-RRVVRQHGGITKLVALLDCAH  589

Query  216  ----PDMSSL---------ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHH  262
                P  SSL          CG L    W+ S    NK        +    P L RLL  
Sbjct  590  DSTKPAQSSLYEARDVEVARCGAL--ALWSCSKSHTNKEAIRKAGGI----PLLARLLKT  643

Query  263  DDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVT  322
                +L      +       N R  +  +  ++  LVK L +    +      AI     
Sbjct  644  SHENMLIPVVGTLQECASEENYRAAIKAER-IIENLVKNLNSENEQLQEHCAMAIYQ--C  700

Query  323  GTDEQTQVVID-AGALAVFPSLLTNPKTNIQKEAT----WTMS----NITAGRQDQIQQV  373
              D++T+ ++   G L    SLL N     +  A     W  S    N+T  R+      
Sbjct  701  AEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFRE------  754

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
              +  +  LV +L+    +     V A+         E  V +  CG I+PL+NLL   +
Sbjct  755  --YKAIETLVGLLTDQPEEVLVNVVGALGECCQ--ERENRVIVRKCGGIQPLVNLLVGIN  810

Query  434  TKIILVILDAI  444
              +++ +  A+
Sbjct  811  QALLVNVTKAV  821


 Score = 37.0 bits (84),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 83/200 (42%), Gaps = 19/200 (10%)

Query  169   SLLASPHAHISEQAVWAL----GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA--  222
             SLL +PH  +   A WAL     N    G + R  V   G ++ ++ LL   +   LA  
Sbjct  845   SLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFV---GGLELIVNLLKSDNKEVLASV  901

Query  223   CGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGP  282
             C  + N+     NL         +     ++P L +L + ++ ++      AIS      
Sbjct  902   CAAITNIAKDQENL--------AVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWG  953

Query  283   NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS  342
               R+       V P LV+ L +++  +     +A+  +    D     + + GA+ +   
Sbjct  954   RNRVAFGEHKAVAP-LVRYLKSNDTNVHRATAQALYQLSEDAD-NCITMHENGAVKLLLD  1011

Query  343   LLTNPKTNIQKEATWTMSNI  362
             ++ +P  ++Q+ A   +SNI
Sbjct  1012  MVGSPDQDLQEAAAGCISNI  1031


> sp|F1QGH7|CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=ctnnb1 
PE=1 SV=1
Length=780

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 128/313 (41%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  275  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  330

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L  P         ++N  WTL 
Sbjct  331  TYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR-----LVQNCLWTLR  385

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  386  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  442

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   +    Q  V +  G L V   LL  P 
Sbjct  443  IEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYG-LPVVVKLLHPP-  500

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  501  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  550

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  551  ---SMGGTQQQFV  560


 Score = 43.9 bits (102),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 123/315 (39%), Gaps = 58/315 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A   +      S   +   A+   G IPA + +L SP    
Sbjct  191  PQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  250

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  251  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  310

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA       Q L     
Sbjct  311  KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG----  366

Query  259  LLHHDDP-EVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             LH  DP + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   
Sbjct  367  -LHLTDPSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGI  422

Query  317  IGNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQD--QIQQ  372
            + N+     +   +V   G +   V   L    + +I + A   + ++T+  QD    Q 
Sbjct  423  LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQN  482

Query  373  VVN-HGLVPFLVSVL  386
             V  H  +P +V +L
Sbjct  483  AVRLHYGLPVVVKLL  497


> sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus 
musculus OX=10090 GN=Armc4 PE=1 SV=1
Length=1037

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 67/320 (21%), Positives = 132/320 (41%), Gaps = 54/320 (17%)

Query  156  KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV  215
            + +VD G +P  +++L SPH  +   +   + N+A      R  V ++G +  L+AL   
Sbjct  522  RNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRA-RRAVRQHGGITKLVAL---  577

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
                 L CG               +N   P        P+L     ++  +V    C A+
Sbjct  578  -----LDCG---------------QNSTEPTQ------PSL-----YETRDVEVARCGAL  606

Query  276  S-YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
            + +     +     + K G +P L +LL  S   ++ P +  +      ++E  +  I A
Sbjct  607  ALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQE--CASEENYRAAIKA  664

Query  335  GALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVN-HGLVPFLVSVLSKADFK  392
                +  +L+ N  + N Q +    M+       ++ + +V  HG +  L S+L+  D  
Sbjct  665  E--RIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTD--  720

Query  393  TQKEAVWAVTN--YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
              KE + AVT   +    + E ++       IE L+ LLT +  ++++ ++ A+    Q 
Sbjct  721  -NKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQE  779

Query  451  AEKLGETEKLSIMIEECGGL  470
             E         +++ +CGG+
Sbjct  780  YEN-------RVLVRKCGGI  792


 Score = 43.5 bits (101),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 70/333 (21%), Positives = 122/333 (37%), Gaps = 56/333 (17%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            I   +  L S +  + E    A+   A D    RDLV  +G + PL +LL   D      
Sbjct  668  IENLVKNLNSENEQLQEHCAMAIYQCAEDEET-RDLVRLHGGLKPLASLLNNTDNKERLA  726

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
              +    W  S    N        A+E    TLV LL     EVL +   A+        
Sbjct  727  A-VTGAIWKCSISKENVIKFREYKAIE----TLVGLLTDQPEEVLVNVVGALGECCQEYE  781

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPS  342
             R+ +V K G +  LV LL      ++    +A+G      + ++  +ID    + +  S
Sbjct  782  NRV-LVRKCGGIQPLVNLLVGINQALLVNVTKAVG--ACAVEPESMAIIDRLDGVRLLWS  838

Query  343  LLTNPKTNIQKEATWTM-------------------------------------------  359
            LL NP  +++  A W +                                           
Sbjct  839  LLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAI  898

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            +NI A  Q+ +  + +HG+VP L  + +  + K ++    A++     G   ++ +  H 
Sbjct  899  TNI-AKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGR-NRVAFGEH-  955

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAE  452
              + PL+  L + DT +      A+  + + A+
Sbjct  956  KAVAPLVRYLKSNDTNVHRATAQALYQLSEDAD  988


 Score = 37.7 bits (86),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 91/222 (41%), Gaps = 20/222 (9%)

Query  148   ASGTSEQTKAVVDG-GAIPAFISLLASPHAHISEQAVWALG----NIAGDGSVFRDLVIK  202
             A     ++ A++D    +    SLL +PH  +   A WAL     N    G + R  V  
Sbjct  816   ACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFV--  873

Query  203   YGAVDPLLALLAVPDMSSLA--CGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
              G ++ ++ LL   +   LA  C  + N+     NL         +     ++P L +L 
Sbjct  874   -GGLELVVNLLKSDNKEVLASVCAAITNIAKDQENL--------AVITDHGVVPLLSKLA  924

Query  261   HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI  320
             + ++ ++      AIS        R+       V P LV+ L +++  +     +A+  +
Sbjct  925   NTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAP-LVRYLKSNDTNVHRATAQALYQL  983

Query  321   VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
                 D     + + GA+ +   ++ +P  ++Q+ A   +SNI
Sbjct  984   SEDAD-NCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNI  1024


> sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum 
OX=44689 GN=aarA PE=2 SV=1
Length=757

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/145 (26%), Positives = 66/145 (46%), Gaps = 12/145 (8%)

Query  136  IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP-HAHISEQAVWALGNIAGDGS  194
            +Q+ +++ L N+A     +++  ++GG      ++   P H  I  Q   AL N+  + S
Sbjct  524  VQYNTSFVLRNLARNDVSESRVAIEGGIQSIATAMKNHPNHIGIQTQGCGALRNLGCNDS  583

Query  195  VFRDLVIKYGAVDPLL----ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE  250
              + L  K G +  +L    +  + PD+    CG LRNL         NKN     + ++
Sbjct  584  N-KVLSAKEGGIGLILRAMRSFSSHPDLQLNGCGALRNLARNED----NKNMISRQNGIQ  638

Query  251  QILPTLVRLLHHDDPEVLADTCWAI  275
             +L  +    H DDP+V  + C A+
Sbjct  639  LVLGAMSN--HPDDPDVQDEGCAAL  661


> sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabidopsis 
thaliana OX=3702 GN=PUB7 PE=2 SV=1
Length=782

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 104/231 (45%), Gaps = 17/231 (7%)

Query  162  GAIPAFISLLASP----HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            G + A +  L S     +A   +    AL N+A + +  ++L++  G +  L  +++  +
Sbjct  466  GFVEALLRFLGSAVDDNNAAAQDSGAMALFNLAVNNNRNKELMLTSGVIRLLEKMISSAE  525

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAIS  276
                A     NL+          + A  +    Q +P LV+LL  + + +   D   A+ 
Sbjct  526  SHGSATALYLNLSCL--------DEAKSVIGSSQAVPFLVQLLQKEIETQCKLDALHALY  577

Query  277  YL-TDGPNERIGMVVKTGVVPQLVKLLGAS-ELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
             L T  PN  I  ++ + ++  L  LL ++ E   +  +L  + N+ +  + + + V   
Sbjct  578  NLSTYSPN--IPALLSSNIIKSLQGLLASTGENLWIEKSLAVLLNLASSQEGKDEAVSSQ  635

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV  385
            G ++   ++L    T  Q++A   +  +  GR+  IQ V+  G++P LVS+
Sbjct  636  GMISSLATVLDMGDTTEQEQAVSCLLILCNGRESCIQMVLQEGVIPSLVSI  686


> sp|P26233|CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 
GN=ctnnb1 PE=1 SV=1
Length=781

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 78/313 (25%), Positives = 130/313 (42%), Gaps = 43/313 (14%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V+ L +T+   +   +   L  +A G  E    ++  G   A ++++ +   +
Sbjct  276  AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---Y  331

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G +  L   L + D S      ++N  WTL 
Sbjct  332  SYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--LHLTDSSQR---LVQNCLWTLR  386

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A   + +E +L TLV+LL  DD  V+      +S LT    +   MV + G 
Sbjct  387  NL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG  443

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPK  348
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  444  IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-  501

Query  349  TNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV  401
                  + W +   T G    +     NH      G +P LV +L +A   TQ+      
Sbjct  502  ------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----  551

Query  402  TNYTSGGTVEQIV  414
               + GGT +Q V
Sbjct  552  ---SIGGTQQQFV  561


 Score = 38.9 bits (89),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 71/314 (23%), Positives = 121/314 (39%), Gaps = 56/314 (18%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASP----  174
            P+ VS + RT  +    E+A          S   +   A+   G IPA + +L SP    
Sbjct  192  PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSV  251

Query  175  -------------HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLAVPDMSS  220
                         H   ++ AV   G +    ++     +K+ A+    L +LA  +  S
Sbjct  252  LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES  311

Query  221  ----LACG------------YLRNLTWTLS------NLCRNKNPAPPIDAVEQILPTLVR  258
                LA G                L WT S      ++C +  PA     VE      + 
Sbjct  312  KLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPA----IVEAGGMQALG  367

Query  259  LLHHDDPEVLADTC-WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
            L   D  + L   C W +  L+D   ++ GM    G++  LV+LLG+ ++ +VT A   +
Sbjct  368  LHLTDSSQRLVQNCLWTLRNLSDAATKQEGM---EGLLGTLVQLLGSDDINVVTCAAGIL  424

Query  318  GNIVTGTDEQTQVVIDAGALA--VFPSLLTNPKTNIQKEATWTMSNITAGRQ--DQIQQV  373
             N+     +   +V   G +   V   L    + +I + A   + ++T+  Q  +  Q  
Sbjct  425  SNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNA  484

Query  374  VN-HGLVPFLVSVL  386
            V  H  +P +V +L
Sbjct  485  VRLHYGLPVVVKLL  498


> sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=vac8 PE=1 SV=4
Length=550

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 105/252 (42%), Gaps = 13/252 (5%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + ++ L  +D   +Q  +A A   I    +E+    VD   I   + LL SP A I   A
Sbjct  50   RALTILAYSDNLDLQRSAALAFAEI----TEKDVREVDRETIEPVLFLLQSPDAEIQRAA  105

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + LV+K   +D L+  +  P +  + C  +  +T  L+ L  NK+ 
Sbjct  106  SVALGNLAVNAE-NKALVVKLNGLDLLIRQMMSPHV-EVQCNAVGCIT-NLATLDENKSK  162

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
                 A    L  L RL    D  V  +   A+  +T     R   +V  G +P LV LL
Sbjct  163  IAHSGA----LGPLTRLAKSKDIRVQRNATGALLNMTHSYENR-QQLVSAGTIPVLVSLL  217

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALA-VFPSLLTNPKTNIQKEATWTMSN  361
             +S+  +      +I NI      + ++      L      L+      +Q +A   + N
Sbjct  218  PSSDTDVQYYCTTSISNIAVDAVHRKRLAQSEPKLVRSLIQLMDTSSPKVQCQAALALRN  277

Query  362  ITAGRQDQIQQV  373
            + +  + QI+ V
Sbjct  278  LASDERYQIEIV  289


 Score = 43.1 bits (100),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 73/337 (22%), Positives = 135/337 (40%), Gaps = 38/337 (11%)

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGAIPAFISLLAS  173
            ++ AG IP  VS L  +D + +Q+    +++NIA     + + A  +   + + I L+ +
Sbjct  204  LVSAGTIPVLVSLLPSSD-TDVQYYCTTSISNIAVDAVHRKRLAQSEPKLVRSLIQLMDT  262

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLV----------IKYGAVDPLLALLAVPDMSSLAC  223
                +  QA  AL N+A D     ++V          +   +  PL+       ++S+AC
Sbjct  263  SSPKVQCQAALALRNLASDERYQIEIVQSNALPSLLRLLRSSYLPLI-------LASVAC  315

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD--G  281
              +RN++          N +P IDA    L  LV LL   + E +   C A+S L +   
Sbjct  316  --IRNISI------HPLNESPIIDA--GFLRPLVDLLSCTENEEI--QCHAVSTLRNLAA  363

Query  282  PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP  341
             +ER    +      Q ++ L       V   + A   ++  +DE    +++ G   V  
Sbjct  364  SSERNKRAIIEANAIQKLRCLILDAPVSVQSEMTACLAVLALSDEFKSYLLNFGICNVLI  423

Query  342  SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV-----NHGLVPFLVSVLSKADFKTQKE  396
             L  +    +Q  +   + N+++   D  + +        G+  +LV  LS  D      
Sbjct  424  PLTDSMSIEVQGNSAAALGNLSSNVDDYSRFIECWDSPAGGIHGYLVRFLSSEDSTFAHI  483

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            A W +      G      ++     I  L+N + A+D
Sbjct  484  AAWTIVQLLEAGVPRLTAFIQSSDDIIELLNDIVARD  520


 Score = 42.4 bits (98),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 79/372 (21%), Positives = 151/372 (41%), Gaps = 36/372 (10%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D +++ + S +VE Q  A      L + ++      I  +G +          D   +Q
Sbjct  128  LDLLIRQMMSPHVEVQCNAVGCITNLATLDENKS--KIAHSGALGPLTRLAKSKDIR-VQ  184

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V  G IP  +SLL S    +      ++ NIA D +V R
Sbjct  185  RNATGALLNM-THSYENRQQLVSAGTIPVLVSLLPSSDTDVQYYCTTSISNIAVD-AVHR  242

Query  198  DLVIKYGAVDPLL--ALLAVPDMSS--LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
                +    +P L  +L+ + D SS  + C         L NL  ++     I     + 
Sbjct  243  K---RLAQSEPKLVRSLIQLMDTSSPKVQC----QAALALRNLASDERYQIEIVQSNALP  295

Query  254  PTLVRLLHHDDPEVLADTCW----AISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LP  308
              L  L     P +LA        +I  L + P      ++  G +  LV LL  +E   
Sbjct  296  SLLRLLRSSYLPLILASVACIRNISIHPLNESP------IIDAGFLRPLVDLLSCTENEE  349

Query  309  IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            I   A+  + N+   ++   + +I+A A+     L+ +   ++Q E T  ++ + A   +
Sbjct  350  IQCHAVSTLRNLAASSERNKRAIIEANAIQKLRCLILDAPVSVQSEMTACLA-VLALSDE  408

Query  369  QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC------GII  422
                ++N G+   L+ +      + Q  +  A+ N +S   V+     + C      GI 
Sbjct  409  FKSYLLNFGICNVLIPLTDSMSIEVQGNSAAALGNLSSN--VDDYSRFIECWDSPAGGIH  466

Query  423  EPLMNLLTAKDT  434
              L+  L+++D+
Sbjct  467  GYLVRFLSSEDS  478


> sp|Q8IUR7|ARMC8_HUMAN Armadillo repeat-containing protein 8 OS=Homo 
sapiens OX=9606 GN=ARMC8 PE=1 SV=2
Length=673

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 63/301 (21%), Positives = 127/301 (42%), Gaps = 27/301 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ S+V+ +L A +    L SR  Q    +     +    +  L       I 
Sbjct  386  MDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPLMKVLQNAP-DEIL  443

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSV  195
              ++  L N+    S   + +++ GA+     L  S +  +    +WAL N+A   +  +
Sbjct  444  VVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKI  503

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV----  249
              D +++  + + L  LL+  D++ L    G LRNL  T           P ID +    
Sbjct  504  KAD-ILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST----------RPHIDKIMSTH  552

Query  250  -EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++ ++   +G S +
Sbjct  553  GKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHV  612

Query  308  PIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             +   A+  I N++     G+ E+   + D G + +   L  +P +N+  +A   +    
Sbjct  613  KLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYL  672

Query  364  A  364
            A
Sbjct  673  A  673


 Score = 41.2 bits (95),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 2/103 (2%)

Query  114  NIIRAGLIPKFVSFLGR-TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            N+I  G +P+ +  L + T  + ++ E A  L ++A GT    K+++D   IPA +  L 
Sbjct  56   NLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLL  115

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLA  214
            SP     E  +  L  I        +L+     V P L+ALL+
Sbjct  116  SPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLS  158


 Score = 33.1 bits (74),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 57/117 (49%), Gaps = 4/117 (3%)

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNITAGRQDQIQQVV  374
            + N V G ++Q   +I  GA+     LL      T ++ E    + ++  G ++ ++ ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAV-TNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            +  ++P L+  L   D K  +  +  + T +TS  T E+++Y     +I  LM LL+
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLY-TDATVIPHLMALLS  158


> sp|Q2KI54|ARMC8_BOVIN Armadillo repeat-containing protein 8 OS=Bos 
taurus OX=9913 GN=ARMC8 PE=2 SV=1
Length=673

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 127/301 (42%), Gaps = 27/301 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ S+V+ +L A +    L SR  Q    +     +    +  L       I 
Sbjct  386  MDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPLMKVLQNAP-DEIL  443

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSV  195
              ++  L N+    S   + +++ GA+     L  S +  +    +WAL N+A   +  +
Sbjct  444  VVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKI  503

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV----  249
              D +++  + + L  LL+  D++ L    G LRNL  T           P ID +    
Sbjct  504  KAD-ILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST----------RPHIDKIMSTH  552

Query  250  -EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++ ++   +G S +
Sbjct  553  GKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKELIMTNDDILQKIKYYMGHSHV  612

Query  308  PIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             +   A+  I N+V     G+ E+   + D G + +   L  +P +N+  +A   +    
Sbjct  613  KLQLAAMFCISNLVWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKTALQQYL  672

Query  364  A  364
            A
Sbjct  673  A  673


 Score = 40.8 bits (94),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 2/103 (2%)

Query  114  NIIRAGLIPKFVSFLGR-TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            N+I  G +P+ +  L + T  + ++ E A  L ++A GT    K+++D   IPA +  L 
Sbjct  56   NLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLL  115

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLA  214
            SP     E  +  L  I        +L+     V P L+ALL+
Sbjct  116  SPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLS  158


 Score = 32.7 bits (73),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 57/117 (49%), Gaps = 4/117 (3%)

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNITAGRQDQIQQVV  374
            + N V G ++Q   +I  GA+     LL      T ++ E    + ++  G ++ ++ ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAV-TNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            +  ++P L+  L   D K  +  +  + T +TS  T E+++Y     +I  LM LL+
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLY-TDATVIPHLMALLS  158


> sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabidopsis 
thaliana OX=3702 GN=PUB6 PE=2 SV=2
Length=771

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 98/230 (43%), Gaps = 16/230 (7%)

Query  162  GAIPAFISLLASP----HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            G + AF+  L S     +A   E    AL N+A + +  ++L++  G +  L  +++   
Sbjct  466  GFVEAFLQFLESAVHDNNAAAQETGAMALFNLAVNNNRNKELMLTSGVIPLLEKMISCSQ  525

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAIS  276
                A     NL+      C  K  A P+    Q +   V LL  D   +   D   A+ 
Sbjct  526  SQGPATALYLNLS------CLEK--AKPVIGSSQAVSFFVNLLLQDTKTQCKLDALHALY  577

Query  277  YL-TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG  335
             L T  PN  I  ++ + ++  L  L        +  +L  + N+ +  + + +++   G
Sbjct  578  NLSTYSPN--IPTLLSSNIIKSLQVLASTGNHLWIEKSLAVLLNLASSREGKEEMITTQG  635

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV  385
             ++   ++L    T  Q++A   +  +  G +  IQ V+  G++P LVS+
Sbjct  636  MISTLATVLDTGDTVEQEQAVSCLVILCTGSESCIQMVLQEGVIPSLVSI  685


> sp|Q5R6S3|ARMC8_PONAB Armadillo repeat-containing protein 8 OS=Pongo 
abelii OX=9601 GN=ARMC8 PE=2 SV=1
Length=673

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 63/301 (21%), Positives = 126/301 (42%), Gaps = 27/301 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ S+V+ +L A +    L SR  Q    +     +    +  L       I 
Sbjct  386  MDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPLMKVLQNAP-DEIL  443

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSV  195
              ++  L N+    S   + +++ GA+     L  S +  +    +WAL N A   +  +
Sbjct  444  VVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNTAFQAEQKI  503

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV----  249
              D +++  + + L  LL+  D++ L    G LRNL  T           P ID +    
Sbjct  504  KAD-ILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST----------RPHIDKIMSTH  552

Query  250  -EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++ ++   +G S +
Sbjct  553  GKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHV  612

Query  308  PIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             +   A+  I N++     G+ E+   + D G + +   L  +P +N+  +A   +    
Sbjct  613  KLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYL  672

Query  364  A  364
            A
Sbjct  673  A  673


 Score = 37.7 bits (86),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (47%), Gaps = 2/103 (2%)

Query  114  NIIRAGLIPKFVSFLGR-TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            N+I  G +P+ +  L + T  + ++ E A  L ++A GT    K+++D   IPA +  L 
Sbjct  56   NLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLL  115

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLA  214
            SP     E  +     I        +L+     V P L+ALL+
Sbjct  116  SPDLKFIEACLRCPRTIFTSPVTPEELLYTDATVIPHLMALLS  158


> sp|Q7Z5J8|ANKAR_HUMAN Ankyrin and armadillo repeat-containing 
protein OS=Homo sapiens OX=9606 GN=ANKAR PE=2 SV=3
Length=1434

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 92/227 (41%), Gaps = 12/227 (5%)

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL  199
            +  +L  I     +  + ++D G IPA I+LL S    +  + V  L NI+   S    L
Sbjct  720  AVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVGLLSNISTHKSAVHAL  779

Query  200  VIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
            V + G +  L+ LL    P++ S     L ++       C NK+     + +    P+L+
Sbjct  780  V-EAGGIPSLINLLVCDEPEVHSRCAVILYDIAQ-----CENKDVIAKYNGI----PSLI  829

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
             LL+ +   VL +    I  L  G       V +   +P L++ L +    +   +  AI
Sbjct  830  NLLNLNIENVLVNVMNCIRVLCIGNENNQRAVREHKGLPYLIRFLSSDSDVLKAVSSAAI  889

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
              +     E    +   GA+    +L    + ++Q +    + ++ +
Sbjct  890  AEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLAS  936


 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/89 (24%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV++L          A+ ++  I    D+  + ++DAG +    +LL + K  +Q +   
Sbjct  705  LVEMLQCESYKRRMMAVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVG  764

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVL  386
             +SNI+   +  +  +V  G +P L+++L
Sbjct  765  LLSNIST-HKSAVHALVEAGGIPSLINLL  792


> sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis 
thaliana OX=3702 GN=PUB4 PE=1 SV=3
Length=826

 Score = 44.3 bits (103),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 16/160 (10%)

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII---R  117
            ++P  E R +   V   V  +V+ + SS+++ Q QAT A  +LL++     +DN I    
Sbjct  526  SAPSNETRRDLSEVETQVKKLVEELKSSSLDTQRQAT-AELRLLAKHN---MDNRIVIGN  581

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            +G I   V  L  TD S  Q  +  AL N+ S      KA+ D GAI   I +L +  + 
Sbjct  582  SGAIVLLVELLYSTD-SATQENAVTALLNL-SINDNNKKAIADAGAIEPLIHVLENGSSE  639

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKY---GAVDPLLALLA  214
              E +   L ++    SV  +  IK    GA+ PL+ LL 
Sbjct  640  AKENSAATLFSL----SVIEENKIKIGQSGAIGPLVDLLG  675


 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query  144  LTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKY  203
            L N+A+   E   A+   G IP  + ++    A   E A  AL  ++ +   F ++V++ 
Sbjct  729  LANLAT-IPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVLQE  787

Query  204  GAVDPLLAL  212
            GAV PL+AL
Sbjct  788  GAVPPLVAL  796


 Score = 33.1 bits (74),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 41/86 (48%), Gaps = 2/86 (2%)

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            L +   + Q++AT  +  +     D    + N G +  LV +L   D  TQ+ AV A+ N
Sbjct  550  LKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDSATQENAVTALLN  609

Query  404  YTSGGTVEQIVYLVHCGIIEPLMNLL  429
             +     ++ +     G IEPL+++L
Sbjct  610  LSINDNNKKAI--ADAGAIEPLIHVL  633


> sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing 
protein OS=Mus musculus OX=10090 GN=Ankar PE=2 SV=1
Length=1465

 Score = 44.3 bits (103),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 51/276 (18%), Positives = 101/276 (37%), Gaps = 51/276 (18%)

Query  156  KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV  215
            + ++D G IPA ++LL SP   +  + V  L NI+   S+   +V   G           
Sbjct  749  QCILDAGTIPALVNLLKSPQIKLQYKTVGLLSNISTHVSIVHAIVEAGG-----------  797

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
                                                 +P ++ LL  D+PE L   C  I
Sbjct  798  -------------------------------------IPAVINLLTSDEPE-LHSRCAII  819

Query  276  SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG  335
             Y      E   ++ K   +P L+ LL  ++  ++   +  I  +  G +   Q + D  
Sbjct  820  LYDV-AKCENKDVIAKYSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNN  878

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK  395
             +      L++    ++  ++ T++ +    ++    +   G +P LV++        Q 
Sbjct  879  GIQYLIQFLSSDSDVLKALSSATIAEVARDNKEVQDAIAKEGAIPPLVTLFKGKQLSVQV  938

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA  431
            +   AV +  +   + Q  +L    + + L+ LL A
Sbjct  939  KGAMAVESLANCNPLIQKEFLER-ELTKDLLKLLQA  973


 Score = 36.2 bits (82),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 67/147 (46%), Gaps = 4/147 (3%)

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV++L          A+ ++  I    D   Q ++DAG +    +LL +P+  +Q +   
Sbjct  718  LVEMLQCESSKRRMMAVMSLEVICLANDRYWQCILDAGTIPALVNLLKSPQIKLQYKTVG  777

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
             +SNI+      +  +V  G +P ++++L+  + +       A+  Y       + V   
Sbjct  778  LLSNIST-HVSIVHAIVEAGGIPAVINLLTSDEPELHSRC--AIILYDVAKCENKDVIAK  834

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAI  444
            + G I  L+NLL+     +++ +++ I
Sbjct  835  YSG-IPALINLLSLNKESVLVNVMNCI  860


> sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo 
sapiens OX=9606 GN=ARMC3 PE=2 SV=2
Length=872

 Score = 44.3 bits (103),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 114/257 (44%), Gaps = 19/257 (7%)

Query  244  PPIDAVEQIL------PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
            PP D  + ++       T+V +L+  + E+LA  C AI        E    +++ G V  
Sbjct  12   PPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEP  71

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEAT  356
            L KLL   E  IV      I  I+   ++  +++ +   + +V   L    +  I + A+
Sbjct  72   LTKLL-THEDKIVRRNATMIFGILASNNDVKKLLRELDVMNSVIAQLAPEEEVVIHEFAS  130

Query  357  WTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL  416
              ++N++A    ++ Q+  HG +  L+ +LS  D   +K ++  + N            L
Sbjct  131  LCLANMSAEYTSKV-QIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCR--AKL  187

Query  417  VHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK-IEA  475
                 I P+++LL ++   I L+ L  +  I  A +K   T     M+ +  GLD  I+ 
Sbjct  188  QELNAIPPILDLLKSEYPVIQLLALKTLGVI--ANDKESRT-----MLRDNQGLDHLIKI  240

Query  476  LQNHENESVYKASLSLI  492
            L+  E   ++  +L++I
Sbjct  241  LETKELNDLHIEALAVI  257


 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 68/142 (48%), Gaps = 3/142 (2%)

Query  295  VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
            +PQL++LL +    +   A  A+ N+ T          +A  +    +LL++ +      
Sbjct  358  IPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIAN  417

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV  414
            A   ++N+ A ++     + NH ++  ++S L  A+   Q +A  AVT   +   VE   
Sbjct  418  AATVLTNM-AMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVT--ATACDVEART  474

Query  415  YLVHCGIIEPLMNLLTAKDTKI  436
             L + G +EPL+ LL +K+ ++
Sbjct  475  ELRNSGGLEPLVELLRSKNDEV  496


> sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes 
aegypti OX=7159 GN=arm PE=3 SV=1
Length=832

 Score = 43.5 bits (101),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 95/402 (24%), Positives = 156/402 (39%), Gaps = 87/402 (22%)

Query  147  IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV  206
            + S  S    A+V+ G + A    L +P   + +  +W L N++       D   K   +
Sbjct  351  VLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLS-------DAATKVDGL  403

Query  207  DPLLA----LLAVPDMSSLAC--GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
            + LL+    +L   D++ + C  G L NLT    N  RNK     +  VE ++ T++   
Sbjct  404  ETLLSGLVTVLGSSDVNVVTCAAGILSNLT---CNNQRNKVTVCQVGGVEALVGTIINA-  459

Query  261  HHDDPEVLADTCWAISYLTDG--PNERIGMVVKTGV-VPQLVKLLGA-SELPIVTPALRA  316
              D  E+      A+ +LT     +E    +V+ G  +P +VKLL   S  P++   +  
Sbjct  460  -GDREEITEPAVCALRHLTSRHPESESAQNIVRNGYGLPVIVKLLNPPSRWPLIKAVIGL  518

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            I N                 LA+ PS                  N    R+        H
Sbjct  519  IRN-----------------LALCPS------------------NAAPLRE--------H  535

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTN-------YTSGGTVEQIVY----LVHCGIIEPL  425
            G +  LV +L KA   TQ++     TN       Y  G  +E+IV      +H    E L
Sbjct  536  GAIHLLVRLLFKAFQDTQRQRSSVATNGSQPPGAYADGVRMEEIVEGTVGALHILSKEEL  595

Query  426  MNLLTAKDTKII----LVILDAISNIFQAAE----KLGETEKLSIMIEECGGLDKIEALQ  477
               L  +   I     L+  + I NI + A     +L   ++++ MIE  G    +  L 
Sbjct  596  NRQLIRQQNVISIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGATAPLTELL  655

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQV  519
            N  NE V   + +++   F + E++  +     +SE  T  V
Sbjct  656  NSANEGVATYAAAVL---FKMSEDKSMDYKKRFSSELTTLPV  694


 Score = 35.0 bits (79),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 88/208 (42%), Gaps = 12/208 (6%)

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            + K G +  L+ LL+ P  S L          TL NL  +++ +     +   L  +V L
Sbjct  236  IFKSGGIPALVKLLSSPVESVLFYA-----ITTLHNLLLHQDGSKMAVRLAGGLQKMVAL  290

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L  ++ + LA     +  L  G  E   +++ +    +LV+++ + +   +      +  
Sbjct  291  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLK  350

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHG  377
            +++        +++AG +      L NP   + +   WT+ N++  A + D ++      
Sbjct  351  VLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLET-----  405

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYT  405
            L+  LV+VL  +D      A   ++N T
Sbjct  406  LLSGLVTVLGSSDVNVVTCAAGILSNLT  433


> sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus 
musculus OX=10090 GN=Armc3 PE=1 SV=1
Length=881

 Score = 43.5 bits (101),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 109/256 (43%), Gaps = 17/256 (7%)

Query  244  PPIDAVEQIL------PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
            PP D  + I        T+V +L   + ++LA  C AI        E    +++ G V  
Sbjct  12   PPKDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEP  71

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            L KLL   +  +   A+   G + + +D +  +       +V   L    +  I + A+ 
Sbjct  72   LTKLLTHEDKTVRRNAMMIFGILASNSDVKKLLRELEVMNSVIAQLSPEEEVVIHEFASL  131

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
             ++N++     ++ Q+  HG +  L+ +LS +D   +K ++  + N            L 
Sbjct  132  CLANMSVEYTGKV-QIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDFQCR--TTLQ  188

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EAL  476
                I P++ LL ++   I L+ L  +  I    +K   T     M++E  GLD + + L
Sbjct  189  ELNAIPPILELLRSEYPIIQLLALKTLGVI--TCDKEART-----MLKENQGLDHLTKIL  241

Query  477  QNHENESVYKASLSLI  492
            +  E   ++  +LS+I
Sbjct  242  ETKELNDLHVEALSVI  257


> sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus 
norvegicus OX=10116 GN=Trip12 PE=1 SV=1
Length=2025

 Score = 43.1 bits (100),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 55/242 (23%), Positives = 97/242 (40%), Gaps = 15/242 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I   +
Sbjct  448  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  507

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVFRDL  199
              ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + +
Sbjct  508  CRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS--KAI  563

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            +   G  D LL L         +    RN     +N C++  P      V   LP L + 
Sbjct  564  LQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSITPD-EFHFVADSLPLLTQR  616

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L H D + +  TC   + L D       ++ +      L  +    +L +VTP + + G 
Sbjct  617  LTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNV---QQLLVVTPPILSSGM  673

Query  320  IV  321
             +
Sbjct  674  FI  675


> sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus 
musculus OX=10090 GN=Trip12 PE=1 SV=1
Length=2025

 Score = 43.1 bits (100),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 55/242 (23%), Positives = 97/242 (40%), Gaps = 15/242 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I   +
Sbjct  448  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  507

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVFRDL  199
              ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + +
Sbjct  508  CRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS--KAI  563

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            +   G  D LL L         +    RN     +N C++  P      V   LP L + 
Sbjct  564  LQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSITPD-EFHFVADSLPLLTQR  616

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L H D + +  TC   + L D       ++ +      L  +    +L +VTP + + G 
Sbjct  617  LTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNV---QQLLVVTPPILSSGM  673

Query  320  IV  321
             +
Sbjct  674  FI  675


> sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos 
taurus OX=9913 GN=TRIP12 PE=2 SV=2
Length=1992

 Score = 42.7 bits (99),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 55/242 (23%), Positives = 97/242 (40%), Gaps = 15/242 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I   +
Sbjct  442  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  501

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVFRDL  199
              ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + +
Sbjct  502  CRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS--KAI  557

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            +   G  D LL L         +    RN     +N C++  P      V   LP L + 
Sbjct  558  LQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSITPD-EFHFVADSLPLLTQR  610

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L H D + +  TC   + L D       ++ +      L  +    +L +VTP + + G 
Sbjct  611  LTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNV---QQLLVVTPPILSSGM  667

Query  320  IV  321
             +
Sbjct  668  FI  669


> sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo 
sapiens OX=9606 GN=TRIP12 PE=1 SV=1
Length=1992

 Score = 42.7 bits (99),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 55/242 (23%), Positives = 97/242 (40%), Gaps = 15/242 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I   +
Sbjct  442  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  501

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVFRDL  199
              ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + +
Sbjct  502  CRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS--KAI  557

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            +   G  D LL L         +    RN     +N C++  P      V   LP L + 
Sbjct  558  LQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSITPD-EFHFVADSLPLLTQR  610

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L H D + +  TC   + L D       ++ +      L  +    +L +VTP + + G 
Sbjct  611  LTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNV---QQLLVVTPPILSSGM  667

Query  320  IV  321
             +
Sbjct  668  FI  669


> sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus 
tropicalis OX=8364 GN=trip12 PE=2 SV=1
Length=2056

 Score = 42.0 bits (97),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 98/242 (40%), Gaps = 15/242 (6%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++G+ +++   QLQA     +LL    +  +       ++P  ++ L       I   +
Sbjct  484  LLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  543

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVFRDL  199
              ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + +
Sbjct  544  CRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS--KAI  599

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            +   G  D LL L         +    RN     +N C++ +P      V   LP L + 
Sbjct  600  LQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSISPD-EFHFVADSLPLLTQR  652

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L H D + +  TC   + L D       ++ +      L  +    +L +VTP + + G 
Sbjct  653  LTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNI---QQLLVVTPPILSSGM  709

Query  320  IV  321
             +
Sbjct  710  FI  711


> sp|Q9SV36|KINUC_ARATH Kinesin-like protein KIN-UC OS=Arabidopsis 
thaliana OX=3702 GN=KINUC PE=1 SV=2
Length=1051

 Score = 41.6 bits (96),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 84/192 (44%), Gaps = 7/192 (4%)

Query  49   KRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREK  108
            +R+ + S        L+E+ N      +  +D+ KG   S  +   Q +Q  +K LS ++
Sbjct  733  QRKQMESELSKLKKNLRESENVVEEKRYMKEDLSKGSAESGAQTGSQRSQGLKKSLSGQR  792

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
               +  +     I K +  +   D   +Q ++   + N+A+  + Q K V +GG     +
Sbjct  793  -ATMARLCEEVGIQKILQLIKSEDL-EVQIQAVKVVANLAAEEANQVKIVEEGGVEALLM  850

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
             + +S ++ I   A  A+ N+A +    +DL++  G    L  ++   D        LR 
Sbjct  851  LVQSSQNSTILRVASGAIANLAMNEKS-QDLIMNKGGAQLLAKMVTKTDDPQT----LRM  905

Query  229  LTWTLSNLCRNK  240
            +   L+NLC N+
Sbjct  906  VAGALANLCGNE  917


> sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana 
OX=3702 GN=At3g60350 PE=2 SV=1
Length=928

 Score = 41.2 bits (95),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 72/160 (45%), Gaps = 11/160 (7%)

Query  150  GTSEQTKAVV--DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVD  207
            G S    A V  + GA+ A + L  SPH  + ++A  AL N+A D    R+ +  +G V+
Sbjct  587  GDSNGNNAAVGQEAGALEALVQLTQSPHEGVKQEAAGALWNLAFDDK-NRESIAAFGGVE  645

Query  208  PLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP--TLVRLLHHDDP  265
             L+AL      S+ + G    +   L  L  ++  +  I     I P   LVR    D  
Sbjct  646  ALVAL--AKSSSNASTGLQERVAGALWGLSVSEANSIAIGHEGGIPPLIALVRSEAEDVH  703

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS  305
            E  A   W +S+    P   + +V + GVV  LV+L  +S
Sbjct  704  ETAAGALWNLSF---NPGNALRIVEEGGVVA-LVQLCSSS  739


> sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 
1 OS=Bos taurus OX=9913 GN=RAP1GDS1 PE=1 SV=1
Length=558

 Score = 41.2 bits (95),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 73/341 (21%), Positives = 142/341 (42%), Gaps = 45/341 (13%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-----  213
            VD G I   + LL S    +  Q   ALGNI  D    +  +I  G +  L+ LL     
Sbjct  86   VDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHCQ  145

Query  214  --AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT  271
              A+ +M  +A G L  L  +       K      +  E+++    + + HD  E++ + 
Sbjct  146  KAALTEMCLVAFGNLAELESS-------KEQFASTNIAEELVKLFKKQIEHDKREMVFEV  198

Query  272  CWAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT------  324
               ++      N+ I + +V++G+V  L++++   +  + +     I  + T +      
Sbjct  199  LAPLA-----ENDAIKLQLVESGLVECLLEIV---QQKVDSDKEEDIAELKTASDLMVLL  250

Query  325  ---DEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLV  379
               DE  Q + + G   VF  +L+  P  N Q +    ++     R D     +V++G+V
Sbjct  251  LLGDESMQKLFEGGKGNVFQRVLSWIPSNNHQLQLAGALAIANFARNDGNCIHMVDNGIV  310

Query  380  PFLVSVLSK----ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK  435
              L+ +L +     +   Q  A+  + N      V     ++  G+ E ++  L ++   
Sbjct  311  EKLMDLLDRHVEDGNVTVQHAALSCLRNLAI--PVVNKAKMLSAGVTEAVLKFLKSEMPP  368

Query  436  IILVILDAISNIF----QAAEKLGETEKL-SIMIEECGGLD  471
            +   +L  +  +     +AAE+LG+  KL   ++E C   D
Sbjct  369  VQFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKD  409


 Score = 38.5 bits (88),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (45%), Gaps = 11/150 (7%)

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
            P +DA   ++  LV+LL+  D EVL  T  A+  +    +     ++  GV+P LVKLLG
Sbjct  84   PCVDA--GLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLG  141

Query  304  --ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN  361
                +  +    L A GN+      + Q      +  +   L+   K  I+ +    +  
Sbjct  142  IHCQKAALTEMCLVAFGNLAELESSKEQF----ASTNIAEELVKLFKKQIEHDKREMVFE  197

Query  362  ITA--GRQDQIQ-QVVNHGLVPFLVSVLSK  388
            + A     D I+ Q+V  GLV  L+ ++ +
Sbjct  198  VLAPLAENDAIKLQLVESGLVECLLEIVQQ  227


> sp|Q9U308|JAC1_CAEEL Juxtamembrane domain-associated catenin 
OS=Caenorhabditis elegans OX=6239 GN=jac-1 PE=1 SV=2
Length=1254

 Score = 41.2 bits (95),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (50%), Gaps = 7/137 (5%)

Query  58   DDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIR  117
            DD+  PL+   NN    + S+ ++++ ++S++ + QL A+   + L   + Q  I    R
Sbjct  673  DDSPPPLRRANNNVQWRDPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQ--IKEETR  730

Query  118  A-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK--AVVDGGAIPAFISLLASP  174
              G IPK ++ L R+D   IQ  +   L N++ G        AV++   +     +L + 
Sbjct  731  EYGGIPKLIALL-RSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTT  789

Query  175  H-AHISEQAVWALGNIA  190
            H A + E+A  AL N++
Sbjct  790  HDASVKEEAAAALWNLS  806


> sp|Q9DBR3|ARMC8_MOUSE Armadillo repeat-containing protein 8 OS=Mus 
musculus OX=10090 GN=Armc8 PE=1 SV=2
Length=673

 Score = 40.8 bits (94),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 2/103 (2%)

Query  114  NIIRAGLIPKFVSFLGR-TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            N+I  G +P+ +  L + T  + ++ E A  L ++A GT    K+++D   IPA +  L 
Sbjct  56   NLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLL  115

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP-LLALLA  214
            SP     E  +  L  I        +L+     V P L+ALL+
Sbjct  116  SPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLS  158


 Score = 40.0 bits (92),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 49/235 (21%), Positives = 99/235 (42%), Gaps = 25/235 (11%)

Query  144  LTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSVFRDLVI  201
            L N+    S   + +++ GA+     L  S +  +    +WAL N+A   +  +  D ++
Sbjct  450  LCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKAD-IL  508

Query  202  KYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV-----EQILP  254
            +  + + L  LL+  DM+ L    G LRNL  T           P ID +     +QI+ 
Sbjct  509  RSLSTEQLFRLLSDSDMNVLMKTLGLLRNLLST----------RPHIDKIMSTHGKQIMQ  558

Query  255  TLVRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
             +  +L  +   EV   T   ++ + DG   +  ++    ++ ++   +G S + +   A
Sbjct  559  AVTLILEGEHSIEVKEQTLCILANIADGTTAKELIMTNDDILQKIKYYMGHSHVKLQLAA  618

Query  314  LRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            +  I N+      G+ E+   + D G + +   L  +  +N+  +A   +    A
Sbjct  619  MFCISNLTWNEEEGSQERQDKLRDMGIVDILHKLSQSADSNLCDKAKTALQQYLA  673


 Score = 32.7 bits (73),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 57/117 (49%), Gaps = 4/117 (3%)

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNITAGRQDQIQQVV  374
            + N V G ++Q   +I  GA+     LL      T ++ E    + ++  G ++ ++ ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAV-TNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            +  ++P L+  L   D K  +  +  + T +TS  T E+++Y     +I  LM LL+
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLY-TDATVIPHLMALLS  158


> sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis OX=8355 
GN=jup PE=2 SV=1
Length=738

 Score = 40.4 bits (93),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 89/208 (43%), Gaps = 21/208 (10%)

Query  157  AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVP  216
            A+V+ G + A    L S    + +  +W L N++       D+  K   +D +L +L V 
Sbjct  343  AIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLS-------DVATKQEGLDNVLKIL-VN  394

Query  217  DMSSLACGYLRNLTWTLSNL-C---RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC  272
             +SS     L   T TLSNL C   RNK      + VE ++ T++R    DD  +     
Sbjct  395  QLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESLIHTILRASDKDD--IAEPAV  452

Query  273  WAISYLT----DGPNERIGMVVKTGVVPQLVKLLGAS-ELPIVTPALRAIGNIVTGTDEQ  327
             A+ +LT    D    +  + +  G +P +VKLL    + P+V   +  I N+       
Sbjct  453  CAMRHLTSRHQDAEVAQNSVRLHYG-IPAIVKLLNPPYQWPLVKATIGLIRNLALCPANH  511

Query  328  TQVVIDAGALAVFPSLLTNPKTNIQKEA  355
              +  DAG +     LL     + Q+ A
Sbjct  512  APLY-DAGVIPRLVQLLVKSHQDAQRHA  538


 Score = 37.4 bits (85),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 66/352 (19%), Positives = 131/352 (37%), Gaps = 71/352 (20%)

Query  87   SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTN  146
            +S + NQL   +A+RK L +               P+ V+ + RT       ++A   T+
Sbjct  158  ASMIVNQLSKKEASRKALMQS--------------PQIVAAIVRTMQHTSDMDTARCTTS  203

Query  147  IASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKY  203
            I    S   +   ++   G IPA + +L+SP   +   A+  L N+         L+ + 
Sbjct  204  ILHNLSHHREGLLSIFKSGGIPALVRMLSSPVESVLFYAITTLHNL---------LLYQE  254

Query  204  GAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD  263
            GA                                  K      D +++++P    LL+ +
Sbjct  255  GA----------------------------------KMAVRLADGLQKMVP----LLNKN  276

Query  264  DPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTG  323
            +P+ LA T   +  L  G  E   +++  G    LV+++       +      +  +++ 
Sbjct  277  NPKFLAITTDCLQLLAYGNQESKLIILGNGGPQGLVQIMRNYNYEKLLWTTSRVLKVLSV  336

Query  324  TDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHGLVPF  381
                   +++AG +      LT+    + +   WT+ N++  A +Q+ +  V+       
Sbjct  337  CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLDNVLK-----I  391

Query  382  LVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            LV+ LS  D      A   ++N T      + +     G+   +  +L A D
Sbjct  392  LVNQLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESLIHTILRASD  443


> sp|Q68FK4|ARMC8_XENLA Armadillo repeat-containing protein 8 OS=Xenopus 
laevis OX=8355 GN=armc8 PE=2 SV=1
Length=720

 Score = 40.0 bits (92),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 112/262 (43%), Gaps = 23/262 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ ++V+ +L A +    L SR  Q    +     +    +  L       I 
Sbjct  433  MDRIVNGLSETSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPLMKVLQNAP-DDIL  490

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSV  195
              ++  L N+    S   + +++ GA+    SL  S +  +    +WAL N+A   D  +
Sbjct  491  VVASSTLCNLLLEFSPSKEPILESGAVELLCSLTLSENPALRVNGIWALMNMAFQADQKI  550

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV----  249
              D +++  + + L  LL+  D++ L    G LRNL  T           P ID +    
Sbjct  551  KSD-ILRGLSTEQLFQLLSDSDVNVLMKTLGLLRNLLST----------RPHIDQIMSTH  599

Query  250  -EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++ ++   +G S L
Sbjct  600  GKQIMQAVTFILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYVGHSNL  659

Query  308  PIVTPALRAIGNIVTGTDEQTQ  329
             +   A+  I N+    +E +Q
Sbjct  660  KLQLAAMFCIANLTWNEEEGSQ  681


 Score = 36.6 bits (83),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 46/101 (46%), Gaps = 1/101 (1%)

Query  114  NIIRAGLIPKFVSFLGR-TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
            N+I  G +P+ +  L + T  + ++ E A  L +++ GT    K+++D   IPA +  L 
Sbjct  56   NLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLSMGTENNVKSLLDCNIIPALLQGLL  115

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL  213
            S      E  +  L  +        +L+    +V P L LL
Sbjct  116  SSDLQFIEACLRCLRTVFTSPVTPVELLYTDASVIPHLMLL  156


> sp|O13986|YEG4_SCHPO Uncharacterized protein C26H5.04 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.04 
PE=4 SV=3
Length=789

 Score = 40.0 bits (92),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 80/204 (39%), Gaps = 8/204 (4%)

Query  143  ALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK  202
            A+  + +   E  K +VD   +P  I+ L      + + A   L +++    + R  +  
Sbjct  425  AVAALTTSKDEYRKLIVDAKYLPVIINALKINSNSVKKAACECLLSLSRSVYILRTGLAD  484

Query  203  YGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHH  262
                +PL+ LL+ PD    +       T  + NL    +P          + TL+  +  
Sbjct  485  ADVSEPLIKLLSDPDTRVKSTA-----TSAICNLVLKFSPLREKFLTTNFIDTLISNIST  539

Query  263  DDPEVLADTCWAISYLTDGPNERIGM--VVKTGVVPQLVKLLGASELPIVTPALRAIGNI  320
             D  +   T W + ++  G +E I +  + K G   +LV+L    +L +    L+ + N 
Sbjct  540  KDSSLRKKTVWVLRHVVFGDDETIQLEPLKKIG-ASKLVELCNDEDLGVQEQMLQVLRNF  598

Query  321  VTGTDEQTQVVIDAGALAVFPSLL  344
                +E    ++    + +   +L
Sbjct  599  TCQKEESVDFLLKMVPMELLAKIL  622


 Score = 34.3 bits (77),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 26/141 (18%), Positives = 57/141 (40%), Gaps = 0/141 (0%)

Query  267  VLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDE  326
            +L     A++ LT   +E   ++V    +P ++  L  +   +   A   + ++      
Sbjct  418  ILESVLLAVAALTTSKDEYRKLIVDAKYLPVIINALKINSNSVKKAACECLLSLSRSVYI  477

Query  327  QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVL  386
                + DA        LL++P T ++  AT  + N+        ++ +    +  L+S +
Sbjct  478  LRTGLADADVSEPLIKLLSDPDTRVKSTATSAICNLVLKFSPLREKFLTTNFIDTLISNI  537

Query  387  SKADFKTQKEAVWAVTNYTSG  407
            S  D   +K+ VW + +   G
Sbjct  538  STKDSSLRKKTVWVLRHVVFG  558


> sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis 
thaliana OX=3702 GN=PUB2 PE=2 SV=1
Length=707

 Score = 40.0 bits (92),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 122/292 (42%), Gaps = 52/292 (18%)

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF  196
            Q E+   +  +A  +++    +    AIP+ +SLL S    I   AV  L N++ + +  
Sbjct  438  QREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQADAVTCLLNLSINDN-N  496

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            + L+ + GA+ PL+ +L          GYL              N A             
Sbjct  497  KSLIAESGAIVPLIHVLKT--------GYLEEA---------KANSAA------------  527

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
                          T +++S + +   E IG   + G +  LV LLG+  L     A  A
Sbjct  528  --------------TLFSLSVIEEYKTE-IG---EAGAIEPLVDLLGSGSLSGKKDAATA  569

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+    + +T+ VI+AGA+     L+ +P   + ++A   ++N+   R+ +I  +   
Sbjct  570  LFNLSIHHENKTK-VIEAGAVRYLVELM-DPAFGMVEKAVVVLANLATVREGKI-AIGEE  626

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNL  428
            G +P LV V+     + ++ A  A+    +    +    ++  G+I PL+ L
Sbjct  627  GGIPVLVEVVELGSARGKENATAALLQLCTHSP-KFCNNVIREGVIPPLVAL  677


 Score = 40.0 bits (92),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 86/189 (46%), Gaps = 3/189 (2%)

Query  215  VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA  274
            + D+ S +    R  T  +  L RN      + A  + +P+LV LL+  D  + AD    
Sbjct  427  IDDLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQADAVTC  486

Query  275  ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
            +  L+   N +  ++ ++G +  L+ +L    L        A    ++  +E    + +A
Sbjct  487  LLNLSINDNNK-SLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKTEIGEA  545

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ  394
            GA+     LL +   + +K+A   + N++   +++  +V+  G V +LV ++  A F   
Sbjct  546  GAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKT-KVIEAGAVRYLVELMDPA-FGMV  603

Query  395  KEAVWAVTN  403
            ++AV  + N
Sbjct  604  EKAVVVLAN  612


> sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca 
domestica OX=7370 GN=arm PE=2 SV=1
Length=813

 Score = 40.0 bits (92),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 88/209 (42%), Gaps = 14/209 (7%)

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            + K G +  L+ LL+ P  S L          TL NL  +++ +     +   L  +V L
Sbjct  229  IFKSGGIPALVKLLSSPVESVLFYA-----ITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  283

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L  ++ + LA     +  L  G  E   +++ +G   +LV+++ + +   +      +  
Sbjct  284  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  343

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            +++        ++DAG +      L+NP   + +   WT+ N++    D   +V   GL 
Sbjct  344  VLSVCSSNKPAIVDAGGMQALAMHLSNPSPRLVQNCLWTLRNLS----DAATKV--DGLE  397

Query  380  PF---LVSVLSKADFKTQKEAVWAVTNYT  405
            P    LV VL+  D      A   ++N T
Sbjct  398  PLLQSLVQVLASTDVNVVTCAAGILSNLT  426


 Score = 39.3 bits (90),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 62/139 (45%), Gaps = 18/139 (13%)

Query  147  IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV  206
            + S  S    A+VD G + A    L++P   + +  +W L N++       D   K   +
Sbjct  344  VLSVCSSNKPAIVDAGGMQALAMHLSNPSPRLVQNCLWTLRNLS-------DAATKVDGL  396

Query  207  DPLL----ALLAVPDMSSLAC--GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
            +PLL     +LA  D++ + C  G L NLT    N  RNK     +  V+ ++ T++   
Sbjct  397  EPLLQSLVQVLASTDVNVVTCAAGILSNLT---CNNQRNKATVCQVGGVDALVRTIINA-  452

Query  261  HHDDPEVLADTCWAISYLT  279
              D  E+      A+ +LT
Sbjct  453  -GDREEITEPAVCALRHLT  470


> sp|Q05AL1|ARMC8_DANRE Armadillo repeat-containing protein 8 OS=Danio 
rerio OX=7955 GN=armc8 PE=2 SV=1
Length=673

 Score = 40.0 bits (92),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 65/298 (22%), Positives = 122/298 (41%), Gaps = 35/298 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ S+++ +L A +    L SR  Q    +     +    +  L       + 
Sbjct  386  MDRIVSGLSESSIKVRLAAVRCLHSL-SRSVQQLRTSFHDHAVWKPLMKLLQNAP-DEVL  443

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA--GDGSV  195
              ++  L N+    S   + +++ G I    SL  S  + +    +WAL N+A   D  V
Sbjct  444  VMASSTLCNLLLEFSPSKEPILESGVIELLCSLTQSDSSALRVNGIWALMNMAFQADQKV  503

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV----  249
              ++V   G  + L  LL+ PD + L    G LRNL  T           P ID +    
Sbjct  504  KVEIVRALGT-EQLFRLLSDPDTNVLMKTLGLLRNLLST----------RPHIDQIMSSH  552

Query  250  -EQILPTLVRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             +QI+  +  +L  +   EV   T   ++ + DG   +  ++    ++ ++   +G S +
Sbjct  553  GKQIMQAVTLILEGEHSIEVKEQTLCILANIADGNTAKELIMTDDDMLQKIKYYMGHSNV  612

Query  308  PIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVF--------PSLLTNPKTNIQK  353
             +   A   I N++     G+ E+   + + G + +         P L    KT +Q+
Sbjct  613  KLQLAATFCISNLIWNEEDGSQERQDKLREMGFVDILHKLTQASDPDLCDRAKTAMQQ  670


> sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo OX=6431 PE=2 
SV=1
Length=818

 Score = 40.0 bits (92),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 91/416 (22%), Positives = 166/416 (40%), Gaps = 50/416 (12%)

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG + K V  L R +   +   +   L  +A G  E    ++  G     + ++ S   +
Sbjct  299  AGGLQKMVLLLQRNNLKFLAITTD-CLQILAYGNQESKLIILASGGPGELVRIMRS---Y  354

Query  178  ISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
              E+ +W    +    SV    +  +++ G+  P + L         +   ++N  WTL 
Sbjct  355  TYEKLLWTTSRVLKVLSVCASNKPAIVEAGSAGPSMHL------GHQSQRLVQNCLWTLR  408

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            NL    + A     +E +L  LV+LL  +D  ++      +S LT         V + G 
Sbjct  409  NL---SDAATKSSDIEGLLQMLVQLLASNDINIVTCAAGILSNLTCNNQRNKVTVCQVGG  465

Query  295  VPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNP-  347
            +  LV+  L       I  PA+ A+ ++ +   E    Q  V +  G L V   LL  P 
Sbjct  466  IEALVRTILQAGDREDITEPAVCALRHLTSRHGEAEMAQNAVRLHYG-LPVLVKLLHPPS  524

Query  348  KTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN---Y  404
            +  + K     + N+     +    +  HG +P +V +L +A   TQ+ A     N   Y
Sbjct  525  RWPLIKAVVGLIRNLALCPANHAP-LREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAY  583

Query  405  TSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAIS-----------NIFQAAE-  452
              G  +E+IV     G +  L  +      + ++  L+ IS           NI + A  
Sbjct  584  VDGVRMEEIVE----GTVGALHIMAREAHNRAVIRGLNCISLFAQLLYSPIDNIQRVAAG  639

Query  453  ---KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
               +L   ++ + MIE+ G    +  L +  NE V   + +++   F + E++ Q+
Sbjct  640  VLCELAADKEGAEMIEQEGTTAPLTELLHSRNEGVATYAAAVL---FRMSEDKPQD  692


 Score = 32.7 bits (73),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 85/399 (21%), Positives = 157/399 (39%), Gaps = 73/399 (18%)

Query  38   LRKAKKDDQMLKRR--NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQ  95
            +++  +  QMLK    N+ ++ DDA                ++ ++ K +N    E+Q+ 
Sbjct  145  VQRLSEPSQMLKHAVVNLINYQDDAD-----------LATRAIPELTKLLND---EDQVV  190

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT  155
             +QAA  +    K+    + I     P+ V+ L R   +    E+           S   
Sbjct  191  VSQAAMMVHQLSKKEASRHAIMNS--PQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHR  248

Query  156  KA---VVDGGAIPAFISLLASP-----------------HAHISEQAVWALGNIAGDGSV  195
            +    +   G IPA + LL+SP                 H   S+ AV   G +     +
Sbjct  249  QGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLL  308

Query  196  FRDLVIKYGAVDP-LLALLAVPDMSS----LACG-------YLRNLT-----WTLS----  234
             +   +K+ A+    L +LA  +  S    LA G        +R+ T     WT S    
Sbjct  309  LQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLK  368

Query  235  --NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
              ++C +  PA  I       P++   L H    ++ +  W +  L+D   +   +    
Sbjct  369  VLSVCASNKPA--IVEAGSAGPSM--HLGHQSQRLVQNCLWTLRNLSDAATKSSDI---E  421

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLL-TNPKTN  350
            G++  LV+LL ++++ IVT A   + N+          V   G + A+  ++L    + +
Sbjct  422  GLLQMLVQLLASNDINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTILQAGDRED  481

Query  351  IQKEATWTMSNITA--GRQDQIQQVVN-HGLVPFLVSVL  386
            I + A   + ++T+  G  +  Q  V  H  +P LV +L
Sbjct  482  ITEPAVCALRHLTSRHGEAEMAQNAVRLHYGLPVLVKLL  520


> sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles 
gambiae OX=7165 GN=arm PE=3 SV=5
Length=850

 Score = 39.7 bits (91),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 156/403 (39%), Gaps = 89/403 (22%)

Query  147  IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV  206
            + S  S    A+V+ G + A    L +P   + +  +W L N++       D   K   +
Sbjct  351  VLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLS-------DAATKVDGL  403

Query  207  DPLLA----LLAVPDMSSLAC--GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
            + LL+    +L   D++ + C  G L NLT    N  RNK     +  VE ++ T++   
Sbjct  404  ETLLSGLVTVLGSSDVNVVTCAAGILSNLT---CNNQRNKVTVCQVGGVEALVGTIINA-  459

Query  261  HHDDPEVLADTCWAISYLTDG--PNERIGMVVKTGV-VPQLVKLLGA-SELPIVTPALRA  316
              D  E+      A+ +LT     +E    VV+ G  +P +VKLL   S  P++   +  
Sbjct  460  -GDREEITEPAVCALRHLTSRHPESESAQNVVRNGYGLPVIVKLLNPPSRWPLIKAVIGL  518

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            I N                 LA+ P+                  N    R+        H
Sbjct  519  IRN-----------------LALCPA------------------NAAPLRE--------H  535

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTN-------YTSGGTVEQIVYLVHCGIIEPL----  425
            G +  LV +L KA   TQ++     +N       Y  G  +E+IV     G +  L    
Sbjct  536  GAIHLLVRLLFKAFQDTQRQRSSVASNGSQPPGAYADGVRMEEIVEGT-VGALHILAKEE  594

Query  426  MNLLTAKDTKII-----LVILDAISNIFQAAE----KLGETEKLSIMIEECGGLDKIEAL  476
             N    +   +I     L+  + I NI + A     +L   ++++ MIE  G    +  L
Sbjct  595  YNRQVIRSQNVIPIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGATAPLTEL  654

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQV  519
             N  NE V   + +++   F + E++  +     +SE  T  V
Sbjct  655  LNSANEGVATYAAAVL---FKMSEDKSMDYKKRFSSELTTLPV  694


 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 88/208 (42%), Gaps = 12/208 (6%)

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            + K G +  L+ LL+ P  S L          TL NL  +++ +     +   L  +V L
Sbjct  236  IFKSGGIPALVKLLSSPVESVLFYA-----ITTLHNLLLHQDGSKMAVRLAGGLQKMVAL  290

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L  ++ + LA     +  L  G  E   +++ +    +LV+++ + +   +      +  
Sbjct  291  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLK  350

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQVVNHG  377
            +++        +++AG +      L NP   + +   WT+ N++  A + D ++      
Sbjct  351  VLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLET-----  405

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYT  405
            L+  LV+VL  +D      A   ++N T
Sbjct  406  LLSGLVTVLGSSDVNVVTCAAGILSNLT  433


> sp|Q5VQ09|KINUB_ORYSJ Kinesin-like protein KIN-UB OS=Oryza sativa 
subsp. japonica OX=39947 GN=KINUB PE=2 SV=1
Length=891

 Score = 39.7 bits (91),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 87/209 (42%), Gaps = 15/209 (7%)

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
            +PPI  +     + K +S L  ++   ++  +   + N+A+  + Q K V  GG     +
Sbjct  623  KPPIAKLFEQVGLQKILSLL-ESEEPDVRVHAVKVVANLAAEEANQEKIVEAGGLTSLLM  681

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
             L +S    I   A  A+ N+A +    +DL++  G V    +LL++    +     LR 
Sbjct  682  LLRSSEDETIRRVAAGAIANLAMN-ETNQDLIMAQGGV----SLLSMTASDAEDPQTLRM  736

Query  229  LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL--------TD  280
            +   ++NLC N      +   E  +  L+ ++    P+VLA     I+          T 
Sbjct  737  VAGAIANLCGNDKLQTRLRG-EGGIKALLGMVKCGHPDVLAQVARGIANFAKCESRAATQ  795

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPI  309
            G      +++  G +P +VK       PI
Sbjct  796  GNKVGKSLLIDDGALPWIVKNANNEAAPI  824


> sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila 
melanogaster OX=7227 GN=arm PE=1 SV=1
Length=843

 Score = 39.7 bits (91),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 82/378 (22%), Positives = 148/378 (39%), Gaps = 69/378 (18%)

Query  38   LRKAKKDDQMLKRR--NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQ  95
            +++  +  QMLK    N+ ++ DDA                ++ +++K +N    E+Q+ 
Sbjct  130  VQRLSEPSQMLKHAVVNLINYQDDAE-----------LATRAIPELIKLLND---EDQVV  175

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT  155
             +QAA  +    K+    + I     P+ V+ L R   +    ES  A        S   
Sbjct  176  VSQAAMMVHQLSKKEASRHAIMNS--PQMVAALVRAISNSNDLESTKAAVGTLHNLSHHR  233

Query  156  K---AVVDGGAIPAFISLLASPHAHISEQAVWALGN--IAGDGSVF--------------  196
            +   A+   G IPA + LL+SP   +   A+  L N  +  DGS                
Sbjct  234  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  197  --RDLVIKYGAVDPLLALLAVPDMSS----LACG-------YLRN-----LTWTLS----  234
              R+ V     V   L +LA  +  S    LA G        +R+     L WT S    
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  235  --NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
              ++C +  PA  +DA    +  L   L +  P ++ +  W +  L+D   +  G+    
Sbjct  354  VLSVCSSNKPA-IVDAGG--MQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGL---E  407

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP--KTN  350
             ++  LV++LG++++ +VT A   + N+          V   G +      + N   +  
Sbjct  408  ALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREE  467

Query  351  IQKEATWTMSNITAGRQD  368
            I + A   + ++T+   D
Sbjct  468  ITEPAVCALRHLTSRHVD  485


 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 43/207 (21%), Positives = 84/207 (41%), Gaps = 10/207 (5%)

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            + K G +  L+ LL+ P  S L          TL NL  +++ +     +   L  +V L
Sbjct  239  IFKSGGIPALVKLLSSPVESVLFYA-----ITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L  ++ + LA     +  L  G  E   +++ +G   +LV+++ + +   +      +  
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN-HGL  378
            +++        ++DAG +      L N    + +   WT+ N++    D   +V     L
Sbjct  354  VLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLS----DAATKVEGLEAL  409

Query  379  VPFLVSVLSKADFKTQKEAVWAVTNYT  405
            +  LV VL   D      A   ++N T
Sbjct  410  LQSLVQVLGSTDVNVVTCAAGILSNLT  436


> sp|Q99569|PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 
PE=1 SV=2
Length=1192

 Score = 39.7 bits (91),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (44%), Gaps = 26/162 (16%)

Query  243  APPIDAVEQI----------LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            +P ID++++           LP ++ +L H  P V A+    + +L  G N+    V + 
Sbjct  510  SPSIDSIQKDPREFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRL  569

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTG--TDEQTQVVIDAGALAVFPSLLTNPKTN  350
            G +  LV LL    L +   A  A+ N+V G  TDE    + + G +   P+LL   + +
Sbjct  570  GGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGI---PALLRLLRKS  626

Query  351  IQKEAT-------WTMSNITAGR----QDQIQQVVNHGLVPF  381
            I  E         W +S+  A +    +D +  + N  +VP 
Sbjct  627  IDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPH  668


> sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila 
pseudoobscura pseudoobscura OX=46245 GN=arm PE=3 SV=2
Length=832

 Score = 39.7 bits (91),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 82/378 (22%), Positives = 148/378 (39%), Gaps = 69/378 (18%)

Query  38   LRKAKKDDQMLKRR--NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQ  95
            +++  +  QMLK    N+ ++ DDA                ++ +++K +N    E+Q+ 
Sbjct  130  VQRLSEPSQMLKHAVVNLINYQDDAE-----------LATRAIPELIKLLND---EDQVV  175

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT  155
             +QAA  +    K+    + I     P+ V+ L R   +    ES  A        S   
Sbjct  176  VSQAAMMVHQLSKKEASRHAIMNS--PQMVAALVRAISNSNDLESTKAAVGTLHNLSHHR  233

Query  156  K---AVVDGGAIPAFISLLASPHAHISEQAVWALGN--IAGDGSVF--------------  196
            +   A+   G IPA + LL+SP   +   A+  L N  +  DGS                
Sbjct  234  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  197  --RDLVIKYGAVDPLLALLAVPDMSS----LACG-------YLRN-----LTWTLS----  234
              R+ V     V   L +LA  +  S    LA G        +R+     L WT S    
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  235  --NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
              ++C +  PA  +DA    +  L   L +  P ++ +  W +  L+D   +  G+    
Sbjct  354  VLSVCSSNKPA-IVDAGG--MQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGL---E  407

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP--KTN  350
             ++  LV++LG++++ +VT A   + N+          V   G +      + N   +  
Sbjct  408  ALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREE  467

Query  351  IQKEATWTMSNITAGRQD  368
            I + A   + ++T+   D
Sbjct  468  ITEPAVCALRHLTSRHVD  485


 Score = 33.9 bits (76),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 43/207 (21%), Positives = 84/207 (41%), Gaps = 10/207 (5%)

Query  200  VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
            + K G +  L+ LL+ P  S L          TL NL  +++ +     +   L  +V L
Sbjct  239  IFKSGGIPALVKLLSSPVESVLFYA-----ITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L  ++ + LA     +  L  G  E   +++ +G   +LV+++ + +   +      +  
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN-HGL  378
            +++        ++DAG +      L N    + +   WT+ N++    D   +V     L
Sbjct  354  VLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLS----DAATKVEGLEAL  409

Query  379  VPFLVSVLSKADFKTQKEAVWAVTNYT  405
            +  LV VL   D      A   ++N T
Sbjct  410  LQSLVQVLGSTDVNVVTCAAGILSNLT  436


> sp|Q68FH0|PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 
PE=1 SV=1
Length=1190

 Score = 39.3 bits (90),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (44%), Gaps = 26/162 (16%)

Query  243  APPIDAVEQI----------LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            +P ID++++           LP ++ +L H  P V A+    + +L  G N+    V + 
Sbjct  509  SPSIDSIQKDPREFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRL  568

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTG--TDEQTQVVIDAGALAVFPSLLTNPKTN  350
            G +  LV LL    L +   A  A+ N+V G  TDE    + + G +   P+LL   + +
Sbjct  569  GGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGI---PALLRLLRKS  625

Query  351  IQKEAT-------WTMSNITAGR----QDQIQQVVNHGLVPF  381
            I  E         W +S+  A +    +D +  + N  +VP 
Sbjct  626  IDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPH  667


> sp|P52306|GDS1_HUMAN Rap1 GTPase-GDP dissociation stimulator 
1 OS=Homo sapiens OX=9606 GN=RAP1GDS1 PE=1 SV=3
Length=607

 Score = 38.9 bits (89),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 66/156 (42%), Gaps = 21/156 (13%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA----VDPLLALLA  214
            VD G I   + LL S    +  Q   ALGNI  D    R  V + G     +D L +L +
Sbjct  86   VDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHLRSLCS  145

Query  215  VPD-----MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ-ILPTLVRLLH-HDDPEV  267
            + D     + ++ CG L N +        N+N +     +   ++PTLV+LL  H     
Sbjct  146  ITDPANEKLLTVFCGMLMNYS--------NENDSLQAQLINMGVIPTLVKLLGIHCQNAA  197

Query  268  LADTCW-AISYLTDGPNERIGMVVKTGVVPQLVKLL  302
            L + C  A   L +  + +      T +  +LVKL 
Sbjct  198  LTEMCLVAFGNLAELESSK-EQFASTNIAEELVKLF  232


 Score = 34.3 bits (77),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 48/104 (46%), Gaps = 7/104 (7%)

Query  290  VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV----FPSL--  343
            V  G++  LV+LL + +  ++    RA+GNI   + E    V  AG   +      SL  
Sbjct  86   VDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHLRSLCS  145

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVL  386
            +T+P           M    +   D +Q Q++N G++P LV +L
Sbjct  146  ITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLL  189


> sp|F4I718|CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 
OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
Length=2136

 Score = 39.3 bits (90),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 92/202 (46%), Gaps = 18/202 (9%)

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            R L+  YG   PL   + + + ++LA     N+   L  LC++K+    +  +   +P L
Sbjct  74   RRLIGSYGQAMPLFISM-LRNGTTLA---KVNVASILCVLCKDKDLRLKV-LLGGCIPPL  128

Query  257  VRLLHHDDPEVLADTCWAISYLTDG--PNERIGM--VVKTGVVPQL---VKLLGASELPI  309
            + +L     E       AI  ++     N+ IGM   +  GVVP L   + L G  +  +
Sbjct  129  LSVLKSGTMETRKAAAEAIYEVSSAGISNDHIGMKIFITEGVVPTLWDQLSLKGNQDKVV  188

Query  310  ---VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
               VT ALR   N+    D   ++ ++   + +  SLL++   N Q  A   ++ +    
Sbjct  189  EGYVTGALR---NLCGVDDGYWRLTLEGSGVDIVVSLLSSDNPNSQANAASLLARLVLSF  245

Query  367  QDQIQQVVNHGLVPFLVSVLSK  388
             D IQ+++N G+V  L+ +L +
Sbjct  246  CDSIQKILNSGVVKSLIQLLEQ  267


 Score = 35.4 bits (80),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 65/176 (37%), Gaps = 33/176 (19%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGAIPAFISLLASPHAHIS  179
            I  F+SFLG +  S    E A  +  I +   + +K AV   G IP  + LL +      
Sbjct  473  IQLFISFLGLS--SEQHQEYAVEMLKILTAQVDDSKWAVTAAGGIPPLVQLLETGSQKAK  530

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            E A   L N+       RD V + G +   L LL                          
Sbjct  531  EDAACILWNLCCHSEEIRDCVERAGGIPAFLWLL--------------------------  564

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            K   P  ++ E    TLV+L+H  DP  +      +  L D P  +I ++   G V
Sbjct  565  KTGGP--NSQETSAKTLVKLVHTADPATINQLLALL--LGDDPTSKIQVIEVLGHV  616


> sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis 
thaliana OX=3702 GN=PUB11 PE=2 SV=2
Length=612

 Score = 38.9 bits (89),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 51/244 (21%), Positives = 100/244 (41%), Gaps = 14/244 (6%)

Query  158  VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA  214
            + + GAIP  ++LL S      E A+  + N+    S++   ++L++  GAV  ++ +L 
Sbjct  369  IAEAGAIPVLVNLLTSEDVATQENAITCVLNL----SIYENNKELIMFAGAVTSIVQVLR  424

Query  215  VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA  274
               M +       N   TL +L         I     I P LV LL +  P    D   A
Sbjct  425  AGTMEAR-----ENAAATLFSLSLADENKIIIGGSGAI-PALVDLLENGTPRGKKDAATA  478

Query  275  ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
            +  L      + G  V+ G+V  LVK+L  S    +      I +++    +    ++ A
Sbjct  479  LFNLCIYHGNK-GRAVRAGIVTALVKMLSDSTRHRMVDEALTILSVLANNQDAKSAIVKA  537

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ  394
              L     +L   +T  ++ A   + ++     +++  +   G V  L+ +      + +
Sbjct  538  NTLPALIGILQTDQTRNRENAAAILLSLCKRDTEKLITIGRLGAVVPLMDLSKNGTERGK  597

Query  395  KEAV  398
            ++A+
Sbjct  598  RKAI  601


> sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis 
thaliana OX=3702 GN=UPL4 PE=3 SV=1
Length=1502

 Score = 38.5 bits (88),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (48%), Gaps = 12/134 (9%)

Query  254  PTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV-KLLGASELPIVT  311
            P LV+L  H++  +++     AI+YL D     +  +V+   +P L  +LL    L +  
Sbjct  156  PVLVKLAKHENNADIMLLAIRAITYLCDVYPPSVEFLVRHDTIPALCQRLLTIEYLDVAE  215

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
              L+A+  I   + ++    ++AGA+    S +    T+IQ+ A  T+ NI        +
Sbjct  216  QCLQALEKI---SRDEPVACLNAGAIMAVLSFIDFFSTSIQRVAISTVVNIC-------K  265

Query  372  QVVNHGLVPFLVSV  385
            Q+ +    PF+ +V
Sbjct  266  QLSSESPSPFMDAV  279


> sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus OX=9913 
GN=JUP PE=2 SV=1
Length=745

 Score = 38.5 bits (88),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 94/481 (20%), Positives = 186/481 (39%), Gaps = 79/481 (16%)

Query  21   GKDSTEMRRRRIE-VNVELRKAKKDDQMLKRRNVS--SFPDDATSPLQENRNNQGTVNWS  77
            G+DS+ +   ++E     L++  +  Q+LK   V   ++ DDA   L      + T   +
Sbjct  95   GEDSSLLLTTQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAE--LATRALPELTKLLN  152

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +D V    ++ + NQL   +A+R+ L                 P+ V+ + RT  +   
Sbjct  153  DEDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSD  198

Query  138  FESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS  194
             ++A   T+I    S   +   A+   G IPA + +L+SP   +   A+  L N+     
Sbjct  199  LDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL-----  253

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                L+ + GA                                  K      D +++++P
Sbjct  254  ----LLYQEGA----------------------------------KMAVRLADGLQKMVP  275

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
                LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  276  ----LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTT  331

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQ  372
              +  +++        +++AG +      LT+    + +   WT+ N++  A +Q+ ++ 
Sbjct  332  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLES  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+       LV+ LS  D      A   ++N T   +  + +   + G+   +  +L A 
Sbjct  392  VLK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAG  446

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENE-SVYKASLSL  491
            D   I     A+  +     +  E E     +    G+  I  L N  N+  + KA++ L
Sbjct  447  DKDDI--TEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGL  504

Query  492  I  492
            I
Sbjct  505  I  505


> sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus 
OX=10116 GN=Jup PE=1 SV=1
Length=745

 Score = 38.1 bits (87),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 94/481 (20%), Positives = 186/481 (39%), Gaps = 79/481 (16%)

Query  21   GKDSTEMRRRRIE-VNVELRKAKKDDQMLKRRNVS--SFPDDATSPLQENRNNQGTVNWS  77
            G+DS+ +   ++E     L++  +  Q+LK   V   ++ DDA   L      + T   +
Sbjct  95   GEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAE--LATRALPELTKLLN  152

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +D V    ++ + NQL   +A+R+ L                 P+ V+ + RT  +   
Sbjct  153  DEDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSD  198

Query  138  FESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS  194
             ++A   T+I    S   +   A+   G IPA + +L+SP   +   A+  L N+     
Sbjct  199  LDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL-----  253

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                L+ + GA                                  K      D +++++P
Sbjct  254  ----LLYQEGA----------------------------------KMAVRLADGLQKMVP  275

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
                LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  276  ----LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYSYEKLLWTT  331

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQ  372
              +  +++        +++AG +      LT+    + +   WT+ N++  A +Q+ ++ 
Sbjct  332  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLEN  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+       LV+ LS  D      A   ++N T   +  + +   + G+   +  +L A 
Sbjct  392  VLK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAG  446

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENE-SVYKASLSL  491
            D   I     A+  +     +  E E     +    G+  I  L N  N+  + KA++ L
Sbjct  447  DKDDI--TEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGL  504

Query  492  I  492
            I
Sbjct  505  I  505


> sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10090 
GN=Jup PE=1 SV=3
Length=745

 Score = 38.1 bits (87),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 94/481 (20%), Positives = 186/481 (39%), Gaps = 79/481 (16%)

Query  21   GKDSTEMRRRRIE-VNVELRKAKKDDQMLKRRNVS--SFPDDATSPLQENRNNQGTVNWS  77
            G+DS+ +   ++E     L++  +  Q+LK   V   ++ DDA   L      + T   +
Sbjct  95   GEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAE--LATRALPELTKLLN  152

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +D V    ++ + NQL   +A+R+ L                 P+ V+ + RT  +   
Sbjct  153  DEDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSD  198

Query  138  FESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS  194
             ++A   T+I    S   +   A+   G IPA + +L+SP   +   A+  L N+     
Sbjct  199  LDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL-----  253

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                L+ + GA                                  K      D +++++P
Sbjct  254  ----LLYQEGA----------------------------------KMAVRLADGLQKMVP  275

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
                LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  276  ----LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYSYEKLLWTT  331

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQ  372
              +  +++        +++AG +      LT+    + +   WT+ N++  A +Q+ ++ 
Sbjct  332  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLES  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+       LV+ LS  D      A   ++N T   +  + +   + G+   +  +L A 
Sbjct  392  VLK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAG  446

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENE-SVYKASLSL  491
            D   I     A+  +     +  E E     +    G+  I  L N  N+  + KA++ L
Sbjct  447  DKDDI--TEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGL  504

Query  492  I  492
            I
Sbjct  505  I  505


> sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa OX=9823 
GN=Jup PE=2 SV=1
Length=745

 Score = 38.1 bits (87),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 94/481 (20%), Positives = 186/481 (39%), Gaps = 79/481 (16%)

Query  21   GKDSTEMRRRRIE-VNVELRKAKKDDQMLKRRNVS--SFPDDATSPLQENRNNQGTVNWS  77
            G+DS+ +   ++E     L++  +  Q+LK   V   ++ DDA   L      + T   +
Sbjct  95   GEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAE--LATRALPELTKLLN  152

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +D V    ++ + NQL   +A+R+ L                 P+ V+ + RT  +   
Sbjct  153  DEDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSD  198

Query  138  FESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS  194
             ++A   T+I    S   +   A+   G IPA + +L+SP   +   A+  L N+     
Sbjct  199  LDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL-----  253

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                L+ + GA                                  K      D +++++P
Sbjct  254  ----LLYQEGA----------------------------------KMAVRLADGLQKMVP  275

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
                LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  276  ----LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTT  331

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQ  372
              +  +++        +++AG +      LT+    + +   WT+ N++  A +Q+ ++ 
Sbjct  332  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLES  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+       LV+ LS  D      A   ++N T   +  + +   + G+   +  +L A 
Sbjct  392  VLK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAG  446

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENE-SVYKASLSL  491
            D   I     A+  +     +  E E     +    G+  I  L N  N+  + KA++ L
Sbjct  447  DKDDI--TEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGL  504

Query  492  I  492
            I
Sbjct  505  I  505


> sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 
GN=JUP PE=1 SV=3
Length=745

 Score = 38.1 bits (87),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 94/481 (20%), Positives = 186/481 (39%), Gaps = 79/481 (16%)

Query  21   GKDSTEMRRRRIEVNV-ELRKAKKDDQMLKRRNVS--SFPDDATSPLQENRNNQGTVNWS  77
            G+DS+ +   ++E     L++  +  Q+LK   V   ++ DDA   L      + T   +
Sbjct  95   GEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAE--LATRALPELTKLLN  152

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +D V    ++ + NQL   +A+R+ L                 P+ V+ + RT  +   
Sbjct  153  DEDPVVVTKAAMIVNQLSKKEASRRALMGS--------------PQLVAAVVRTMQNTSD  198

Query  138  FESAWALTNIASGTSEQTK---AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGS  194
             ++A   T+I    S   +   A+   G IPA + +L+SP   +   A+  L N+     
Sbjct  199  LDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL-----  253

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                L+ + GA                                  K      D +++++P
Sbjct  254  ----LLYQEGA----------------------------------KMAVRLADGLQKMVP  275

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
                LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  276  ----LLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTT  331

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT--AGRQDQIQQ  372
              +  +++        +++AG +      LT+    + +   WT+ N++  A +Q+ ++ 
Sbjct  332  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLES  391

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+       LV+ LS  D      A   ++N T   +  + +   + G+   +  +L A 
Sbjct  392  VLK-----ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAG  446

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENE-SVYKASLSL  491
            D   I     A+  +     +  E E     +    G+  I  L N  N+  + KA++ L
Sbjct  447  DKDDI--TEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGL  504

Query  492  I  492
            I
Sbjct  505  I  505


> sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio 
rerio OX=7955 GN=trip12 PE=3 SV=1
Length=2026

 Score = 37.7 bits (86),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 84/202 (42%), Gaps = 13/202 (6%)

Query  81   IVKGINSSNVENQ-LQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFE  139
            +++G+ ++  E+Q LQA     +LL    +  +       ++P  ++ L       I   
Sbjct  481  LLQGLQATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNH  540

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS-PHAHISEQAVWALGNIAGDGSVFRD  198
            ++ ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S  + 
Sbjct  541  ASRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQFIDVAEQALTALEMLSRRHS--KA  596

Query  199  LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR  258
            ++   G  D LL L         +    RN     +N C++  P      V   LP L +
Sbjct  597  ILQAGGLADCLLYL------EFFSINAQRNALAIAANCCQSITPDE-FHFVADSLPLLTQ  649

Query  259  LLHHDDPEVLADTCWAISYLTD  280
             L H D + +  TC   + L D
Sbjct  650  RLTHQDKKSVESTCLCFARLVD  671


> sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana 
OX=3702 GN=FBX5 PE=1 SV=1
Length=930

 Score = 37.4 bits (85),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 71/165 (43%), Gaps = 21/165 (13%)

Query  150  GTSEQTKAVV--DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVD  207
            G S    A V  + GA+ A + L  SPH  + ++A  AL N++ D    R+ +   G V+
Sbjct  596  GDSNNNNAAVGQEAGALEALVQLTKSPHEGVRQEAAGALWNLSFDDK-NRESISVAGGVE  654

Query  208  PLLALL-----AVPDMSSLACGYLRNLTWTLSN--LCRNKNPAPPIDAVEQILPTLVRLL  260
             L+AL      A   +   A G L  L+ + +N      +   PP+ A       L R  
Sbjct  655  ALVALAQSCSNASTGLQERAAGALWGLSVSEANSVAIGREGGVPPLIA-------LARSE  707

Query  261  HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS  305
              D  E  A   W +++    P   +  +V+ G VP LV L  +S
Sbjct  708  AEDVHETAAGALWNLAF---NPGNAL-RIVEEGGVPALVHLCSSS  748


> sp|O93614|GDS1A_XENLA Rap1 GTPase-GDP dissociation stimulator 
1-A OS=Xenopus laevis OX=8355 GN=rap1gds1-a PE=1 SV=1
Length=607

 Score = 37.4 bits (85),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 50/104 (48%), Gaps = 7/104 (7%)

Query  290  VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSL-----  343
            V+ G++P LV+LL + +  ++    RA+GNI     E  + V  + GA  V   L     
Sbjct  86   VEAGLIPPLVQLLHSKDQEVLLQTGRALGNICYDNHEGRRAVDQEGGAQIVVDHLRSMCT  145

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVL  386
            LT+P +         M    +   D +Q Q++  G++P LV +L
Sbjct  146  LTDPSSEKLMTVFCGMLMNYSSENDSLQTQLIQMGVIPILVDLL  189


 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 79/381 (21%), Positives = 156/381 (41%), Gaps = 33/381 (9%)

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV-VDGGA------IPAFI  168
            + AGLIP  V  L   D   +  ++  AL NI     E  +AV  +GGA      + +  
Sbjct  86   VEAGLIPPLVQLLHSKD-QEVLLQTGRALGNICYDNHEGRRAVDQEGGAQIVVDHLRSMC  144

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
            +L       +       L N + +    +  +I+ G +  L+ LL V   ++        
Sbjct  145  TLTDPSSEKLMTVFCGMLMNYSSENDSLQTQLIQMGVIPILVDLLGVHSQNTALTEMCLV  204

Query  229  LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM  288
                L+ L  +K      +  E+I+    +   H+  E++ +    ++      N+ I M
Sbjct  205  AFGNLAELESSKEQFAGTNIAEEIVKLFKKQTEHEKREIIFEVLAPLA-----ENDAIKM  259

Query  289  -VVKTGVVPQLVKLLGA---SELPIVTPALRAIGNIVTGT---DEQTQVVIDAGALAVFP  341
             +V+ G+V  L+ ++     SE       L+   +++      DE  Q + + G  +VF 
Sbjct  260  QLVEAGLVECLLDVVQQTVNSEKDDDIAELKTSSDLMVLLLLGDESMQKLFEGGKGSVFQ  319

Query  342  SLLT-NPKTNIQKEATWTMSNITAGRQD-QIQQVVNHGLVPFLVSVLSK----ADFKTQK  395
             +L+  P  N Q +    ++     R D     +V+  +V  L+ +L +     +   Q 
Sbjct  320  RVLSWLPSNNHQLQLAGALAIANFARNDGNCIHMVDSEIVQKLLDLLDRHVEDGNVTVQH  379

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIF----QAA  451
             A+ A+ N      V     ++  G+ E ++  L ++   +   +L  +  +     +AA
Sbjct  380  AALSALRNLAI--PVVNKAKMLSAGVAEEVLKFLRSEMPPVQFKLLGTLRMLIDAQAEAA  437

Query  452  EKLGETEKLS-IMIEECGGLD  471
            E++G+ EKL+  ++E C   D
Sbjct  438  EQIGKNEKLAERLVEWCEAKD  458


> sp|O34808|UXAC_BACSU Uronate isomerase OS=Bacillus subtilis (strain 
168) OX=224308 GN=uxaC PE=2 SV=1
Length=473

 Score = 37.0 bits (84),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            + K +NS  ++NQL  T     L S     P DN + A +I    SF        IQF +
Sbjct  329  LYKLLNSVEMKNQLPKTI----LYSLN---PNDNYVIASMIN---SFQDGITPGKIQFGT  378

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            AW   +   G  +Q KA+ + G    FI +L    + +S
Sbjct  379  AWWFNDTKDGMLDQMKALSNVGLFSRFIGMLTDSRSFLS  417


> sp|Q5EBP3|ARMC5_MOUSE Armadillo repeat-containing protein 5 OS=Mus 
musculus OX=10090 GN=Armc5 PE=2 SV=1
Length=926

 Score = 37.0 bits (84),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 48/104 (46%), Gaps = 3/104 (3%)

Query  263  DDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL-RAIGNIV  321
             D + L     A+  L D P  R+ +  +  V P L +LL  +  P +T AL RA+  + 
Sbjct  204  QDSQCLQSIVRALRNLADSPQHRLALAQQGAVRP-LAELLATAPDPALTAALVRALLELS  262

Query  322  TGTDEQTQVVID-AGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             G        +   GAL    SL ++PK  I++ A   ++N+ A
Sbjct  263  RGCSRACAEQLSLGGALGPLVSLASHPKRAIREAAILILANLCA  306


> sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio 
OX=7955 GN=unc45b PE=1 SV=2
Length=934

 Score = 36.6 bits (83),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 57/148 (39%), Gaps = 10/148 (7%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
             VS LG        FE+   LTN+A    +    ++   A+P   + +   H  I + A 
Sbjct  725  LVSLLGTDRDGMENFEALRGLTNLAGLNDKLRVKILKEKALPEIENYMFEDHEQIRQAAT  784

Query  184  WALGNIAGDGSVFRDLVIKYGAVD-PLLALLAVPDMSSL---ACGYLRNLTWTLSNLCRN  239
              + N+     V +D  ++ G     LL LL   D   L   A G L  LT     L   
Sbjct  785  ECMCNLVCCKEV-QDRYLEDGNDKLKLLVLLCGEDEEKLQRAAAGALAMLTAAQKKL---  840

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEV  267
                      EQ L  L RL  HD+PE+
Sbjct  841  --AVKMTKVTEQWLEILQRLCIHDNPEI  866


> sp|A7Z3M5|UXAC_BACVZ Uronate isomerase OS=Bacillus velezensis 
(strain DSM 23117 / BGSC 10A6 / FZB42) OX=326423 GN=uxaC PE=3 
SV=1
Length=465

 Score = 36.6 bits (83),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 33/69 (48%), Gaps = 3/69 (4%)

Query  111  PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL  170
            P DN I A +I  F    G+T    IQF +AW   +   G  +Q +A+ + G    FI +
Sbjct  351  PNDNYIIASMINSFQD--GKTP-GKIQFGTAWWFNDTKDGMLQQMRALSNMGLFSRFIGM  407

Query  171  LASPHAHIS  179
            L    + +S
Sbjct  408  LTDSRSFLS  416


> sp|Q0DV28|KINUA_ORYSJ Kinesin-like protein KIN-UA OS=Oryza sativa 
subsp. japonica OX=39947 GN=KINUA PE=2 SV=2
Length=945

 Score = 36.6 bits (83),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 69/142 (49%), Gaps = 9/142 (6%)

Query  100  ARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV  159
            +R+LLS ++   I  I     +P  ++ L ++D   +Q  +   + N+A+    Q K V 
Sbjct  675  SRELLSSQR-SNISKIFEEVGLPNVLALL-KSDELEVQIHAVKVVANLAAEDVNQEKIVE  732

Query  160  DGGAIPAFISLL-ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM  218
            +GG + A +SLL  S +  I      A+ N+A +GS    ++ K GA   LLA +A    
Sbjct  733  EGG-LDALLSLLETSENTTIHRVTAGAIANLAMNGSNQGLIMNKGGA--RLLANIASKTN  789

Query  219  SSLACGYLRNLTWTLSNLCRNK  240
                   LR +   L+NLC N+
Sbjct  790  DPQT---LRMVAGALANLCGNE  808


> sp|P36144|RL1D1_YEAST Ribosome biogenesis protein UTP30 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) OX=559292 
GN=UTP30 PE=1 SV=1
Length=274

 Score = 35.8 bits (81),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L ++C+N +  P  D    +    ++   H  PE+L +    I++LTD      G V+K 
Sbjct  180  LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG  237

Query  293  GVVPQLVKLLGASELPI  309
            G++   VK   ++ LPI
Sbjct  238  GIISIFVKTSNSTSLPI  254


> sp|P80911|IORB_METTM Indolepyruvate oxidoreductase subunit IorB 
OS=Methanothermobacter marburgensis (strain ATCC BAA-927 
/ DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) OX=79929 
GN=iorB PE=1 SV=2
Length=196

 Score = 35.4 bits (80),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
            DLVI +   +PL AL A+P MS  AC  +        NL ++ +P PP+   E+I+ TL
Sbjct  68   DLVIAF---EPLEALRALPKMSEDACVIVNTSKIPPFNLIKSPHPYPPL---EEIIKTL  120


> sp|Q54VU5|Y0038_DICDI Probable inactive serine/threonine-protein 
kinase DDB_G0280131 OS=Dictyostelium discoideum OX=44689 
GN=DDB_G0280131 PE=3 SV=1
Length=1192

 Score = 36.2 bits (82),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 77/178 (43%), Gaps = 14/178 (8%)

Query  254   PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
             PTL+ L  H   + +   C  +        E I  +++   VP + +L+      I    
Sbjct  875   PTLLNL--HRASQTIDQLCKNV--------ENIEYLLEADFVPLIFQLMDQPYDEIQLSC  924

Query  314   LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG--RQDQIQ  371
             L+    ++   +E   +  +   + +    L + K NI       +S ++ G  R++  +
Sbjct  925   LKQFSTLIEHNEEIMNLFRNLLGINILMETLNSQKENILFITLRLLSQLSNGADREENRE  984

Query  372   QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
             Q++  G +P L+++LS  +   + + +W +T      +V+  V  V  G +  L++++
Sbjct  985   QILIKGGIPLLINLLSHQNELIRLQILWCLTLLLESNSVQ--VEFVKLGGVNQLLDMM  1040


> sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis 
thaliana OX=3702 GN=PUB14 PE=1 SV=1
Length=632

 Score = 35.8 bits (81),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 83/183 (45%), Gaps = 13/183 (7%)

Query  289  VVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPK  348
            + + G +P LV+LL + +      ++ A+ N+      +  +V DAGA+     +L N  
Sbjct  383  IAEAGAIPLLVELLSSPDPRTQEHSVTALLNLSINEGNKGAIV-DAGAITDIVEVLKNGS  441

Query  349  TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN---YT  405
               ++ A  T+ +++   ++++        +  L+S+L +   + +K+A  A+ N   Y 
Sbjct  442  MEARENAAATLFSLSVIDENKVAIGAAG-AIQALISLLEEGTRRGKKDAATAIFNLCIYQ  500

Query  406  SGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII---LVILDAISNIFQAAEKLGETEKLSI  462
               +       V  GI++PL  LL      ++   L IL  +S   +    + E E + +
Sbjct  501  GNKS-----RAVKGGIVDPLTRLLKDAGGGMVDEALAILAILSTNQEGKTAIAEAESIPV  555

Query  463  MIE  465
            ++E
Sbjct  556  LVE  558


 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 44/89 (49%), Gaps = 21/89 (24%)

Query  144  LTNIASGTSEQTKA------------------VVDGGAIPAFISLLASPHAHISEQAVWA  185
            L  +A+GT+EQ +A                  + + GAIP  + LL+SP     E +V A
Sbjct  351  LEKLANGTTEQQRAAAGELRLLAKRNVDNRVCIAEAGAIPLLVELLSSPDPRTQEHSVTA  410

Query  186  LGNIA-GDGSVFRDLVIKYGAVDPLLALL  213
            L N++  +G+  +  ++  GA+  ++ +L
Sbjct  411  LLNLSINEGN--KGAIVDAGAITDIVEVL  437


> sp|Q9LPC6|KINUB_ARATH Kinesin-like protein KIN-UB OS=Arabidopsis 
thaliana OX=3702 GN=KINUB PE=1 SV=2
Length=894

 Score = 35.8 bits (81),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 79/189 (42%), Gaps = 18/189 (10%)

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            +D + I+  +   + N+A+  + Q K V  GG     + L +     +   A  A+ N+A
Sbjct  647  SDDANIRIHAVKVVANLAAEEANQEKIVEAGGLTSLLMLLRSYEDETVRRVAAGAIANLA  706

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI--DA  248
             +  V + L++  G +    +LL++    +     LR +   ++NLC N      +  D 
Sbjct  707  MN-EVSQQLIVDQGGI----SLLSLTAADAEDPQTLRMVAGAIANLCGNDKLQARLWSDG  761

Query  249  VEQILPTLVRLLHHDDPEVLADTCWAISYL--------TDGPNERIGMVVKTGVVPQLVK  300
              + L  +VR  H   P+VLA     I+          T G      ++++ G +P +V+
Sbjct  762  GIKALLGMVRCGH---PDVLAQVARGIANFAKCESRATTQGVKSGRSLLIEDGALPWIVQ  818

Query  301  LLGASELPI  309
                   PI
Sbjct  819  HANDEAAPI  827


> sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis 
OX=8355 GN=unc45b PE=2 SV=1
Length=927

 Score = 35.4 bits (80),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 54/134 (40%), Gaps = 9/134 (7%)

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
            FE+  ALTN++  + +  + +V   A+P   + +   H  I + A   + N+A +  V  
Sbjct  732  FEALLALTNLSGKSDKLRQKIVKEKALPEIENYMFENHEQIRQAATECMCNLAVNKEVKE  791

Query  198  DLVIKYGAVDPLLALLAVPD----MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
                +      L+ LL   D    +   A G L  LT     LC         +   Q L
Sbjct  792  RFTAEGNDRLKLIVLLCGEDEEVKLQRAAAGTLAILTAAEKKLCHKMT-----EVTSQWL  846

Query  254  PTLVRLLHHDDPEV  267
              L RL  ++D +V
Sbjct  847  EILQRLCLNEDLQV  860


> sp|Q55BR7|RPTOR_DICDI Protein raptor homolog OS=Dictyostelium 
discoideum OX=44689 GN=raptor PE=1 SV=1
Length=1509

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 93/218 (43%), Gaps = 14/218 (6%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNI-AGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
            G  P  + LL SP   +    V+    I A D S   DLV + G     +++L+ P + +
Sbjct  590  GIFPYVLKLLQSPAGDLRHILVFIWAKILALDKSCQLDLVKENGHAY-FISVLSSPQIPA  648

Query  221  LACGYLRNLT-WTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                  R ++ + LS +C N  P      +  +LP  +  L+  DP V       ++ + 
Sbjct  649  DQ----RTMSAFVLSTICNNCRPGQNACLIGNLLPICLSQLNDPDPMVRRWMILCMAKMW  704

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV---TGTDEQTQVVID-AG  335
            +   E     +K     +L  LL      +   A+ A+G ++    G++++T + ++ A 
Sbjct  705  ENFEEAKWAAIKENAHEKLCLLLTDVSPEVRASAVVALGELIGGAEGSEQRTNIELNLAL  764

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             LAV   +  +    ++KE   ++S I +  +    QV
Sbjct  765  TLAV---ITADCSPMVRKELVISLSRIVSSYESNFVQV  799


> sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Mesorhizobium 
japonicum (strain LMG 29417 / CECT 9101 / MAFF 
303099) OX=266835 GN=dapE PE=3 SV=1
Length=397

 Score = 34.7 bits (78),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 7/78 (9%)

Query  101  RKLLSREKQPPIDNII--RAGLIPKFVSFLGRTDCSPIQFESAWA----LTNIASGTSEQ  154
            R + S +  P I+N+   R+G  P  + F G TD  P+  E+AW        IA+G    
Sbjct  44   RPVFSEDGTPDIENLYARRSGNGPHLM-FAGHTDVVPVGDEAAWTHPPFAAEIANGEMYG  102

Query  155  TKAVVDGGAIPAFISLLA  172
              AV   G I  F++ +A
Sbjct  103  RGAVDMKGGIACFVAAIA  120


> sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein 
kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
Length=2527

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 40/72 (56%), Gaps = 5/72 (7%)

Query  261  HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE--LPIVTPALRAIG  318
            H   PEV    C  +++L +G N  + ++    VVP+++ ++   E  LP+   ALRAI 
Sbjct  452  HIHSPEVAESGCKMLNHLFEGSNTSLDIM--AAVVPKILTVMKRHETSLPVQLEALRAIL  509

Query  319  N-IVTGTDEQTQ  329
            + IV G  E+++
Sbjct  510  HFIVPGMPEESR  521


> sp|Q5PPZ9|GDS1B_XENLA Rap1 GTPase-GDP dissociation stimulator 
1-B OS=Xenopus laevis OX=8355 GN=rap1gds1-b PE=2 SV=1
Length=607

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 50/105 (48%), Gaps = 7/105 (7%)

Query  290  VKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSL-----  343
            V+  ++P LV+LL + +  ++    RA+GNI     E  + V  + GA  V   L     
Sbjct  86   VEADLIPPLVQLLHSKDQEVLLQTGRALGNICYDNHEGRRTVDQEGGAQIVVDHLRSRCT  145

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVLS  387
            LT+P +         M    +   D +Q Q++  G++P LV +L+
Sbjct  146  LTDPSSEKLMTVFCGMLMNYSSENDSLQTQLIQMGVIPILVDLLA  190


> sp|E4NKF8|PUB1_MEDTR U-box domain-containing protein 1 OS=Medicago 
truncatula OX=3880 GN=PUB1 PE=1 SV=1
Length=694

 Score = 34.3 bits (77),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 41/87 (47%), Gaps = 10/87 (11%)

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            L    T+IQ+++ + +  +     D  + +   G +PFLV++L   D + Q+  V A+ N
Sbjct  412  LATGSTDIQRQSAYEIRLLAKTGMDNRRIIAEVGAIPFLVTLLVSKDSRIQEHVVTALFN  471

Query  404  YT----------SGGTVEQIVYLVHCG  420
             +          + G ++ IV ++  G
Sbjct  472  LSIYDNNKILIMAAGAIDNIVEVLEFG  498


> sp|Q9FZ06|KINUA_ARATH Kinesin-like protein KIN-UA OS=Arabidopsis 
thaliana OX=3702 GN=KINUA PE=1 SV=1
Length=919

 Score = 34.3 bits (77),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 35/169 (21%), Positives = 74/169 (44%), Gaps = 7/169 (4%)

Query  108  KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAF  167
            ++PP+  +     + K +S L   D + ++  +   + N+A+  + Q + V  GG     
Sbjct  649  EKPPVARLFEQVGLQKILSLLEAED-ADVRIHAVKVVANLAAEEANQQQIVEAGGLTSLL  707

Query  168  ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
            + L  +    I   A  A+ N+A +    ++L++  G +     LL+    ++     LR
Sbjct  708  MLLKNTEDETIHRVAAGAIANLAMN-ETNQELIMDQGGI----GLLSSTAANAEDPQTLR  762

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             +   ++NLC N      + + E  +  L+ ++    P+VLA     I+
Sbjct  763  MVAGAIANLCGNDKLQTKLRS-EGGIAALLGMVRCGHPDVLAQVARGIA  810


> sp|Q9VM21|GUDU_DROME Armadillo repeat-containing protein gudu 
OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
Length=669

 Score = 33.9 bits (76),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 60/147 (41%), Gaps = 13/147 (9%)

Query  139  ESAWALTNIASGTSEQTK------AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD  192
            E    LTN+    SE  +       +   G +PA +SLL S HA + E     L   A D
Sbjct  389  ECDEVLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAED  448

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN-PAPPIDAVEQ  251
                R ++    AV  + +LL  P     A     +  + +    RN N  A  + ++  
Sbjct  449  PDSMR-ILEDLDAVRLIWSLLKNPTTRVQA-----HAAYAICPCVRNANDSAELVRSLVG  502

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYL  278
             +  +V LL   D  VL+  C AI+ +
Sbjct  503  AMELVVGLLKSKDIMVLSAVCAAIATI  529


> sp|O27881|IORB_METTH Indolepyruvate oxidoreductase subunit IorB 
OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 
/ DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 
GN=iorB PE=3 SV=1
Length=196

 Score = 33.1 bits (74),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 8/70 (11%)

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            G+I  DG    DLV+ +   +PL A+ A+P MS  +   L        NL R+ +P PP+
Sbjct  59   GSIIPDGEA--DLVLAF---EPLEAIRALPKMSEESEVILNTSVIPPFNLMRSPHPYPPL  113

Query  247  DAVEQILPTL  256
            D   +I+ TL
Sbjct  114  D---EIMSTL  120


> sp|Q8BJY1|PSMD5_MOUSE 26S proteasome non-ATPase regulatory subunit 
5 OS=Mus musculus OX=10090 GN=Psmd5 PE=1 SV=4
Length=504

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 77/199 (39%), Gaps = 22/199 (11%)

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            PI     +   L R L H D  V   T   I  + +       ++    ++ Q+V  +G 
Sbjct  77   PIHLARNLRLDLQRGLTHPDDSVKTLTLSQIGRIVENSEAVTEILNNAELLKQIVYCIGG  136

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK-------EATW  357
              L +   A++++  I          +  AG  A+F S L +   N+ K           
Sbjct  137  ENLSVAKAAIKSLSRI---------SLTQAGLEALFESNLLDDLKNVMKTNDVVRYRVYE  187

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN--YTSGGTVEQIVY  415
             + +I++   + +      GLV  L+  L+  D   +   +  VT+  YT  G      Y
Sbjct  188  LIIDISSVSSESLNYCTTSGLVTQLLKELTGEDVLVRATCIEMVTSLAYTHHGR----QY  243

Query  416  LVHCGIIEPLMNLLTAKDT  434
            L   G+I+ + N++   D+
Sbjct  244  LAQEGVIDQISNIIVGADS  262


> sp|Q10FT0|PUB24_ORYSJ U-box domain-containing protein 24 OS=Oryza 
sativa subsp. japonica OX=39947 GN=PUB24 PE=1 SV=1
Length=824

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 52/128 (41%), Gaps = 2/128 (2%)

Query  157  AVVDGG-AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV  215
            A  DGG A+   ++ L      + E A+ AL  +  DG   R+ V+  G  D L  ++ +
Sbjct  688  AQADGGKAVERLVACLDHLDGRVVEAALAALSTLVCDGVDAREGVVVLGEADGLRPVVDI  747

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
              + S      R   W +  + R +  A  + A + +   LV    + DP        A+
Sbjct  748  M-VESRTEALQRRAVWAVERILRVEEIAGEVAADQTVASALVEAYRNGDPRTRQTAERAL  806

Query  276  SYLTDGPN  283
             +L   PN
Sbjct  807  RHLDRIPN  814


> sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 
47 OS=Mus musculus OX=10090 GN=Lrrc47 PE=1 SV=1
Length=581

 Score = 33.5 bits (75),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 54/116 (47%), Gaps = 13/116 (11%)

Query  326  EQTQVVIDA-GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS  384
            E    ++DA G +  FP +  + KT I+K        +T+    Q+ + +   L+   ++
Sbjct  445  ENYPCLVDAEGDVISFPPITNSEKTKIKKTTCNLFLEVTSATSLQLCKDIMDSLI-LRMA  503

Query  385  VLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVI  440
             LSK+  + ++E + + T   +G           CG+ +P + L + KD +  LV+
Sbjct  504  ELSKSTSENKEEDMLSGTEADAG-----------CGLSDPNLTLSSGKDGQCPLVV  548


> sp|Q8CPZ0|UVRB_STAES UvrABC system protein B OS=Staphylococcus 
epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=uvrB 
PE=3 SV=1
Length=661

 Score = 33.5 bits (75),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  73   TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
            T+N  + D++     S+  NQ Q T+  +K+  +E+Q  I+NI
Sbjct  589  TINKKIHDVISATVESDETNQQQQTELPKKMTKKERQKTIENI  631


> sp|Q5HQX0|UVRB_STAEQ UvrABC system protein B OS=Staphylococcus 
epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=uvrB 
PE=3 SV=1
Length=661

 Score = 33.5 bits (75),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  73   TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
            T+N  + D++     S+  NQ Q T+  +K+  +E+Q  I+NI
Sbjct  589  TINKKIHDVISATVESDETNQQQQTELPKKMTKKERQKTIENI  631


> sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis 
thaliana OX=3702 GN=PUB3 PE=2 SV=2
Length=760

 Score = 33.1 bits (74),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 61/152 (40%), Gaps = 7/152 (5%)

Query  62   SPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKL-LSREKQPPIDNIIRAGL  120
            S LQ NR   G  N ++  +V  +       +  A  A   L ++ + +     I++A  
Sbjct  583  SVLQVNRERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKA---RIVQAKA  639

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +   V  L   D      + A AL    S   E  +A+V  G IP  +  +        E
Sbjct  640  VKYLVELL---DPDLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKE  696

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL  212
             A   L  +  +   F  LV++ GA+ PL+AL
Sbjct  697  NAASVLLQLCLNSPKFCTLVLQEGAIPPLVAL  728


> sp|Q640C5|DOPDB_XENLA D-dopachrome decarboxylase-B OS=Xenopus 
laevis OX=8355 GN=ddt-b PE=3 SV=1
Length=118

 Score = 31.2 bits (69),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 36/72 (50%), Gaps = 7/72 (10%)

Query  259  LLHHDDPEVLADT-CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
            L   + P+ LA+  C A + +   P ER+ + V+TGV      ++G S  P     + +I
Sbjct  10   LQQQEVPQDLAEKLCSATATILGKPRERVNVTVRTGV----SMVVGGSSAPCTQLIISSI  65

Query  318  GNIVTGTDEQTQ  329
            G  V GT EQ +
Sbjct  66   G--VVGTAEQNK  75


> sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis 
thaliana OX=3702 GN=PUB15 PE=2 SV=2
Length=660

 Score = 32.7 bits (73),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 76/172 (44%), Gaps = 8/172 (5%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            +   +  L+S       ++V  +  +A +    R L+   GA+  L+ LL+ PD      
Sbjct  381  VSLLVEALSSSQLEEQRRSVKQMRLLARENPENRVLIANAGAIPLLVQLLSYPD-----S  435

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
            G   N   TL NL  ++     I + E  +P ++ +L + + E   ++  A+  L+    
Sbjct  436  GIQENAVTTLLNLSIDEVNKKLI-SNEGAIPNIIEILENGNREARENSAAALFSLSMLDE  494

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG  335
             ++ + +  G +P LV LL    L     AL A+ N+   +  + +  IDAG
Sbjct  495  NKVTIGLSNG-IPPLVDLLQHGTLRGKKDALTALFNLSLNSANKGR-AIDAG  544



Lambda      K        H        a         alpha
   0.315    0.132    0.377    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 54217231880
Results from round 2


Query= sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens
OX=9606 GN=KPNA2 PE=1 SV=1

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens O...   753    0.0   
  sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus O...   738    0.0   
  sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis t...   656    0.0   
  sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis...   650    0.0   
  sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis t...   645    0.0   
  sp|G5EB89|KAPA_EMENI Importin subunit alpha OS=Emericella nidul...   643    0.0   
  sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis...   639    0.0   
  sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa...   636    0.0   
  sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersi...   635    0.0   
  sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis t...   634    0.0   
  sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa...   628    0.0   
  sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis t...   628    0.0   
  sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis t...   625    0.0   
  sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio OX...   620    0.0   
  sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharo...   620    0.0   
  sp|B6HJ92|KAPA_PENRW Importin subunit alpha OS=Penicillium rube...   620    0.0   
  sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus OX=...   618    0.0   
  sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens O...   616    0.0   
  sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii O...   617    0.0   
  sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens O...   617    0.0   
  sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus O...   616    0.0   
  sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus O...   615    0.0   
  sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus O...   609    0.0   
  sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens O...   609    0.0   
  sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens O...   605    0.0   
  sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicu...   600    0.0   
  sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus ...   594    0.0   
  sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces ce...   593    0.0   
  sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens O...   592    0.0   
  sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus OX=...   591    0.0   
  sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharo...   591    0.0   
  sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus OX=...   589    0.0   
  sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii O...   588    0.0   
  sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens O...   588    0.0   
  sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus O...   584    0.0   
  sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis t...   581    0.0   
  sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicu...   581    0.0   
  sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium ...   577    0.0   
  sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa OX=98...   563    0.0   
  sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis...   562    0.0   
  sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melano...   543    0.0   
  sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis t...   534    0.0   
  sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus O...   532    0.0   
  sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dict...   480    1e-162
  sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis...   468    5e-158
  sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis t...   423    1e-141
  sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa ...   329    3e-104
  sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis t...   321    2e-101
  sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis...   299    9e-93 
  sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (str...   295    9e-91 
  sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata...   293    1e-89 
  sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (...   292    1e-89 
  sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (s...   287    1e-87 
  sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica ...   277    8e-84 
  sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoform...   277    3e-83 
  sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoform...   277    3e-83 
  sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum ...   266    1e-79 
  sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis...   264    7e-79 
  sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (st...   255    3e-75 
  sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hanseni...   251    3e-74 
  sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (st...   248    1e-72 
  sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevi...   247    2e-72 
  sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (str...   246    2e-72 
  sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastori...   242    6e-71 
  sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces ...   240    4e-70 
  sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Ar...   234    2e-66 
  sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 O...   207    4e-57 
  sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=...   192    8e-51 
  sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=...   188    1e-49 
  sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus OX=1011...   170    3e-44 
  sp|Q7Z5J8|ANKAR_HUMAN Ankyrin and armadillo repeat-containing p...   172    8e-44 
  sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris ...   168    2e-43 
  sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=C...   168    2e-43 
  sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 GN...   168    2e-43 
  sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus OX=10090 G...   168    2e-43 
  sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculu...   165    3e-43 
  sp|F1QGH7|CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=...   167    4e-43 
  sp|P26233|CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 ...   167    5e-43 
  sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapien...   160    1e-41 
  sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Ara...   160    5e-41 
  sp|Q8IUR7|ARMC8_HUMAN Armadillo repeat-containing protein 8 OS=...   152    4e-38 
  sp|Q2KI54|ARMC8_BOVIN Armadillo repeat-containing protein 8 OS=...   150    1e-37 
  sp|Q5R6S3|ARMC8_PONAB Armadillo repeat-containing protein 8 OS=...   150    1e-37 
  sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabi...   143    5e-35 
  sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabid...   143    1e-34 
  sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabi...   135    3e-32 
  sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoide...   120    2e-27 

Sequences not found previously or not previously below threshold:

  sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing p...   162    1e-40
  sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo OX=6431 PE=2...   157    1e-39
  sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla OX=76...   154    2e-38
  sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anoph...   152    6e-38
  sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes...   152    8e-38
  sp|Q9DBR3|ARMC8_MOUSE Armadillo repeat-containing protein 8 OS=...   146    4e-36
  sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Droso...   142    1e-34
  sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Droso...   141    2e-34
  sp|Q68FK4|ARMC8_XENLA Armadillo repeat-containing protein 8 OS=...   137    4e-33
  sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Ara...   136    8e-33
  sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabi...   137    8e-33
  sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca...   135    2e-32
  sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Ory...   130    4e-31
  sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabi...   130    8e-31
  sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis OX=...   125    4e-29
  sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza...   121    6e-28
  sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa su...   121    6e-28
  sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabi...   120    1e-27
  sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa OX=9823 G...   120    2e-27
  sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=96...   120    2e-27
  sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus OX=9913...   120    2e-27
  sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10...   119    4e-27
  sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus OX...   119    5e-27
  sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Ara...   117    1e-26
  sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=...   115    7e-26
  sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Ara...   115    9e-26
  sp|F4I718|CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 O...   114    2e-25
  sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Ara...   112    5e-25
  sp|Q9VM21|GUDU_DROME Armadillo repeat-containing protein gudu O...   112    6e-25
  sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thali...   110    3e-24
  sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabid...   108    2e-23
  sp|E4NKF8|PUB1_MEDTR U-box domain-containing protein 1 OS=Medic...   105    1e-22
  sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Ara...   105    2e-22
  sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=...   104    3e-22
  sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thali...   104    3e-22
  sp|Q9C7G1|PUB45_ARATH U-box domain-containing protein 45 OS=Ara...   104    4e-22
  sp|O44326|HMP2_CAEEL Beta-catenin-like protein hmp-2 OS=Caenorh...   102    1e-21
  sp|A8HNV0|RSP14_CHLRE Radial spoke protein 14 OS=Chlamydomonas ...  98.9    4e-21
  sp|Q9UQB3|CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 G...  97.8    6e-20
  sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 1 ...  95.1    2e-19
  sp|O95996|APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Ho...  95.5    4e-19
  sp|Q9C6Y4|CSI2_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 2 O...  94.7    6e-19
  sp|Q68FH0|PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=...  94.3    7e-19
  sp|Q05AL1|ARMC8_DANRE Armadillo repeat-containing protein 8 OS=...  93.9    7e-19
  sp|Q9C7R6|PUB17_ARATH U-box domain-containing protein 17 OS=Ara...  93.5    9e-19
  sp|Q99569|PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=P...  92.8    2e-18
  sp|Q96DC7|TMCO6_HUMAN Transmembrane and coiled-coil domain-cont...  90.8    4e-18
  sp|O35927|CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 ...  91.6    5e-18
  sp|O93614|GDS1A_XENLA Rap1 GTPase-GDP dissociation stimulator 1...  90.5    9e-18
  sp|P70478|APC_RAT Adenomatous polyposis coli protein OS=Rattus ...  88.5    6e-17
  sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Hom...  88.1    7e-17
  sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus...  88.1    7e-17
  sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos...  88.1    7e-17
  sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattu...  88.1    8e-17
  sp|Q61315|APC_MOUSE Adenomatous polyposis coli protein OS=Mus m...  88.1    8e-17
  sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arab...  87.8    9e-17
  sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xen...  87.8    9e-17
  sp|O80742|PUB19_ARATH U-box domain-containing protein 19 OS=Ara...  87.4    9e-17
  sp|P25054|APC_HUMAN Adenomatous polyposis coli protein OS=Homo ...  87.8    9e-17
  sp|Q9D3W1|RSP14_MOUSE Radial spoke head 14 homolog OS=Mus muscu...  85.1    1e-16
  sp|P52306|GDS1_HUMAN Rap1 GTPase-GDP dissociation stimulator 1 ...  87.0    1e-16
  sp|Q5PPZ9|GDS1B_XENLA Rap1 GTPase-GDP dissociation stimulator 1...  87.0    1e-16
  sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Ara...  86.6    1e-16
  sp|Q28161|PKP1_BOVIN Plakophilin-1 OS=Bos taurus OX=9913 GN=PKP...  86.2    2e-16
  sp|P70039|APC_XENLA Adenomatous polyposis coli homolog OS=Xenop...  85.4    6e-16
  sp|F4IIM1|CSI1_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 1 O...  85.4    6e-16
  sp|Q5EBP3|ARMC5_MOUSE Armadillo repeat-containing protein 5 OS=...  84.7    7e-16
  sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Dan...  84.3    1e-15
  sp|Q9LPC6|KINUB_ARATH Kinesin-like protein KIN-UB OS=Arabidopsi...  82.4    4e-15
  sp|Q0DV28|KINUA_ORYSJ Kinesin-like protein KIN-UA OS=Oryza sati...  82.0    6e-15
  sp|Q9Z1K7|APCL_MOUSE Adenomatous polyposis coli protein 2 OS=Mu...  82.4    6e-15
  sp|Q5VQ09|KINUB_ORYSJ Kinesin-like protein KIN-UB OS=Oryza sati...  81.6    7e-15
  sp|Q6EUK7|PUB04_ORYSJ U-box domain-containing protein 4 OS=Oryz...  80.4    2e-14
  sp|Q10FT0|PUB24_ORYSJ U-box domain-containing protein 24 OS=Ory...  80.1    2e-14
  sp|Q9FZ06|KINUA_ARATH Kinesin-like protein KIN-UA OS=Arabidopsi...  80.1    2e-14
  sp|Q9SFX2|PUB43_ARATH U-box domain-containing protein 43 OS=Ara...  79.3    3e-14
  sp|P97350|PKP1_MOUSE Plakophilin-1 OS=Mus musculus OX=10090 GN=...  79.3    3e-14
  sp|Q9FJP6|PUB38_ARATH U-box domain-containing protein 38 OS=Ara...  78.5    4e-14
  sp|Q8AXM9|CTND1_XENLA Catenin delta-1 OS=Xenopus laevis OX=8355...  78.5    6e-14
  sp|Q9QY23|PKP3_MOUSE Plakophilin-3 OS=Mus musculus OX=10090 GN=...  78.5    6e-14
  sp|Q9Y446|PKP3_HUMAN Plakophilin-3 OS=Homo sapiens OX=9606 GN=P...  78.1    9e-14
  sp|Q9XIJ5|PUB18_ARATH U-box domain-containing protein 18 OS=Ara...  77.7    9e-14
  sp|Q8BQX5|TMCO6_MOUSE Transmembrane and coiled-coil domain-cont...  77.0    1e-13
  sp|P30999|CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 ...  77.7    1e-13
  sp|Q9U308|JAC1_CAEEL Juxtamembrane domain-associated catenin OS...  77.4    1e-13


> sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens 
OX=9606 GN=KPNA2 PE=1 SV=1
Length=529

 Score =  753 bits (1944),  Expect = 0.0, Method: Composition-based stats.
 Identities = 529/529 (100%), Positives = 529/529 (100%), Gaps = 0/529 (0%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA
Sbjct  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL
Sbjct  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
Sbjct  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK
Sbjct  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK
Sbjct  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS
Sbjct  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG
Sbjct  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE
Sbjct  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF
Sbjct  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529


> sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus 
OX=10090 GN=Kpna2 PE=1 SV=2
Length=529

 Score =  738 bits (1906),  Expect = 0.0, Method: Composition-based stats.
 Identities = 500/529 (95%), Positives = 519/529 (98%), Gaps = 0/529 (0%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MSTNENAN PAARL+RFKNKGKDSTEMRRRRIEVNVELRKAKKD+QMLKRRNVSSFPDDA
Sbjct  1    MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDA  60

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            TSPLQENRNNQGTVNWSV+DIVKGINS+N+E+QLQATQAARKLLSREKQPPIDNIIRAGL
Sbjct  61   TSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGL  120

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            IPKFVSFLG+TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
Sbjct  121  IPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGDGS FRDLVIK+GA+DPLLALLAVPD+S+LACGYLRNLTWTLSNLCRNK
Sbjct  181  QAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNK  240

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            NPAPP+DAVEQILPTLVRLLHH+DPEVLAD+CWAISYLTDGPNERI MVVK GVVPQLVK
Sbjct  241  NPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVK  300

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LLGA+ELPIVTPALRAIGNIVTGTDEQTQ VIDAGALAVFPSLLTNPKTNIQKEATWTMS
Sbjct  301  LLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAGRQDQIQQVVNHGLVPFLV VLSKADFKTQKEA WA+TNYTSGGTVEQIVYLVHCG
Sbjct  361  NITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCG  420

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            IIEPLMNLL+AKDTKII VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQ HE
Sbjct  421  IIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHE  480

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            NESVYKASL+LIEKYFSVEEEEDQNVVPETTSEG+ FQVQDGAPGTFNF
Sbjct  481  NESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF  529


> sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA1 PE=1 SV=2
Length=532

 Score =  656 bits (1692),  Expect = 0.0, Method: Composition-based stats.
 Identities = 246/545 (45%), Positives = 341/545 (63%), Gaps = 30/545 (6%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRN-----VSS  55
            MS   NA T   R +R+K    D+ E RRRR +  VE+RK+K+++ ++K+R      +  
Sbjct  1    MSLRPNAKTEV-RRNRYK-VAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQG  58

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
            FP  + + + +  +       S+ D+V G+ S +   QL++T   RKLLS E+ PPI+ +
Sbjct  59   FPSASAASVDKKLD-------SLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEV  111

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
            I AG++P+FV FL + D   IQFE+AWALTNIASGTS+ TK V+D  A+P F+ LLASP 
Sbjct  112  ISAGVVPRFVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPS  171

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGN+AGD    RDLV+  GA+ PLL  L            LRN TWTLSN
Sbjct  172  DDVREQAVWALGNVAGDSPRCRDLVLGCGALLPLLNQLNEH----AKLSMLRNATWTLSN  227

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
             CR K P P  D V+  LP L RL+H DD EVL D CWA+SYL+DG N++I  V++ GVV
Sbjct  228  FCRGK-PQPHFDQVKPALPALERLIHSDDEEVLTDACWALSYLSDGTNDKIQTVIQAGVV  286

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKE  354
            P+LV+LL      ++ PALR +GNIVTG D QTQ VI++GAL    +LL  N K +I+KE
Sbjct  287  PKLVELLLHHSPSVLIPALRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKSIKKE  346

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIV  414
            A WT+SNITAG +DQIQ VV   L+  LVS+L  A+F  +KEA WA++N TSGG+ +QI 
Sbjct  347  ACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIK  406

Query  415  YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL------GETEKLSIMIEECG  468
            YLV  G I+PL +LL   D +II V L+ + NI +  E        G+    + +I++  
Sbjct  407  YLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAE  466

Query  469  GLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVP--ETTSEGYTFQVQ--DGAP  524
            GL+KIE LQ+H+N  +Y+ ++ ++E Y+  EE+++    P  + +  G+ F         
Sbjct  467  GLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVPS  526

Query  525  GTFNF  529
            G FNF
Sbjct  527  GGFNF  531


> sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis 
OX=8355 GN=kpna1 PE=1 SV=2
Length=522

 Score =  650 bits (1678),  Expect = 0.0, Method: Composition-based stats.
 Identities = 328/525 (62%), Positives = 408/525 (78%), Gaps = 4/525 (1%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
               N    R+ +FKNKGKD+ E+RRRR+EV+VELRKAKKD+Q+LKRRNV    +   SP 
Sbjct  2    PTTNEADERMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNVCLPEELILSPE  61

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            +    +      S+++IV+G+NS + EN+L+ TQAARK+LSRE+ PP+++II AGLIPK 
Sbjct  62   KNAMQSVQVPPLSLEEIVQGMNSGDPENELRCTQAARKMLSRERNPPLNDIIEAGLIPKL  121

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V FL R D S +QFE+AWALTNIASGTS+QTK+VVDGGAIPAFISL++SPH HISEQAVW
Sbjct  122  VEFLSRHDNSTLQFEAAWALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVW  181

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNIAGDG ++RD +I    + PLLAL+          GYLRN+TW LSNLCRNKNP P
Sbjct  182  ALGNIAGDGPLYRDALINCNVIPPLLALVN----PQTPLGYLRNITWMLSNLCRNKNPYP  237

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P+ AV QILP L +L+HHDD ++L+DTCWA+SYLTDG N+RI +VVKTG+V +L++L+ +
Sbjct  238  PMSAVLQILPVLTQLMHHDDKDILSDTCWAMSYLTDGSNDRIDVVVKTGIVDRLIQLMYS  297

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             EL IVTP+LR +GNIVTGTD+QTQ  IDAG L+V P LL + K +IQKEA W +SNI A
Sbjct  298  PELSIVTPSLRTVGNIVTGTDKQTQAAIDAGVLSVLPQLLRHQKPSIQKEAAWAISNIAA  357

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G   QIQQ++  GL+  LV +L+K DFK QKEAVWAVTNYTSGGTVEQ+V LV CG++EP
Sbjct  358  GPAPQIQQMITCGLLSPLVDLLNKGDFKAQKEAVWAVTNYTSGGTVEQVVQLVQCGVLEP  417

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
            L+NLLT KD+K ILVILDAISNIF AAEKLGE EKL +++EE GGL+KIEALQ H+N  V
Sbjct  418  LLNLLTIKDSKTILVILDAISNIFLAAEKLGEQEKLCLLVEELGGLEKIEALQTHDNHMV  477

Query  485  YKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            Y A+L+LIEKYFS EE +D  + PE   + YTFQV +    +FNF
Sbjct  478  YHAALALIEKYFSGEEADDIALEPEMGKDAYTFQVPNMQKESFNF  522


> sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA2 PE=1 SV=1
Length=535

 Score =  645 bits (1663),  Expect = 0.0, Method: Composition-based stats.
 Identities = 248/544 (46%), Positives = 345/544 (63%), Gaps = 25/544 (5%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRR----NVSSF  56
            MS   NA T   R +R+K    D+ E RRRR +  VE+RK+K+++ + K+R      +  
Sbjct  1    MSLRPNAKTEV-RRNRYK-VAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQL  58

Query  57   PDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
            P  A SP+  +   +  +  S+  +V G+ S +   QL+AT   RKLLS E+ PPI+ +I
Sbjct  59   PQFAPSPVPASSTVEKKLE-SLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVI  117

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA  176
             AG++P+FV FL R D   +QFE+AWALTNIASGTSE TK V++ GA+P F+ LLAS   
Sbjct  118  DAGVVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSD  177

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             + EQAVWALGN+AGD    RDLV+  GA+ PLL+ L            LRN TWTLSN 
Sbjct  178  DVREQAVWALGNVAGDSPRCRDLVLGQGALIPLLSQLNEH----AKLSMLRNATWTLSNF  233

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
            CR K P PP D V   LP L RL+H  D EVL D CWA+SYL+DG N++I  V++ GVVP
Sbjct  234  CRGK-PQPPFDQVRPALPALERLIHSTDEEVLTDACWALSYLSDGTNDKIQSVIEAGVVP  292

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGA-LAVFPSLLTNPKTNIQKEA  355
            +LV+LL      ++ PALR+IGNIVTG D QTQ VI  GA L++   L  N K +I+KEA
Sbjct  293  RLVELLQHQSPSVLIPALRSIGNIVTGDDLQTQCVISHGALLSLLSLLTHNHKKSIKKEA  352

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG +DQIQ V   GL+  LV++L  A+F  +KEA WA++N TSGG+ +QI Y
Sbjct  353  CWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSGGSPDQIKY  412

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE------KLGETEKLSIMIEECGG  469
            +V  G+++PL +LL   D +II V L+ + NI +  E        G+    + +I++  G
Sbjct  413  MVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEG  472

Query  470  LDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVP-ETTSEGYTFQVQDG---APG  525
            L+KIE LQ+H+N  +Y+ ++ ++E Y+   EEED+ + P + +++G+ F   +     PG
Sbjct  473  LEKIENLQSHDNSEIYEKAVKILETYWL--EEEDETLPPGDPSAQGFQFGGGNDAAVPPG  530

Query  526  TFNF  529
             FNF
Sbjct  531  GFNF  534


> sp|G5EB89|KAPA_EMENI Importin subunit alpha OS=Emericella nidulans 
(strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / 
M139) OX=227321 GN=kapA PE=1 SV=1
Length=553

 Score =  643 bits (1659),  Expect = 0.0, Method: Composition-based stats.
 Identities = 242/541 (45%), Positives = 338/541 (62%), Gaps = 26/541 (5%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDD--------A  60
            P  R  ++K + +    E+RRRR E  VE+RK K+++ + KRR + +            A
Sbjct  7    PEHRRTQYKARNQFRPDELRRRREEQQVEIRKQKREENLAKRRGIQTRDGGIGVGGGMAA  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                 E    +  +N  + ++VKG+ S  +E Q+QAT   RKLLS+E+ PPI+ +I  G+
Sbjct  67   AESDDEASAIESELNVELPEMVKGVFSDQIEAQIQATTKFRKLLSKERNPPIERVIETGV  126

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + +FV FL R+  + +QFE+AWALTNIASG+++QT+ V++ GA+P F+ LL+SP   + E
Sbjct  127  VSRFVEFL-RSPHTLVQFEAAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVRE  185

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGD    RD V+  GA+ PLL L+            LRN TWTLSN CR K
Sbjct  186  QAVWALGNIAGDSPQCRDFVLNAGALRPLLTLIND----GRKISMLRNATWTLSNFCRGK  241

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P P  + +   LP L +L++  D EVL D CWAISYL+DGPNE+I  V++ G+  +LV+
Sbjct  242  TPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGPNEKIQAVIEAGIPRRLVE  301

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL  +   + TPALR++GNIVTG D QTQV+I+ GAL    SLL++ K  I+KEA WT+S
Sbjct  302  LLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPALLSLLSSTKDGIRKEACWTIS  361

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVH  418
            NITAG   QIQ V++ G++P LV +L+  DFKT+KEA WA++N TSGG    +QI YLV 
Sbjct  362  NITAGNSSQIQSVIDAGIIPPLVHLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVT  421

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-------EKLSIMIEECGGLD  471
             G I+PL +LL   D KII V LD + NI +  E   E         + ++ IEE GG++
Sbjct  422  QGCIKPLCDLLACPDNKIIQVALDGLENILKVGEMDKEAGQGDAHVNRYALFIEEAGGME  481

Query  472  KIEALQNHENESVYKASLSLIEKYFSVEEEEDQNV---VPETTSEGYTFQVQDGAPGTFN  528
            KI   QN+ NE +Y  + ++IEKYFS E+E   ++    P+ T  G+T       PG F+
Sbjct  482  KIHDCQNNANEEIYMKAYNIIEKYFSDEDEAAGDIDELAPQQTQTGFTLGATQQQPGGFS  541

Query  529  F  529
            F
Sbjct  542  F  542


> sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis 
OX=8355 GN=kpna2 PE=1 SV=2
Length=523

 Score =  639 bits (1648),  Expect = 0.0, Method: Composition-based stats.
 Identities = 321/526 (61%), Positives = 407/526 (77%), Gaps = 5/526 (1%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
               N    R+ +FKNKGKD+ E+RRRR+EV+VELRKAKKD+Q+LKRRNV    +   SP 
Sbjct  2    PTTNEADERMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNVCFPEELILSPE  61

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            +    +      S+++IV+G+NS + EN+L++TQAARK+LS+E+ PP+++II AGLIPK 
Sbjct  62   KNAMQSIQVPQLSLEEIVQGMNSGDNENELRSTQAARKMLSKERNPPLNDIIEAGLIPKL  121

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V FL   + S +QFE+AWALTNIASGTS+QTK+VVDGGAIPAFISL++SPH HISEQAVW
Sbjct  122  VEFLSYHNNSTLQFEAAWALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVW  181

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNIAGDG ++RD +I    + PLL L+          GYLRN+TWTLSNLCRNKNP P
Sbjct  182  ALGNIAGDGPLYRDALISCNVIPPLLTLVN----PQTPLGYLRNITWTLSNLCRNKNPYP  237

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P+ AV QILP L +L+ H+D ++L+DTCWA+SYLTDG N+RI +VVKTG+V +L++L+ +
Sbjct  238  PMSAVLQILPVLTQLMLHEDKDILSDTCWAMSYLTDGSNDRIDVVVKTGLVERLIQLMYS  297

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             EL I+TP+LR +GNIVTGTD+QTQ  IDAG L+V P LL + K +IQKEA W +SNI A
Sbjct  298  PELSILTPSLRTVGNIVTGTDKQTQAAIDAGVLSVLPQLLRHQKPSIQKEAAWALSNIAA  357

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G   QIQQ++  GL+  LV +L K DFK QKEAVWAVTNYTSGGTVEQ+V LV CG++EP
Sbjct  358  GPAPQIQQMITCGLLSPLVDLLKKGDFKAQKEAVWAVTNYTSGGTVEQVVQLVQCGVLEP  417

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
            L+NLLT KD+K ILVILDAISNIF AAEKLGE EKL +++EE GGL+KIEALQ H+N  V
Sbjct  418  LLNLLTIKDSKTILVILDAISNIFLAAEKLGEQEKLCLLVEELGGLEKIEALQTHDNRMV  477

Query  485  YKASLSLIEKYFSVEEEEDQN-VVPETTSEGYTFQVQDGAPGTFNF  529
            Y A+L+LIEKYFS EE ++ N + PE  ++ YTFQV +    +F F
Sbjct  478  YHAALALIEKYFSGEEADEMNALEPEVGNDAYTFQVPNMQKESFKF  523


> sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os05g0155601 PE=1 SV=2
Length=534

 Score =  636 bits (1640),  Expect = 0.0, Method: Composition-based stats.
 Identities = 236/541 (44%), Positives = 332/541 (61%), Gaps = 20/541 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRN----VSSF  56
            MS   +      R  R+K    D+ E RRRR +  VE+RK+++++ +LK+R      ++ 
Sbjct  1    MSLRPSERAEV-RRSRYK-VAVDADEGRRRREDNMVEIRKSRREESLLKKRRDGLPAAAA  58

Query  57   PDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
               A SPL  + +        +  +V+ + S +   QL+AT   RKLLS E+ PPI+ +I
Sbjct  59   AAAAASPLLAHSSALQQKLEGLPAMVQAVQSDDSAVQLEATTQFRKLLSIERSPPIEEVI  118

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA  176
              G++P+F++FL R D   +QFE+AWALTNIASGTS+ TK VV+ GA+P F+ LL+SP  
Sbjct  119  NTGVVPRFIAFLQREDYPQLQFEAAWALTNIASGTSDNTKVVVESGAVPIFVKLLSSPSE  178

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             + EQAVWALGN+AGD    RDLV+  G + PLL  L            LRN TWTLSN 
Sbjct  179  DVREQAVWALGNVAGDSPKCRDLVLASGGLYPLLQQLNEH----AKLSMLRNATWTLSNF  234

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
            CR K P P  + V+  L  L RL+H  D EVL D CWA+SYL+DG N++I  V+++GV P
Sbjct  235  CRGK-PQPNFEQVKPALSALQRLIHSQDEEVLTDACWALSYLSDGTNDKIQAVIESGVFP  293

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEA  355
            +LV+LL      ++ PALR +GNIVTG D QTQ VID  AL    +LL  N K +I+KEA
Sbjct  294  RLVELLMHPSASVLIPALRTVGNIVTGDDMQTQCVIDHQALPCLLNLLTNNHKKSIKKEA  353

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG ++QIQ V+N  ++  LV +L  A+F  +KEA WA++N TSGGT +QI Y
Sbjct  354  CWTISNITAGNREQIQAVINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKY  413

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL-----GETEKLSIMIEECGGL  470
            LV  G I+PL +LL   D +I+ V L+ + NI +  E       G+    + MI++  GL
Sbjct  414  LVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNSYAQMIDDAEGL  473

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQ--DGAPGTFN  528
            +KIE LQ+H+N  +Y+ ++ ++E Y+  EEE+D     +    G+ F  Q  +   G FN
Sbjct  474  EKIENLQSHDNTEIYEKAVKMLESYWL-EEEDDAMPSGDNAQNGFNFGNQQPNVPSGGFN  532

Query  529  F  529
            F
Sbjct  533  F  533


> sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum 
OX=4081 PE=2 SV=2
Length=527

 Score =  635 bits (1639),  Expect = 0.0, Method: Composition-based stats.
 Identities = 237/538 (44%), Positives = 336/538 (62%), Gaps = 21/538 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   N+ T A R  R+K    D+ E RRRR +  VE+RK K+++ +LK+R         
Sbjct  1    MSLRPNSRTEA-RRSRYK-VAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLQAQQ  58

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                    +    +  ++ +++ G+ S +   QL+ T   RKLLS E+ PPI+ +I++G+
Sbjct  59   FPSTAAVSHLDKKLE-TLPELIAGVWSDDSSLQLECTTQFRKLLSIERNPPIEEVIQSGV  117

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P+FV FL R D   +QFE+AWALTNIASGTSE TK V+D G++P FI LL+SP   + E
Sbjct  118  VPRFVEFLARDDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFIRLLSSPSDDVRE  177

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGD   +RDLV+ +GA+  LLA              LRN TWTLSN CR K
Sbjct  178  QAVWALGNIAGDSPKYRDLVLGHGALVALLAQFNE----QAKLSMLRNATWTLSNFCRGK  233

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P P  +  +  LPTL RL+H +D EVL D CWA+SYL+DG N++I  V++ GV  +LV+
Sbjct  234  -PQPLFEQTKAALPTLGRLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCSRLVE  292

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTM  359
            LL  S   ++ PALR +GNIVTG D QTQV+ID  AL    +LL  N K +I+KEA WT+
Sbjct  293  LLLHSSPSVLIPALRTVGNIVTGDDIQTQVMIDHHALPCLVNLLTQNYKKSIKKEACWTI  352

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG ++QIQ V+  G++  LV +L  A+F+ +KEA WA++N TSGG  +QI +LV  
Sbjct  353  SNITAGNRNQIQIVIEAGIIAPLVYLLQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQ  412

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSI---MIEECGGLDKI  473
            G I+PL +LL   D +I+ V L+ + NI +  E    LG TE +++   +I+E  GL+KI
Sbjct  413  GCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKI  472

Query  474  EALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDG--APGTFNF  529
            E LQ+H+N  +Y+ ++ ++E Y+  EE+   ++      + + F   D     G FNF
Sbjct  473  ENLQSHDNTEIYEKAVKILETYWLEEEDVPVSL----NEDQFEFGGADISLPSGGFNF  526


> sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA3 PE=1 SV=2
Length=531

 Score =  634 bits (1635),  Expect = 0.0, Method: Composition-based stats.
 Identities = 239/537 (45%), Positives = 338/537 (63%), Gaps = 15/537 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFP-DD  59
            MS   +A T   R +R+K    D+ E RRRR +  VE+RK K+++ + K+R  SS     
Sbjct  1    MSLRPSAKTEV-RRNRYK-VAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGS  58

Query  60   ATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG  119
            AT   +++ ++   +  ++  +V GI S +  +QL+AT   RKLLS E+ PPI+ ++++G
Sbjct  59   ATGQTEQDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSG  118

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++P+ V FL R D   +QFE+AWALTNIASGTSE T  +++ GA+P FI LL+S    + 
Sbjct  119  VVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVR  178

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGN+AGD    RDLV+ YGA+ PLL+              LRN TWTLSN CR 
Sbjct  179  EQAVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNEN----TKLSMLRNATWTLSNFCRG  234

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K P P  +  +  LP L RL+   D EVL D CWA+SYL+D  N++I  V++ GVVP+L+
Sbjct  235  K-PPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLI  293

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWT  358
            +LLG S   ++ PALR IGNIVTG D QTQ+V+D  AL    +LL  N K +I+KEA WT
Sbjct  294  QLLGHSSPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWT  353

Query  359  MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
            +SNITAG  DQIQ V++ G++  LV VL  A+F+ +KEA W ++N TSGGT +QI ++V 
Sbjct  354  ISNITAGNADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVS  413

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL------GETEKLSIMIEECGGLDK  472
             G I+PL +LLT  D K++ V L+A+ NI    E        GE    + MI+E  GL+K
Sbjct  414  QGCIKPLCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEK  473

Query  473  IEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
            IE LQ+H+N  +Y  ++ ++E +++ + EE+ N        G+ F   +  PG FNF
Sbjct  474  IENLQSHDNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNF  530


> sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os01g0253300 PE=1 SV=2
Length=526

 Score =  628 bits (1621),  Expect = 0.0, Method: Composition-based stats.
 Identities = 236/528 (45%), Positives = 325/528 (62%), Gaps = 15/528 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   +      R +R+K    D+ E RRRR +  VE+RK+++++ +LK+R        A
Sbjct  1    MSLRPSERVEV-RRNRYK-VAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQ-A  57

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
              P          +  S+  ++ G+ S +   QL+AT   RKLLS E+ PPI+ +I++G+
Sbjct  58   PVPASAATGVDKKLE-SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGV  116

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P+FV FL R D   +QFE+AWALTNIASGTSE TK V+D GA+P F+ LL S    + E
Sbjct  117  VPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVRE  176

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGN+AGD    RDLV+  GA+ PLLA L            LRN TWTLSN CR K
Sbjct  177  QAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEH----TKLSMLRNATWTLSNFCRGK  232

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P P  +     LP L RL+H +D EVL D CWA+SYL+DG N++I  V++ GV P+LV+
Sbjct  233  -PQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVE  291

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTM  359
            LL      ++ PALR +GNIVTG D QTQ +ID  AL    SLL  N K +I+KEA WT+
Sbjct  292  LLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTI  351

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG +DQIQ V+N G++  LV++L  A+F  +KEA WA++N TSGG+ +QI YLV  
Sbjct  352  SNITAGNKDQIQAVINAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSE  411

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAE-----KLGETEKLSIMIEECGGLDKIE  474
            G I+PL +LL   D +I+ V L+ + NI +  E       G+    S MI+E  GL+KIE
Sbjct  412  GCIKPLCDLLICPDIRIVTVCLEGLENILKVGETDKTLAAGDVNVFSQMIDEAEGLEKIE  471

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDG  522
             LQ+H+N  +Y+ ++ ++E Y+  EE++          +G TF    G
Sbjct  472  NLQSHDNNEIYEKAVKILEAYWMDEEDDTMGATTVAAPQGATFDFGQG  519


> sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA4 PE=1 SV=1
Length=538

 Score =  628 bits (1621),  Expect = 0.0, Method: Composition-based stats.
 Identities = 241/545 (44%), Positives = 338/545 (62%), Gaps = 24/545 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   +      R   +K  G D+ E RRRR +  VE+RK K++D +LK+R         
Sbjct  1    MSLRPSTRAEL-RKKIYKT-GVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQ  58

Query  61   TSPLQENRNNQGTVN------WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDN  114
              PL    +   T          +  +V+G+ S + + QL+AT   RKLLS E+ PPID 
Sbjct  59   L-PLGAGLDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDE  117

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            +I+AG+IP+FV FLGR D   +QFE+AWALTN+ASGTS+ T+ V++ GA+P F+ LL S 
Sbjct  118  VIKAGVIPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSA  177

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
               + EQAVWALGN+AGD    R+LV+ YGA++PLLA L            LRN TWTLS
Sbjct  178  SDDVREQAVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNEN----SKLSMLRNATWTLS  233

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            N CR K P  P + V+  LP L +L++ +D EVL D CWA+SYL+DGPN++I  V++ GV
Sbjct  234  NFCRGK-PPTPFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGV  292

Query  295  VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQK  353
             P+LV+LLG     ++ PALR +GNIVTG D QTQ +I++G L    +LL  N K +I+K
Sbjct  293  CPRLVELLGHQSPTVLIPALRTVGNIVTGDDSQTQFIIESGVLPHLYNLLTQNHKKSIKK  352

Query  354  EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQI  413
            EA WT+SNITAG + QI+ VV  G++  LV +L  A+F  +KEA WA++N TSGG+ EQI
Sbjct  353  EACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQI  412

Query  414  VYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE------TEKLSIMIEEC  467
             YLV  G I+PL +LL   D +I+ V L+ + NI +  E   E          + +IEE 
Sbjct  413  QYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEES  472

Query  468  GGLDKIEALQNHENESVYKASLSLIEKYFSVEEEED--QNVVPETTSEGYTFQVQDGAP-  524
             GLDK+E LQ+H+N  +Y+ ++ ++E+Y++ EEEE   Q+   + + + + F     AP 
Sbjct  473  DGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNNPAAPV  532

Query  525  GTFNF  529
            G F F
Sbjct  533  GGFKF  537


> sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA6 PE=1 SV=1
Length=538

 Score =  625 bits (1611),  Expect = 0.0, Method: Composition-based stats.
 Identities = 232/544 (43%), Positives = 331/544 (61%), Gaps = 22/544 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   +A T   R +R+K    D+ E RRRR +  VE+RK K+++ + K+R     P  A
Sbjct  1    MSYKPSAKTEV-RRNRYK-VSVDADEGRRRREDNMVEIRKNKREENLQKKRREGFNPSMA  58

Query  61   TSPLQENRNNQGTVN--WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA  118
            + P Q+  ++  T     ++  ++ G+ S + + QL+AT + R+LLS E+ PPI+ ++++
Sbjct  59   SQPGQDFSSSLPTETRLENIQQMIAGVMSEDRDLQLEATASFRRLLSIERNPPINEVVQS  118

Query  119  GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI  178
            G++P  V FL R D + +QFE+AWALTNIASGTSE T+ ++D GA+P F+ LL+S    +
Sbjct  119  GVVPHIVQFLSRDDFTQLQFEAAWALTNIASGTSENTRVIIDSGAVPLFVKLLSSASEEV  178

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             EQAVWALGN+AGD    RD V+   A+  LLA              LRN TWTLSN CR
Sbjct  179  REQAVWALGNVAGDSPKCRDHVLSCEAMMSLLAQFHEH----SKLSMLRNATWTLSNFCR  234

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
             K P P  +  +  LP L RLLH  D EVL D  WA+SYL+DG NE+I  V+  GV+P+L
Sbjct  235  GK-PQPAFEQTKAALPALERLLHSTDEEVLTDASWALSYLSDGTNEKIQTVIDAGVIPRL  293

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP-KTNIQKEATW  357
            V+LL      ++ PALR IGNIVTG D QTQ VI + AL    +LL N  K +I+KEA W
Sbjct  294  VQLLAHPSPSVLIPALRTIGNIVTGDDIQTQAVISSQALPGLLNLLKNTYKKSIKKEACW  353

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+SNITAG   QIQ+V   G++  L+++L   +F+ +KEAVWA++N TSGG  +QI +LV
Sbjct  354  TISNITAGNTSQIQEVFQAGIIRPLINLLEIGEFEIKKEAVWAISNATSGGNHDQIKFLV  413

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE------KLGETEKLSIMIEECGGLD  471
              G I PL +LL   D +++ V L+ + NI +  E        G     + MIE+  GLD
Sbjct  414  SQGCIRPLCDLLPCPDPRVVTVTLEGLENILKVGEAEKNLGNTGNDNLYAQMIEDADGLD  473

Query  472  KIEALQNHENESVYKASLSLIEKYFSVEEEED---QNVVPETTS-EGYTFQVQ--DGAPG  525
            KIE LQ+H+N  +Y+ ++ ++E Y++ ++EE+       PE     G+ F  Q  +   G
Sbjct  474  KIENLQSHDNNEIYEKAVKILESYWAADDEEEDIGGVDAPENVQSSGFQFGNQSGNAPTG  533

Query  526  TFNF  529
             FNF
Sbjct  534  GFNF  537


> sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio 
OX=7955 GN=kpna5 PE=2 SV=2
Length=536

 Score =  620 bits (1599),  Expect = 0.0, Method: Composition-based stats.
 Identities = 251/534 (47%), Positives = 337/534 (63%), Gaps = 20/534 (4%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQEN  67
              R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNVS  P D +    P+Q+ 
Sbjct  8    NYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPPGDESMLECPIQDP  67

Query  68   RNNQ----GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIP  122
              +             D+++ I S + + QL ATQ  RKLLS+E  PPID +I   G++ 
Sbjct  68   DVSSTVPVSGEGVITQDVIQMIFSEDPDQQLIATQKFRKLLSKEPNPPIDEVIGTPGVVN  127

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R+D   +QFE+AWALTNIASGT + TK V++ GA+P FI LL S +  + EQA
Sbjct  128  RFVEFLRRSDNCTLQFEAAWALTNIASGTFQHTKVVIETGAVPIFIELLNSEYEDVQEQA  187

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD +  RD V+  G +  L  LL      S      RN  W LSNLCR KNP
Sbjct  188  VWALGNIAGDNAECRDYVLNCGILPSLQQLL----AKSNRLTTTRNAVWALSNLCRGKNP  243

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I  V+ +GV  +LV+LL
Sbjct  244  PPDFAKVSPCLSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQTVIDSGVCRRLVELL  303

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              S+  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  304  MHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSNI  363

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV    I
Sbjct  364  TAGNRAQIQAVIDSNVFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLNTI  423

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIEALQ  477
            +P+ +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GLDKIE LQ
Sbjct  424  KPMCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGTGINPYCALIEEAYGLDKIEFLQ  483

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
            +HEN+ +Y+ +  LIE YF VEEE D ++VP+       Y FQ  +G    F  
Sbjct  484  SHENQEIYQKAFDLIEHYFGVEEE-DASIVPQVDQNQGQYIFQQSEGPMEGFQL  536


> sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=1 
SV=1
Length=539

 Score =  620 bits (1598),  Expect = 0.0, Method: Composition-based stats.
 Identities = 249/536 (46%), Positives = 345/536 (64%), Gaps = 17/536 (3%)

Query  6    NANTPAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
             +   + R  RFK+KG   + E+RR+R E  +E+RK K+++ + KRRN+++   +     
Sbjct  2    ESRYLSDRRSRFKSKGVFKADELRRQREEQQIEIRKQKREESLNKRRNLNAVLQNDIDVE  61

Query  65   QENRNNQGTVNWSVDD----IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            +E   +Q  +   + D    +   + S ++E QL A    RK LS+E  PPID +I  G+
Sbjct  62   EEADQSQVQMEQQMKDEFPKLTADVMSDDIELQLGAVTKFRKYLSKETHPPIDQVIACGV  121

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + +FV FL  ++   +QFE+AWALTNIASGT++QT+ VVD GA+P FI LL+SP   + E
Sbjct  122  VDRFVQFLE-SEHHLLQFEAAWALTNIASGTTDQTRIVVDSGAVPRFIQLLSSPEKDVRE  180

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            Q VWALGNIAGD S  RD V+  G + PLL +L     S+     LRN TWTLSNLCR K
Sbjct  181  QVVWALGNIAGDSSACRDYVLGNGVLQPLLNILQS---SASDVSMLRNATWTLSNLCRGK  237

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            NP P    +   +P L +LL+ +D E++ D CWAISYL+DGPNE+IG ++  G  P+LV+
Sbjct  238  NPPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVGCAPRLVE  297

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL +  + I TPALR++GNIVTGTD QTQ++ID GAL  FPSLL++ K NI+KEA WT+S
Sbjct  298  LLSSPSVNIQTPALRSVGNIVTGTDAQTQIIIDCGALNAFPSLLSHQKENIRKEACWTIS  357

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG--GTVEQIVYLVH  418
            NITAG   QIQ ++   L+P LV +LS AD+KT+KEA WA++N TSG  G  +QI YLV 
Sbjct  358  NITAGNTQQIQAIIESNLIPPLVHLLSYADYKTKKEACWAISNATSGGLGQPDQIRYLVS  417

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE-----KLGETEKLSIMIEECGGLDKI  473
             G+I+PL ++L   D KII V LDAI NI +  E      L    + ++ +EE GG+D I
Sbjct  418  QGVIKPLCDMLNGSDNKIIQVALDAIENILKVGEMDRTMDLENINQYAVYVEEAGGMDMI  477

Query  474  EALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
              LQ+  N  +Y  + S+IEKYFS +E+  +++ PET +  +TF     A G F F
Sbjct  478  HDLQSSGNNDIYLKAYSIIEKYFS-DEDAVEDLAPETENGAFTFGNGPQAQGEFKF  532


> sp|B6HJ92|KAPA_PENRW Importin subunit alpha OS=Penicillium rubens 
(strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) 
OX=500485 GN=kapA PE=1 SV=1
Length=552

 Score =  620 bits (1598),  Expect = 0.0, Method: Composition-based stats.
 Identities = 239/537 (45%), Positives = 335/537 (62%), Gaps = 27/537 (5%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDD--------A  60
            P  R  +FK K +    E+RRRR E  VE+RKAK+D+ + KRR + +            A
Sbjct  7    PEHRRTQFKAKNQFKPDELRRRREEQQVEIRKAKRDENLAKRRGIQTQDGRIGVGGMAAA  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            T    E    +  +N  +  +VKG+ S  VE Q+QAT   RKLLS+E+ PPI+ +I  G+
Sbjct  67   TESDDEASAIESELNVELPQMVKGVFSDQVEEQIQATTKFRKLLSKERNPPIERVIETGV  126

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + +FV FL R+  + +QFESAWALTNIASG+++QT+ V++ GA+P F+ LL+SP   + E
Sbjct  127  VARFVEFL-RSPHTLVQFESAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVRE  185

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNIAGD    RD V+  GA+ PLL L+            LRN TWTLSN CR K
Sbjct  186  QAVWALGNIAGDSPHCRDFVLGAGALRPLLNLIND----GRKLSMLRNATWTLSNFCRGK  241

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P P  + +   LP L +L++  D EVL D CWAISYL+DG N++I  V++ G+  +LV+
Sbjct  242  TPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGANDKIQAVIEAGIPRRLVE  301

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL  +   + TPALR++GNIVTG D QTQV+I+ G+L    SLL++ K  I+KEA WT+S
Sbjct  302  LLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGSLPALLSLLSSTKDGIRKEACWTIS  361

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVH  418
            N+TAG   QIQ V++ G++  L+++L+  DFKT+KEA WA++N TSGG    +QI YLV 
Sbjct  362  NVTAGNSSQIQAVIDAGIIAPLINLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVS  421

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET--------EKLSIMIEECGGL  470
             G I+PL +LL   D KII V LD + NI +  +   E          + ++ IEE GG+
Sbjct  422  QGCIKPLCDLLACPDNKIIQVALDGLENILKVGDMDKEAGQPGEARVNRYALFIEEAGGM  481

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEE---EDQNVVPETTSEGYTFQVQDGAP  524
            +KI   QN+ NE +Y  + ++IEKYFS E+E   + + + P+ T  G+T       P
Sbjct  482  EKIHDCQNNANEEIYMKAYNIIEKYFSDEDEAGGDIEELAPQQTQTGFTLGTGQQQP  538


> sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus OX=9913 
GN=KPNA6 PE=2 SV=1
Length=536

 Score =  618 bits (1595),  Expect = 0.0, Method: Composition-based stats.
 Identities = 250/541 (46%), Positives = 339/541 (63%), Gaps = 17/541 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M T  +      R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A
Sbjct  1    METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA  60

Query  61   T--SPLQENRNNQGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
                 L  +     T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I
Sbjct  61   AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDPDLQLATTQKFRKLLSKEPSPPIDEVI  120

Query  117  RA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
               G++ +FV FL R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S  
Sbjct  121  NTPGVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF  180

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGNIAGD SV RD V+    ++PLL LL      S      RN  W LSN
Sbjct  181  EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSN  236

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            LCR KNP P    V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV 
Sbjct  237  LCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVC  296

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
             +LV+LL  ++  + +PALRA+GNIVTG D QTQV+++  AL     LL++ K +I+KEA
Sbjct  297  RRLVELLMHNDNKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEA  356

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI Y
Sbjct  357  CWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRY  416

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-----EKLSIMIEECGGL  470
            LV  G I+PL +LLT  D+KI+ V L+ + NI +  E+ G+           +IEE  GL
Sbjct  417  LVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGL  476

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFN  528
            DKIE LQ+HEN+ +Y+ +  LIE YF V E++D ++ P+   T + + FQ  +     F 
Sbjct  477  DKIEFLQSHENQEIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQQPEAPMEGFQ  535

Query  529  F  529
             
Sbjct  536  L  536


> sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens 
OX=9606 GN=KPNA4 PE=1 SV=1
Length=521

 Score =  616 bits (1589),  Expect = 0.0, Method: Composition-based stats.
 Identities = 268/533 (50%), Positives = 359/533 (67%), Gaps = 16/533 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M+ NE  +    RL  FKNKG+D   MRR+R EV VELRK K+D+ +LKRRNV   P + 
Sbjct  1    MADNEKLDN--QRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNV---PHED  55

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                 +   +    N S++ IV+  +S N   QL A QAARKLLS ++ PPID++I++G+
Sbjct  56   ICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGI  115

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P  V  L R D   +QFE+AWALTNIASGTSEQT+AVV   A+P F+ LL SPH ++ E
Sbjct  116  LPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCE  175

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCR+K
Sbjct  176  QAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHK  231

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +P PP++ +++ILP L  L+HH D  +L DT WA+SYLTD  NE+I MV+ +G+VP LV 
Sbjct  232  DPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVP  291

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL   E+ + T ALRA+GNIVTGTDEQTQVV++  AL+ FP+LLT+PK  I KEA W +S
Sbjct  292  LLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLS  351

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAG Q Q+Q V++  LVP ++ +L K DF TQKEA WA++N T  G  +Q+ YL+   
Sbjct  352  NITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQN  411

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            +I P  NLLT KD +++ V+LD +SNI + AE   ET     +IEECGGL+KIE LQNHE
Sbjct  412  VIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGN--LIEECGGLEKIEQLQNHE  469

Query  481  NESVYKASLSLIEKYFSVEE-EEDQNVVPETTSEGYTFQVQ---DGAPGTFNF  529
            NE +YK +  +I+++FS ++ +ED ++VPE    G TF      +     F F
Sbjct  470  NEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGG-TFGFNSSANVPTEGFQF  521


> sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii 
OX=9601 GN=KPNA6 PE=2 SV=1
Length=536

 Score =  617 bits (1590),  Expect = 0.0, Method: Composition-based stats.
 Identities = 250/541 (46%), Positives = 339/541 (63%), Gaps = 17/541 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M T  +      R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A
Sbjct  1    METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA  60

Query  61   T--SPLQENRNNQGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
                 L  +     T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I
Sbjct  61   AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI  120

Query  117  RA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
                ++ +FV FL R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S  
Sbjct  121  NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF  180

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGNIAGD SV RD V+    ++PLL LL      S      RN  W LSN
Sbjct  181  EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSN  236

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            LCR KNP P    V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV 
Sbjct  237  LCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVC  296

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
             +LV+LL  ++  + +PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA
Sbjct  297  RRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEA  356

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI Y
Sbjct  357  CWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRY  416

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-----EKLSIMIEECGGL  470
            LV  G I+PL +LLT  D+KI+ V L+ + NI +  E+ G+           +IEE  GL
Sbjct  417  LVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGL  476

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFN  528
            DKIE LQ+HEN+ +Y+ +  LIE YF V E++D ++ P+   T + + FQ  +     F 
Sbjct  477  DKIEFLQSHENQEIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQQPEAPMEGFQ  535

Query  529  F  529
             
Sbjct  536  L  536


> sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens 
OX=9606 GN=KPNA6 PE=1 SV=1
Length=536

 Score =  617 bits (1590),  Expect = 0.0, Method: Composition-based stats.
 Identities = 250/541 (46%), Positives = 339/541 (63%), Gaps = 17/541 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M T  +      R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A
Sbjct  1    METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA  60

Query  61   T--SPLQENRNNQGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
                 L  +     T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I
Sbjct  61   AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI  120

Query  117  RA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
                ++ +FV FL R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S  
Sbjct  121  NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF  180

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGNIAGD SV RD V+    ++PLL LL      S      RN  W LSN
Sbjct  181  EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSN  236

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            LCR KNP P    V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV 
Sbjct  237  LCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVC  296

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
             +LV+LL  ++  + +PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA
Sbjct  297  RRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEA  356

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI Y
Sbjct  357  CWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRY  416

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-----EKLSIMIEECGGL  470
            LV  G I+PL +LLT  D+KI+ V L+ + NI +  E+ G+           +IEE  GL
Sbjct  417  LVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGL  476

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFN  528
            DKIE LQ+HEN+ +Y+ +  LIE YF V E++D ++ P+   T + + FQ  +     F 
Sbjct  477  DKIEFLQSHENQEIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQQPEAPMEGFQ  535

Query  529  F  529
             
Sbjct  536  L  536


> sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus 
OX=10090 GN=Kpna4 PE=1 SV=1
Length=521

 Score =  616 bits (1588),  Expect = 0.0, Method: Composition-based stats.
 Identities = 268/533 (50%), Positives = 362/533 (68%), Gaps = 16/533 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M+ NE  +    RL  FKNKG+D   MRR+R EV VELRK K+D+ +LKRRNV   P + 
Sbjct  1    MADNEKLDN--QRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNV---PQED  55

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
                 +   +    N S++ IV+  +S N   QL A QAARKLLS ++ PPID++I++G+
Sbjct  56   ICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGI  115

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P  V  L R D   +QFE+AWALTNIASGTSEQT+AVV   A+P F+ LL SPH ++ E
Sbjct  116  LPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCE  175

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QAVWALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCR+K
Sbjct  176  QAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHK  231

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +P PP++ +++ILP L  L+HH D  +L DT WA+SYLTD  NE+I MV+ +G+VP LV 
Sbjct  232  DPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVP  291

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL   E+ + T ALRA+GNIVTGTDEQTQVV++  AL+ FP+LLT+PK  I KEA W +S
Sbjct  292  LLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLS  351

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG  420
            NITAG Q Q+Q V++  LVP ++ +L K DF TQKEA WA++N T  G  +Q+ YL+   
Sbjct  352  NITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQN  411

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
            +I P  NLLT KD +++ V+LD +SNI + AE   ET  ++ +IEECGGL+KIE LQNHE
Sbjct  412  VIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAET--IANLIEECGGLEKIEQLQNHE  469

Query  481  NESVYKASLSLIEKYFSVEE-EEDQNVVPETTSEGYTFQV---QDGAPGTFNF  529
            NE +YK +  +I+++FS ++ +ED ++VPE+   G TF      +     F F
Sbjct  470  NEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGG-TFGFNSSTNVPTEGFQF  521


> sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus 
OX=10090 GN=Kpna6 PE=1 SV=2
Length=536

 Score =  615 bits (1587),  Expect = 0.0, Method: Composition-based stats.
 Identities = 248/541 (46%), Positives = 338/541 (62%), Gaps = 17/541 (3%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            M T  +      R+  +KN   +  EMRRRR E  ++LRK K++ Q+ KRRNV    ++A
Sbjct  1    METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA  60

Query  61   T--SPLQENRNNQGTVNWSV--DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII  116
                 L  +     T   SV   ++V+ + S + + QL  TQ  RKLLS+E  PPID +I
Sbjct  61   AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI  120

Query  117  RA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
               G++ +FV FL R +   +QFE+AWALTNIASGTS+QTK V++ GA+P FI LL S  
Sbjct  121  NTPGVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF  180

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
              + EQAVWALGNIAGD S+ RD V+    ++PLL LL      S      RN  W LSN
Sbjct  181  EDVQEQAVWALGNIAGDSSLCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSN  236

Query  236  LCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            LCR KNP P    V   LP L RLL   D ++LAD CWA+SYL+DGPNE+I  V+ +GV 
Sbjct  237  LCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVC  296

Query  296  PQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
             +LV+LL  ++  + +PALRA+GNIVTG D QTQV+++  AL     LL++ K +I+KEA
Sbjct  297  RRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEA  356

Query  356  TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             WT+SNITAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI Y
Sbjct  357  CWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRY  416

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-----EKLSIMIEECGGL  470
            LV  G I+PL +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GL
Sbjct  417  LVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKRSGSGVNPYCGLIEEAYGL  476

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFN  528
            DKIE LQ+HEN+ +Y+ +  LIE YF V E++D ++ P+   T + + FQ  +     F 
Sbjct  477  DKIEFLQSHENQEIYQKAFDLIEHYFGV-EDDDSSLAPQVDETQQQFIFQQPEAPMEGFQ  535

Query  529  F  529
             
Sbjct  536  L  536


> sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus 
OX=10090 GN=Kpna3 PE=1 SV=1
Length=521

 Score =  609 bits (1570),  Expect = 0.0, Method: Composition-based stats.
 Identities = 262/528 (50%), Positives = 353/528 (67%), Gaps = 12/528 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
            EN      R+  FKNKG+D   MRR R EV VELRK K+D+ +LK+RNV        S +
Sbjct  3    ENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDV  62

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
              +   Q   N +++ I++   S N   QL A QAARKLLS ++ PPID++I++G++P  
Sbjct  63   DADFKAQ---NVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPIL  119

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L R D   +QFE+AWALTNIASGTS QT+AVV   A+P F+ LL SPH ++ EQAVW
Sbjct  120  VKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVW  179

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNI GDG   RD VI  G V PLL+ +      S+   +LRN+TW + NLCRNK+P P
Sbjct  180  ALGNIIGDGPQCRDYVISLGVVKPLLSFIN----PSIPITFLRNVTWVIVNLCRNKDPPP  235

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P++ V++ILP L  L++H D  +L DT WA+SYLTDG NE+I MV+ +GVVP LV LL  
Sbjct  236  PMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSH  295

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             E+ + T ALRA+GNIVTGTDEQTQVV++   L+ FP+LL++PK  I KEA W +SNITA
Sbjct  296  QEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITA  355

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G Q Q+Q V++ GL+P ++  L+K DF TQKEA WA++N T  G  +Q+ YLV   +I P
Sbjct  356  GNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPP  415

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
              NLL+ KD++++ V+LD + NI   A     T  ++ +IEECGGL+KIE LQ HENE +
Sbjct  416  FCNLLSVKDSQVVQVVLDGLKNILIMAGDEAST--IAEIIEECGGLEKIEVLQQHENEDI  473

Query  485  YKASLSLIEKYFSVEE-EEDQNVVPETTSEG-YTF-QVQDGAPGTFNF  529
            YK +  +I++YFS ++ +ED +++PE T  G Y F    +     FNF
Sbjct  474  YKLAFEIIDQYFSGDDIDEDPSLIPEATQGGTYNFDPTANLQTKEFNF  521


> sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens 
OX=9606 GN=KPNA3 PE=1 SV=2
Length=521

 Score =  609 bits (1570),  Expect = 0.0, Method: Composition-based stats.
 Identities = 262/528 (50%), Positives = 354/528 (67%), Gaps = 12/528 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
            EN +    R+  FKNKG+D   MRR R EV VELRK K+D+ +LK+RNV        S +
Sbjct  3    ENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDV  62

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
              +   Q   N +++ I++   S N   QL A QAARKLLS ++ PPID++I++G++P  
Sbjct  63   DADFKAQ---NVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPIL  119

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L R D   +QFE+AWALTNIASGTS QT+AVV   A+P F+ LL SPH ++ EQAVW
Sbjct  120  VKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVW  179

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNI GDG   RD VI  G V PLL+ ++     S+   +LRN+TW + NLCRNK+P P
Sbjct  180  ALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVIVNLCRNKDPPP  235

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            P++ V++ILP L  L++H D  +L DT WA+SYLTDG NE+I MV+ +GVVP LV LL  
Sbjct  236  PMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSH  295

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             E+ + T ALRA+GNIVTGTDEQTQVV++   L+ FP+LL++PK  I KEA W +SNITA
Sbjct  296  QEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITA  355

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G Q Q+Q V++ GL+P ++  L+K DF TQKEA WA++N T  G  +Q+ YLV   +I P
Sbjct  356  GNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPP  415

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
              NLL+ KD++++ V+LD + NI   A     T  ++ +IEECGGL+KIE LQ HENE +
Sbjct  416  FCNLLSVKDSQVVQVVLDGLKNILIMAGDEAST--IAEIIEECGGLEKIEVLQQHENEDI  473

Query  485  YKASLSLIEKYFSVEE-EEDQNVVPETTSEG-YTF-QVQDGAPGTFNF  529
            YK +  +I++YFS ++ +ED  ++PE T  G Y F    +     FNF
Sbjct  474  YKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF  521


> sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens 
OX=9606 GN=KPNA7 PE=1 SV=1
Length=516

 Score =  605 bits (1559),  Expect = 0.0, Method: Composition-based stats.
 Identities = 280/513 (55%), Positives = 371/513 (72%), Gaps = 7/513 (1%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
               + P  R  +FK +GKD +  R++R+ V++ELRKAKKD+Q LKRRN++SF  D  S  
Sbjct  2    PTLDAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPS--  59

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
             E       V+ ++ +I+KG+NSS+     QATQ ARK+LS+EK PP+  +I AGLIP+ 
Sbjct  60   -EKTAKGVAVSLTLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRM  118

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V FL  +    +QFE+AWALTNIASGTSEQT+AVV+GGAI   I LL+S +  + EQAVW
Sbjct  119  VEFLKSSLYPCLQFEAAWALTNIASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVW  178

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNIAGDG  FRD VI   A+  LLAL++     +L   +LRN+TWTLSNLCRNKNP P
Sbjct  179  ALGNIAGDGPEFRDNVITSNAIPHLLALIS----PTLPITFLRNITWTLSNLCRNKNPYP  234

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
               AV+QILP L+ LL H D EVL+D CWA+SYLTDG N+RIG VV TGV+P+LV L+ +
Sbjct  235  CDTAVKQILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVVNTGVLPRLVVLMTS  294

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            SEL ++TP+LR +GNIVTGTDEQTQ+ IDAG L V P LL + K +IQKEA W +SN+ A
Sbjct  295  SELNVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALSNVAA  354

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G    IQQ++ + ++P LV++L   +FK QKEAVW V N+ +G T++Q++ LVH G++EP
Sbjct  355  GPCHHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEP  414

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
            L+NLLTA D KI+L+ILD IS I QAAEK  E E L ++IEE GG+D+IEALQ HEN  +
Sbjct  415  LVNLLTAPDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQI  474

Query  485  YKASLSLIEKYFSVEEEEDQNVVPETTSEGYTF  517
             +++L++IEK+F  EE+E Q ++ +   + Y F
Sbjct  475  GQSALNIIEKHFGEEEDESQTLLSQVIDQDYEF  507


> sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus 
OX=10116 GN=Kpna5 PE=2 SV=1
Length=536

 Score =  600 bits (1548),  Expect = 0.0, Method: Composition-based stats.
 Identities = 252/534 (47%), Positives = 340/534 (64%), Gaps = 20/534 (4%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQEN  67
              R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNVS   +D     SP+Q+ 
Sbjct  8    NYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPRNDDCMLESPIQDP  67

Query  68   RNNQG----TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII-RAGLIP  122
              +        +    D+++ I S+N E QL ATQ  RKLLS+E  PPID +I + G++ 
Sbjct  68   DVSSTVPIPEEDMITADMIQMIFSNNAEQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQ  127

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFE+AWALTNIASGT   TK V++ GA+P FI LL S H  + EQA
Sbjct  128  RFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIRLLTSEHEDVQEQA  187

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD +  RD V+        L  L     +S      RN  W LSNLCR KNP
Sbjct  188  VWALGNIAGDNAECRDFVLNCEI----LPPLLELLTNSNRLTTTRNAVWALSNLCRGKNP  243

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I +V+ +GV  +LV+LL
Sbjct  244  PPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQVVIDSGVCRRLVELL  303

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL +PK +++KEA WT+SNI
Sbjct  304  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLGSPKESVRKEACWTISNI  363

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+ VL KA+F+T+KEA WA+TN TSGG  EQI YLV  G I
Sbjct  364  TAGNRMQIQAVIDGSIFPVLIEVLQKAEFRTRKEAAWAITNATSGGAPEQIRYLVTLGCI  423

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L+ + NI +  E+  +   + I     +IEE  GLDKIE LQ
Sbjct  424  KPLCDLLTVMDSKIVQVALNGLENILRLGERESKQNGVGINPYCALIEEAYGLDKIEFLQ  483

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQD-GAPG-TFNF  529
            +HEN+ +Y+ +  LIE+YF VEE+ D ++VP+   +   F  Q   APG  F  
Sbjct  484  SHENQEIYQKAFDLIERYFGVEED-DPSLVPQVDEQQRQFLFQQCEAPGEGFQL  536


> sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus 
OX=9031 GN=KPNA1 PE=2 SV=1
Length=538

 Score =  594 bits (1531),  Expect = 0.0, Method: Composition-based stats.
 Identities = 242/537 (45%), Positives = 331/537 (62%), Gaps = 22/537 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEEAEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q N     +      D+++ I S++ E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQMNNMEMTSSAVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVISTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFE+AW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFEAAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL LL+            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLLS----KQNRITMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            KNP P    V   L  L  LL  +D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KNPPPDFAKVSPCLSVLSWLLFVNDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+++L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDAHIFPALINILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET-----EKLSIMIEECGGLDKIE  474
            G I+PL +LLT  D+KI+ V L  + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDSKIVQVALSGLENILRLGEQESKRSGAGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ  +     F  
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL  538


> sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP1 PE=1 
SV=1
Length=542

 Score =  593 bits (1529),  Expect = 0.0, Method: Composition-based stats.
 Identities = 241/535 (45%), Positives = 330/535 (62%), Gaps = 22/535 (4%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE--  66
            P  R   FKNKG+  + E+RRRR    VELRKAK+D+ + KRRN     D A S  ++  
Sbjct  14   PEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDES  73

Query  67   ----NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIP  122
                ++     +   +  + + +NS +++ QL AT   R++LSRE +PPID +I+AG++P
Sbjct  74   SVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVP  133

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + V F+       +Q E+AWALTNIASGTS QTK VVD  A+P FI LL +    + EQA
Sbjct  134  RLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQA  193

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            +WALGN+AGD + +RD V++  A++P+L L       S     +R  TWTLSNLCR K P
Sbjct  194  IWALGNVAGDSTDYRDYVLQCNAMEPILGLFN-----SNKPSLIRTATWTLSNLCRGKKP  248

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V Q LPTL +L++  D E L D CWAISYL+DGP E I  V+   +  +LV+LL
Sbjct  249  QPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELL  308

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
                  + TPALRA+GNIVTG D QTQVVI+AG L     LL++PK NI+KEA WT+SNI
Sbjct  309  SHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNI  368

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVHCG  420
            TAG  +QIQ V++  L+P LV +L  A++KT+KEA WA++N +SGG    + I YLV  G
Sbjct  369  TAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQG  428

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEA  475
             I+PL +LL   D +II V LDA+ NI +  E   E   L+I      IE+ GG++KI  
Sbjct  429  CIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFN  488

Query  476  LQNHENESVYKASLSLIEKYFSVEEEE-DQNVVPETTSEGYTFQVQDGAPGTFNF  529
             Q +EN+ +Y+ +  +IE YF  EE+  D+ + P+  + G TF         FNF
Sbjct  489  CQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQ--NAGNTFGFGSNVNQQFNF  541


> sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens 
OX=9606 GN=KPNA5 PE=1 SV=2
Length=536

 Score =  592 bits (1527),  Expect = 0.0, Method: Composition-based stats.
 Identities = 245/516 (47%), Positives = 330/516 (64%), Gaps = 18/516 (3%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDAT---SPLQEN  67
              R+  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV    +D +   SP+Q+ 
Sbjct  8    NYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDP  67

Query  68   RNNQG----TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNII-RAGLIP  122
              +             D+V+ I S+N + QL ATQ  RKLLS+E  PPID +I + G++ 
Sbjct  68   DISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQ  127

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            +FV FL R +   +QFE+AWALTNIASGT   TK V++ GA+P FI LL S H  + EQA
Sbjct  128  RFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQA  187

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            VWALGNIAGD +  RD V+        L  L     +S      RN  W LSNLCR KNP
Sbjct  188  VWALGNIAGDNAECRDFVLNCEI----LPPLLELLTNSNRLTTTRNAVWALSNLCRGKNP  243

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
             P    V   L  L RLL   DP+VLAD CWA+SYL+DGPN++I  V+ +GV  +LV+LL
Sbjct  244  PPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELL  303

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+SNI
Sbjct  304  MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNI  363

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            TAG + QIQ V++  + P L+ +L KA+F+T+KEA WA+TN TSGGT EQI YLV  G I
Sbjct  364  TAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCI  423

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIEALQ  477
            +PL +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GLDKIE LQ
Sbjct  424  KPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQ  483

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSE  513
            +HEN+ +Y+ +  LIE YF VEE+ D ++VP+    
Sbjct  484  SHENQEIYQKAFDLIEHYFGVEED-DPSIVPQVDEN  518


> sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus OX=9913 
GN=KPNA7 PE=1 SV=2
Length=522

 Score =  591 bits (1525),  Expect = 0.0, Method: Composition-based stats.
 Identities = 269/497 (54%), Positives = 358/497 (72%), Gaps = 10/497 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
               + P  RL +FK +GKD++  R++RI V++ELRKAKKD+Q LKRRN++    D +   
Sbjct  2    PTLDAPEERLRKFKYRGKDASARRQQRIAVSLELRKAKKDEQALKRRNITDVSLDPS---  58

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
                     V+ ++ +I+ G+N+S+ E   QATQAARK+LSREK PP+  I+ AGLIP+ 
Sbjct  59   ---DQQTKGVSLTLQEIISGVNASDPELCFQATQAARKMLSREKNPPLKLIVDAGLIPRL  115

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L  +    +QFE+AWALTNIASG SE T+AVV GGAI   + LL+SPH  + EQAVW
Sbjct  116  VELLKSSLHPRLQFEAAWALTNIASGASELTRAVVVGGAIQPLVELLSSPHMTVCEQAVW  175

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNIAGDG  FRD VI   A+  LL L++    SS+   +LRN+ WTLSNLCRNKNP P
Sbjct  176  ALGNIAGDGPEFRDNVIASDAIPHLLTLVS----SSIPVPFLRNIAWTLSNLCRNKNPYP  231

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
               AV+Q+LP L  LL H D EVL+DTCWA+SYLTDG + RIG VV TGV+P+LV+L+ +
Sbjct  232  SDHAVKQMLPALFYLLGHPDREVLSDTCWALSYLTDGCDARIGQVVDTGVLPRLVELMSS  291

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            SEL I+TP+LR +GNIVTGTD QTQ+ +DAG L V P LLT+P+ +IQKEA W +SN+ A
Sbjct  292  SELNILTPSLRTVGNIVTGTDHQTQLALDAGILGVLPQLLTHPRPSIQKEAAWALSNVAA  351

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G +  IQ+++  G +P LV+VL   +FK QKEAVW V N+T+GG+VEQ++ LV  G++EP
Sbjct  352  GPRQHIQRLIACGALPPLVAVLKNGEFKVQKEAVWTVANFTTGGSVEQLIQLVQAGVLEP  411

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
            L+NLLT  D K++++ILD +  I QAAEK+ + E + ++IE  GGLD+IEALQ HEN  V
Sbjct  412  LINLLTIPDNKMVIIILDVLFFILQAAEKISQKENMCLLIEGLGGLDRIEALQLHENHQV  471

Query  485  YKASLSLIEKYFSVEEE  501
               +L++IE++FS EEE
Sbjct  472  ALTALNIIERHFSEEEE  488


> sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=cut15 PE=1 
SV=1
Length=542

 Score =  591 bits (1525),  Expect = 0.0, Method: Composition-based stats.
 Identities = 231/530 (44%), Positives = 337/530 (64%), Gaps = 16/530 (3%)

Query  10   PAARLHRFKNKGK-DSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSF--PDDATSPLQE  66
            P  R   +K KG   + E+RRRR    +E+RK K+++ + KRRN+     P + T PL++
Sbjct  9    PEHRRQNYKGKGTFQADELRRRRETQQIEIRKQKREENLNKRRNLVDVQEPAEETIPLEQ  68

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVS  126
            ++ N   +   + D++K + S ++E Q+QAT   RK LS+E  PPI  +I AG++P+FV 
Sbjct  69   DKENDLELELQLPDLLKALYSDDIEAQIQATAKFRKALSKETNPPIQKVIDAGVVPRFVE  128

Query  127  FLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL  186
            FL   +   ++FE++WALTN+ASG+S QT  VV+  A+P F+SLL+S    + EQAVWAL
Sbjct  129  FLSHENNL-LKFEASWALTNVASGSSNQTHVVVEANAVPVFVSLLSSSEQDVREQAVWAL  187

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            GNIAGD  + RD V++ G ++PLL ++     S+     LRN TWTLSN+CR KNP P  
Sbjct  188  GNIAGDSPMCRDHVLQCGVLEPLLNIIE----SNRRLSMLRNSTWTLSNMCRGKNPQPDW  243

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
            +++ Q++P L +L++  D +VL D  WAISYL+DG NE+I  ++  G+  +LV+LL    
Sbjct  244  NSISQVIPVLSKLIYTLDEDVLVDALWAISYLSDGANEKIQAIIDAGIPRRLVELLMHPS  303

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
              + TPALR++GNIVTG D QTQV+I+ GAL+   SLL++P+  ++KEA WT+SNITAG 
Sbjct  304  AQVQTPALRSVGNIVTGDDVQTQVIINCGALSALLSLLSSPRDGVRKEACWTISNITAGN  363

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVHCGIIEP  424
              QIQ V+   ++P L+ +L+ ADFK QKEA WA++N TSGG    +QI YLV  G I+P
Sbjct  364  SSQIQYVIEANIIPPLIHLLTTADFKIQKEACWAISNATSGGARRPDQIRYLVEQGAIKP  423

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAE-----KLGETEKLSIMIEECGGLDKIEALQNH  479
            L NLL  +D KII V LD I NI +  E        +    ++ +E+ GG+D I   QN 
Sbjct  424  LCNLLACQDNKIIQVALDGIENILRVGELDRANNPDKINLYAVYVEDAGGMDLIHECQNS  483

Query  480  ENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF  529
             N  +Y+ + ++IEK+F  E+E ++    ET  + +TF       G F F
Sbjct  484  SNSEIYQKAYNIIEKFFGEEDEIEELEP-ETVGDTFTFGTTQEPAGDFQF  532


> sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus OX=9913 
GN=KPNA1 PE=2 SV=1
Length=538

 Score =  589 bits (1519),  Expect = 0.0, Method: Composition-based stats.
 Identities = 242/537 (45%), Positives = 329/537 (61%), Gaps = 22/537 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q N            D+++ I S++ E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQINNMEMAPGGVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVISTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL L +            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFS----KQNRLTMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+P P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDVQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIE  474
            G I+PL +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ  +     F  
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL  538


> sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii 
OX=9601 GN=KPNA1 PE=2 SV=1
Length=538

 Score =  588 bits (1517),  Expect = 0.0, Method: Composition-based stats.
 Identities = 242/537 (45%), Positives = 327/537 (61%), Gaps = 22/537 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q N            D+++ I S + E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL L +            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFS----KQNRLTMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+P P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIE  474
            G I+PL +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+     + Y FQ  +     F  
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL  538


> sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens 
OX=9606 GN=KPNA1 PE=1 SV=3
Length=538

 Score =  588 bits (1515),  Expect = 0.0, Method: Composition-based stats.
 Identities = 241/537 (45%), Positives = 327/537 (61%), Gaps = 22/537 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q +            D+++ I S + E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL L +            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFS----KQNRLTMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+P P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIE  474
            G I+PL +LLT  D+KI+ V L+ + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+     + Y FQ  +     F  
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL  538


> sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus 
OX=10090 GN=Kpna1 PE=1 SV=2
Length=538

 Score =  584 bits (1506),  Expect = 0.0, Method: Composition-based stats.
 Identities = 242/537 (45%), Positives = 326/537 (61%), Gaps = 22/537 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q N            D+   I S++ E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQINNMEMAPGGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRNVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL L +            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLNCNILPPLLQLFS----KQNRLTMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+P P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIE  474
            G I+PL +LLT  D KI+ V L+ + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGTFNF  529
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ  +     F  
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL  538


> sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA5 PE=2 SV=1
Length=519

 Score =  581 bits (1499),  Expect = 0.0, Method: Composition-based stats.
 Identities = 221/529 (42%), Positives = 317/529 (60%), Gaps = 20/529 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS   +  T   R+ R+K    D+ E RRRR +  VE+RK+K+++ ++K+R V   P D 
Sbjct  1    MSLRPSTKTEIRRI-RYK-VSVDAEEGRRRREDFLVEIRKSKRNENLMKKRRVKVLPPDY  58

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
               L  N   +  +   + +++ G+ S +   QL+ T   R +LS ++ PP DN+I++G+
Sbjct  59   K--LISNDPFESLLE--IANMITGVFSDDPSLQLEYTTRFRVVLSFDRSPPTDNVIKSGV  114

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P+FV FL + D   +QFE+AWALTNIASG SE TK V+D G +P F+ LLASP   + E
Sbjct  115  VPRFVEFLKKDDNPKLQFEAAWALTNIASGASEHTKVVIDHGVVPLFVQLLASPDDDVRE  174

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            QA+W LGN+AGD    RD V+  GA  PLL  L            LRN TWTLSN  R K
Sbjct  175  QAIWGLGNVAGDSIQCRDFVLNSGAFIPLLHQLNNH----ATLSILRNATWTLSNFFRGK  230

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
             P+PP D V+ +LP L RL++ DD +VL D CWA+S L+D  NE I  V++ GVVP+LV+
Sbjct  231  -PSPPFDLVKHVLPVLKRLVYSDDEQVLIDACWALSNLSDASNENIQSVIEAGVVPRLVE  289

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTM  359
            LL  +   ++ PALR IGNIV+G  +QT  VI+ G L V   LL  N    I++EA WT+
Sbjct  290  LLQHASPVVLVPALRCIGNIVSGNSQQTHCVINCGVLPVLADLLTQNHMRGIRREACWTI  349

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG ++QIQ V++  L+P LV++   A+F  +KEA+WA++N + GG+  QI YLV  
Sbjct  350  SNITAGLEEQIQSVIDANLIPSLVNLAQHAEFDIKKEAIWAISNASVGGSPNQIKYLVEQ  409

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSIMIEECGGLDKIEAL  476
              I+ L ++L   D +IILV L  +  I  A E    L +    S MIE+  GL+KIE L
Sbjct  410  NCIKALCDILVCPDLRIILVSLGGLEMILIAGEVDKNLRDVNCYSQMIEDAEGLEKIENL  469

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEG-----YTFQVQ  520
            Q+H N  +Y+ ++ +++ Y  VEE+       +   +G     + F   
Sbjct  470  QHHGNNEIYEKAVKILQTYGLVEEDGRLVEEEDEGGDGCSHPEFQFDFS  518


> sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus 
OX=10116 GN=Kpna1 PE=1 SV=1
Length=538

 Score =  581 bits (1498),  Expect = 0.0, Method: Composition-based stats.
 Identities = 241/534 (45%), Positives = 326/534 (61%), Gaps = 22/534 (4%)

Query  10   PAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSS---------FPDDA  60
               RL  +KNK  +  EMRRRR E  ++LRK K+++Q+ KRRNV++           D  
Sbjct  7    ENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGG  66

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-G  119
                Q N            D+ + I S++ E QL ATQ  RKLLS+E  PPID +I   G
Sbjct  67   FHEAQINNMEMAPGGVITSDMTEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPG  126

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++ +FV FL R +   +QFESAW LTNIASG S QT+ V+  GA+P FI LL+S    + 
Sbjct  127  VVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQ  186

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            EQAVWALGNIAGD ++ RD V+    + PLL L +            RN  W LSNLCR 
Sbjct  187  EQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFS----KQNRLTMTRNAVWALSNLCRG  242

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+P P    V   L  L  LL   D +VLAD CWA+SYL+DGPN++I  V+  GV  +LV
Sbjct  243  KSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV  302

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +LL  ++  +V+PALRA+GNIVTG D QTQV+++  AL     LL++PK +I+KEA WT+
Sbjct  303  ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTI  362

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            SNITAG + QIQ V++  + P L+S+L  A+F+T+KEA WA+TN TSGG+ EQI YLV  
Sbjct  363  SNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVEL  422

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK-----LSIMIEECGGLDKIE  474
            G I+PL +LLT  D KI+ V L+ + NI +  E+  +           +IEE  GLDKIE
Sbjct  423  GCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIE  482

Query  475  ALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPET--TSEGYTFQVQDGAPGT  526
             LQ+HEN+ +Y+ +  LIE YF   E+ED ++ P+   + + Y FQ  +     
Sbjct  483  FLQSHENQEIYQKAFDLIEHYFGT-EDEDSSIAPQVDLSQQQYIFQQCEAPMEG  535


> sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium 
discoideum OX=44689 GN=DDB_G0272318 PE=3 SV=1
Length=516

 Score =  577 bits (1488),  Expect = 0.0, Method: Composition-based stats.
 Identities = 229/515 (44%), Positives = 333/515 (65%), Gaps = 11/515 (2%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNN  70
              R  ++K K  DS E RR+R E ++ +RK K+++ +LK+R   +     ++P++ +   
Sbjct  7    ETRKSQYK-KSIDSDESRRKREEASLSIRKNKREESLLKKR---TQAVPGSTPVKVDSLI  62

Query  71   QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR  130
               +   +  +V  INS N +  L++T A RKLLS EK PPI+ +I+ G++P+ V FL  
Sbjct  63   NQRLEQ-LPSLVAEINSENPDLILKSTTAFRKLLSIEKSPPIEEVIKTGIVPRLVKFLYM  121

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
             D   +QFE+AWALTNIASGT EQT+ V++ GAI  F+ LL+SPH  + EQAVWALGNIA
Sbjct  122  QDFPQLQFEAAWALTNIASGTPEQTRVVIENGAIQVFVLLLSSPHDDVREQAVWALGNIA  181

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE  250
            GD    RDLV+ + A+ PLL+LL  P  +++    +RN TWTLSN CR K P PP + V 
Sbjct  182  GDSHYCRDLVLSHNALPPLLSLLQNP--AAIKVSMVRNATWTLSNFCRGK-PQPPFEIVR  238

Query  251  QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
              LP L +L+++ D EVL D CWA+SYL+DG NERI  V+   V  ++V+LLG   + + 
Sbjct  239  ASLPVLAKLIYYQDEEVLIDACWALSYLSDGSNERIQEVIDAKVCRKMVELLGHPTIAVQ  298

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
            TPALR IGNIVTG D QTQ+V+   AL+   +LL +PK  I+KEA WT+SNITAG ++QI
Sbjct  299  TPALRTIGNIVTGDDNQTQIVLSVQALSHLLNLLQSPKRAIRKEACWTISNITAGDKNQI  358

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            QQV++  ++P LV +L+ A+F+ QKEA WA++N TS GT +QI +LV  G ++PL +LL 
Sbjct  359  QQVIDANIIPSLVYLLANAEFEIQKEAAWAISNATSCGTPQQIHFLVSQGCVKPLCDLLK  418

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSI---MIEECGGLDKIEALQNHENESVYKA  487
              D +II V L+ I NI  A +K  +   ++    +IE+  GL KI  LQ+H N+  ++ 
Sbjct  419  VSDPRIINVALEGIENILVAGKKEAQVTGVNPYKKIIEDADGLGKIYDLQHHMNKDTFEK  478

Query  488  SLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDG  522
               +I  Y   E+E++ +++PE +S  ++ Q    
Sbjct  479  VSRIISTYLEDEQEDEGDLMPEGSSFSFSNQTNSN  513


> sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa OX=9823 
GN=KPNA7 PE=2 SV=2
Length=507

 Score =  563 bits (1451),  Expect = 0.0, Method: Composition-based stats.
 Identities = 268/498 (54%), Positives = 363/498 (73%), Gaps = 11/498 (2%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL  64
                 P  RL +FK +GKD++  R++R+ V++ELRKAKKD+Q LKRRN+++    A+ P 
Sbjct  2    PILEAPEERLRKFKYRGKDASVRRQQRLAVSLELRKAKKDEQALKRRNITT----ASDPF  57

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
             +  N       ++ +I+ G+N+S+ E   QATQAARK+LS+E+ PP+  ++ AGLIP+ 
Sbjct  58   VQQTNGAK---LTLQEIIHGVNASDPEQCFQATQAARKMLSQERNPPLKLMVEAGLIPRL  114

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            V  L  +    +QFE+AWALTNIASG SE T+AVV+GGAI   + LLAS H  + EQAVW
Sbjct  115  VQLLRSSLHPCLQFEAAWALTNIASGASELTRAVVEGGAIQPLVELLASSHMSVCEQAVW  174

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALGNIAGDG+ FRD+VI   A+  LLAL +    S++   +LRN+ WTLSNLCRNKNP P
Sbjct  175  ALGNIAGDGAEFRDIVISSNAIPHLLALAS----SNVPVTFLRNIVWTLSNLCRNKNPCP  230

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
              +AV+Q+LP L  LL H D EVL+DTCWA+SYLTDG +ERIG VV  GV+P+LV+L+ +
Sbjct  231  CDNAVKQMLPVLSHLLQHRDSEVLSDTCWALSYLTDGCDERIGQVVDMGVLPRLVELMTS  290

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            SEL ++TP+LR +GNIVTGTD QTQ+ IDAG L+V P LL +P+++IQKEA W +SN+ A
Sbjct  291  SELNVLTPSLRTVGNIVTGTDPQTQLAIDAGLLSVLPHLLLHPRSSIQKEAAWALSNVAA  350

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G    IQQ++  G +P LV++L   +FK QKEAVW V N+T+GGTV+Q+V LV  G++EP
Sbjct  351  GPHQHIQQLIACGALPPLVALLKNGEFKVQKEAVWTVANFTTGGTVDQLVQLVQAGVLEP  410

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
            L+NLL  +DTK++++ILD I  I QAAEK+ + E + ++IE  GG+DKIEALQ HEN  V
Sbjct  411  LINLLDIQDTKMVIIILDVIFFILQAAEKISQKENMCLLIEGLGGIDKIEALQLHENRQV  470

Query  485  YKASLSLIEKYFSVEEEE  502
               +LS+IE+YFS EE+ 
Sbjct  471  ALTALSIIERYFSEEEDA  488


> sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis 
elegans OX=6239 GN=ima-3 PE=1 SV=2
Length=514

 Score =  562 bits (1449),  Expect = 0.0, Method: Composition-based stats.
 Identities = 235/522 (45%), Positives = 333/522 (64%), Gaps = 15/522 (3%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNN  70
            + R   +KN  K+    + +R E  V +RK K+++ + KRRN+++  +D +   + +   
Sbjct  3    SNRQAYYKNNAKEQI-GKEKRNEEVVSIRKDKREEAISKRRNINTQIEDDS---ETSTTP  58

Query  71   QGTVNWSVDDI-VKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG  129
             G  + ++  + V    SS+   QL A Q ARK+LS ++ PPID++I +G++P  V  L 
Sbjct  59   PGPFDANLLRLTVAAAQSSDPAEQLTAVQQARKMLSTDRNPPIDDLIGSGILPVLVQCLS  118

Query  130  RTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI  189
             TD   +QFE+AWALTNIASGTSEQT+AVV+ GA+P F+ LL+  + ++ EQ+VWALGNI
Sbjct  119  STD-PNLQFEAAWALTNIASGTSEQTQAVVNAGAVPLFLQLLSCGNLNVCEQSVWALGNI  177

Query  190  AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
             GDG  FRD  ++ G + PLL  +       +  G+LRN+TW + NLCR K+PAP    V
Sbjct  178  IGDGPHFRDYCLELGILQPLLQFIN----PEIPIGFLRNVTWVIVNLCRCKDPAPSPAVV  233

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI  309
              ILP L  L+HH D  +L DT WA+SYLTDG NE I MV++  VV  LV LLG  ++ +
Sbjct  234  RTILPALSLLIHHQDTNILIDTVWALSYLTDGGNEHIQMVIEAQVVTHLVPLLGHVDVKV  293

Query  310  VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ  369
             T ALRA+GNIVTGTDEQTQ+V+D+G L   P LL + K  I KEA W +SNITAG Q Q
Sbjct  294  QTAALRAVGNIVTGTDEQTQLVLDSGVLRFMPGLLAHYKEKINKEAVWFVSNITAGNQQQ  353

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
            +Q V + G++P ++ +L + DF TQKEA WA++N T  G   Q+  +V  G++ P   +L
Sbjct  354  VQDVFDAGIMPMIIHLLDRGDFPTQKEAAWAISNVTISGRPNQVEQMVKLGVLRPFCAML  413

Query  430  TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASL  489
            +  D++II V+LD I+NI + A +  E  +++  IEECGGLDKIE LQNHENE +YK + 
Sbjct  414  SCTDSQIIQVVLDGINNILKMAGEAAE--QVTSEIEECGGLDKIENLQNHENEDIYKLAF  471

Query  490  SLIEKYFSVEEEEDQNVVPETTS--EGYTFQVQDGAPGTFNF  529
             +I+ +FS ++E   NV    +S   G    V D   G +NF
Sbjct  472  EIIDNFFSSDDE-TGNVEGAQSSAFGGDVPPVPDAPNGGWNF  512


> sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster 
OX=7227 GN=Pen PE=1 SV=2
Length=522

 Score =  543 bits (1398),  Expect = 0.0, Method: Composition-based stats.
 Identities = 261/525 (50%), Positives = 352/525 (67%), Gaps = 11/525 (2%)

Query  9    TPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENR  68
               +R   +K    ++ + R RR EV +ELRK+KK+DQM KRRN++   +D TSPL+E  
Sbjct  5    DSNSRQGSYKANSINTQDSRMRRHEVTIELRKSKKEDQMFKRRNIND--EDLTSPLKE-L  61

Query  69   NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL  128
            N Q  V  SVD+IV  +NS + E Q    Q+ARK+LSRE+ PPID +I  G++P  + FL
Sbjct  62   NGQSPVQLSVDEIVAAMNSEDQERQFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFL  121

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN  188
              T+ S +QFE+AWALTNIASGTS+QT+ V++  A+P F++LL S   +++EQAVWALGN
Sbjct  122  QNTNNSMLQFEAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGN  181

Query  189  IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
            IAGDG+  RD+VI +  +D +L L+     +     +LRN+ W +SNLCRNKNP+PP D 
Sbjct  182  IAGDGAAARDIVIHHNVIDGILPLIN----NETPLSFLRNIVWLMSNLCRNKNPSPPFDQ  237

Query  249  VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP  308
            V+++LP L +LL   D +VLAD CWA+SY+TD  N +I  VV +  VP+LVKLL   E  
Sbjct  238  VKRLLPVLSQLLLSQDIQVLADACWALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPS  297

Query  309  IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            I+ PALR++GNIVTGTD+QT VVI +G L     LL + K+NI KEA WT+SNITAG Q 
Sbjct  298  IIVPALRSVGNIVTGTDQQTDVVIASGGLPRLGLLLQHNKSNIVKEAAWTVSNITAGNQK  357

Query  369  QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH-CGIIEPLMN  427
            QIQ V+  G+   L +VL K DFK QKEA WAVTN T+ GT EQIV L+    I++P ++
Sbjct  358  QIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAVTNTTTSGTPEQIVDLIEKYKILKPFID  417

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKA  487
            LL  KD + I V+   +SN+F  AEKLG TE L +M+EE GGLDK+E LQ HENE VYK 
Sbjct  418  LLDTKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEEMGGLDKLETLQQHENEEVYKK  477

Query  488  SLSLIEKYFS-VEEEEDQNVVPETTSEGYTFQ--VQDGAPGTFNF  529
            + ++I+ YFS  ++E +Q + P+  +    F         G + F
Sbjct  478  AYAIIDTYFSNGDDEAEQELAPQEVNGALEFNATQPKAPEGGYTF  522


> sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA7 PE=2 SV=1
Length=528

 Score =  534 bits (1375),  Expect = 0.0, Method: Composition-based stats.
 Identities = 204/505 (40%), Positives = 289/505 (57%), Gaps = 34/505 (7%)

Query  7    ANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE  66
              T + R   +K    D    RRRR +  VE+RKAK+++ +LK+R  +     +   L +
Sbjct  4    GETMSVRRSGYKA-VVDGVGGRRRREDDMVEIRKAKREESLLKKRREALPHSPSADSLDQ  62

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREK-QPPIDNIIRAGLIPKFV  125
                          ++  I S   +  ++AT   R LL  E     ++ +I+AGL+P+FV
Sbjct  63   -------------KLISCIWSDERDLLIEATTQIRTLLCGEMFNVRVEEVIQAGLVPRFV  109

Query  126  SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA  185
             FL   D   +QFE+AWALTNIASGTSE T+ V+D GA+   + LL SP+  + EQ VWA
Sbjct  110  EFLTWDDSPQLQFEAAWALTNIASGTSENTEVVIDHGAVAILVRLLNSPYDVVREQVVWA  169

Query  186  LGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPP  245
            LGNI+GD    RD+V+ + A+  LL  L            L N  WTLSNLCR K P PP
Sbjct  170  LGNISGDSPRCRDIVLGHAALPSLLLQLN----HGAKLSMLVNAAWTLSNLCRGK-PQPP  224

Query  246  IDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS  305
             D V   LP L +L+  DD E+LA TCWA+ YL+DG NE+I  V++  V  +L+ L    
Sbjct  225  FDQVSAALPALAQLIRLDDKELLAYTCWALVYLSDGSNEKIQAVIEANVCARLIGLSIHR  284

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITA  364
               ++TPALR IGNIVTG D QTQ +ID  AL    +LL  +    I+KEA WT+SNITA
Sbjct  285  SPSVITPALRTIGNIVTGNDSQTQHIIDLQALPCLVNLLRGSYNKTIRKEACWTVSNITA  344

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            G Q QIQ V +  + P LV++L  ++   +KEA WA+ N  +GG+ +QI++LV    I+P
Sbjct  345  GCQSQIQAVFDADICPALVNLLQNSEGDVKKEAAWAICNAIAGGSYKQIMFLVKQECIKP  404

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-------------MIEECGGLD  471
            L +LLT  DT++++V L+A+  I +  E         I             +IEE  GL+
Sbjct  405  LCDLLTCSDTQLVMVCLEALKKILKVGEVFSSRHAEGIYQCPQTNVNPHAQLIEEAEGLE  464

Query  472  KIEALQNHENESVYKASLSLIEKYF  496
            KIE LQ+HEN  +Y+ ++ ++E Y+
Sbjct  465  KIEGLQSHENNDIYETAVKILETYW  489


> sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus 
OX=10090 GN=Kpna7 PE=1 SV=1
Length=499

 Score =  532 bits (1370),  Expect = 0.0, Method: Composition-based stats.
 Identities = 244/502 (49%), Positives = 338/502 (67%), Gaps = 10/502 (2%)

Query  7    ANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQE  66
            +  P  RL  +K +GK+ +  R++RI  +++LRK +KD+Q+LKRRN+  F  D  S    
Sbjct  4    SKAPKERLKNYKYRGKEMSLPRQQRIASSLQLRKTRKDEQVLKRRNIDLFSSDMVSQALV  63

Query  67   NRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVS  126
                   VN+++DDI++ +NSS+     +AT+AAR+++S+E  PP++ II AGLIPK V 
Sbjct  64   -----KEVNFTLDDIIQAVNSSDPILHFRATRAAREMISQENTPPLNLIIEAGLIPKLVD  118

Query  127  FLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL  186
            FL  T    +QFE+AW LTNIASGTSEQT+AVV  GAI   I LL SPH  +SEQAVWAL
Sbjct  119  FLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWAL  178

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI  246
            GNIAGD + FRD VI   A+  L+ L++      +   +LRN++WTLSNLCRNK+P P  
Sbjct  179  GNIAGDCAEFRDCVISNNAIPHLINLIS----KGIPITFLRNISWTLSNLCRNKDPYPSE  234

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
             AV Q+LP L +LL H D E+LADTCWA+SYLT G  E I  VV TG++P+LV+L+ +SE
Sbjct  235  SAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSE  294

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
            L I  P L  IGNIV GTDEQTQ+ IDAG L V   +L +PKT+IQ  A WTMSN+ AG 
Sbjct  295  LSISIPCLHTIGNIVAGTDEQTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAAGP  354

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
            + Q++Q++   L+P LV +L  A+ K QKE V  V N  +G + +Q+  L H GI+EP++
Sbjct  355  RHQVEQLL-CNLLPILVDLLRNAELKVQKEVVCTVINIATGASQDQLTLLAHSGILEPML  413

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYK  486
            +LL+A D ++++++LD IS + Q  + L E ++L   IE+ GG +KIE LQ+H N S+  
Sbjct  414  SLLSAPDLEVVIIVLDIISYLLQHIDNLQEKKRLYFQIEKFGGFEKIECLQHHHNISISN  473

Query  487  ASLSLIEKYFSVEEEEDQNVVP  508
            ++L +IEKYF  + + D    P
Sbjct  474  SALDIIEKYFCEDGDGDSLPGP  495


> sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dictyostelium 
discoideum OX=44689 GN=DDB_G0273149 PE=3 SV=1
Length=550

 Score =  480 bits (1236),  Expect = 1e-162, Method: Composition-based stats.
 Identities = 202/545 (37%), Positives = 302/545 (55%), Gaps = 34/545 (6%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            MS+ +  +   +R   FK K  DS   RR+R E ++ +RK  +++ MLKRR +       
Sbjct  1    MSSRDKQD---SRKKEFK-KSLDSETARRKREENSIGIRKNAREELMLKRRGIVQPNPST  56

Query  61   T----SPLQENRNNQGTVNWSVDD-------IVKGINSSNVENQLQATQAARKLLSREKQ  109
            +     P +     Q   N ++++       +V  +NS++      +    RKLLS    
Sbjct  57   SYQIIVPPEVQEQFQKYENETMENKIKNLPGLVTALNSNDQAYVYSSLVQFRKLLSIHAY  116

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS  169
            PPID +I  G+IPK    L   +   +QFESAWALTNIASG + QT+ V++ G++P FI 
Sbjct  117  PPIDQVIECGIIPKLNQLLQ-CNNPKVQFESAWALTNIASGNNRQTQTVMESGSVPIFIQ  175

Query  170  LLASPHAH-ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD---------MS  219
            LL +     + EQ  WALGNIAGD    R+ ++KYGA++ L+ LL   +          S
Sbjct  176  LLCAETTDEVKEQCAWALGNIAGDTVDSRNYLLKYGAMNALIPLLHYGEDNGATTTSANS  235

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDD--PEVLADTCWAISY  277
                G ++N+ WT+SNLCR K P P    V Q LP +  L+  ++   E+  D CWA+SY
Sbjct  236  ERKIGLIQNVVWTISNLCRGK-PQPDFSVVSQCLPAINELIRIENLPSEIYGDLCWALSY  294

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L DGPN +I  V+ +GVVP+LVKLL   +  + TPALRA+GNIVTG   QTQ+VID   +
Sbjct  295  LCDGPNTKIQAVIDSGVVPRLVKLLEYPDSIVFTPALRAVGNIVTGESSQTQIVIDNNGV  354

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV-NHGLVPFLVSVLSKADFKTQKE  396
             +   LL   K +I+KE+ W +SNITAG   QI  VV N   V  L+S+LS ++   ++E
Sbjct  355  ELITRLLAVQKKSIRKESCWALSNITAGEPSQIDVVVSNPKTVTTLISLLSHSEHDIKRE  414

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            A WA++N T+  + + I  LV   I++  ++LL ++D  I+ ++L+ + NI +  EK   
Sbjct  415  ACWALSNSTNNSSTKSIQTLVRHNILKHFIDLLNSQDLVILKIVLEGLINIIKEGEKTKT  474

Query  457  TEKLSI---MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSE  513
               ++    +I E  G   I  LQ H+++ VYK +  LIE + S +  + +N  P     
Sbjct  475  KTGVNPYVNLISEMQGESIIYDLQEHQSKDVYKKAFELIEFFESSDYSDSENSEPNINQN  534

Query  514  G-YTF  517
            G Y F
Sbjct  535  GQYEF  539


> sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis 
elegans OX=6239 GN=ima-2 PE=1 SV=1
Length=531

 Score =  468 bits (1204),  Expect = 5e-158, Method: Composition-based stats.
 Identities = 196/526 (37%), Positives = 300/526 (57%), Gaps = 22/526 (4%)

Query  5    ENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPD--DATS  62
            E       RL ++KN  K   E+RRRR E +VE+RK K  D M+KRRN+    +  ++ S
Sbjct  13   EEGKDEGGRLQQYKNLTKH-EELRRRRTECSVEIRKQKGADMMMKRRNIVDVDEGGNSES  71

Query  63   PLQENR---NNQGTVNWSVDDIVKGINSSNV--ENQLQATQAARKLLSREKQPPIDNIIR  117
             L+E     + Q +   S D+ ++ I S+N   ++ ++  ++ RK LS+ K PPID +I 
Sbjct  72   ELEEPEKISHQQSSTRLSNDE-IRAILSNNPSEDDMVRCFESLRKSLSKTKNPPIDEVIH  130

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
             GL+   V  L   +   +Q+E+AWALTNI SG++EQT A V+ G     I L     A 
Sbjct  131  CGLLQALVQALS-VENERVQYEAAWALTNIVSGSTEQTIAAVEAGVTIPLIHLSVHQSAQ  189

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
            ISEQA+WA+ NIAGD S  RD VIK   V+ L+ L+   D   L   ++R + W  SN+C
Sbjct  190  ISEQALWAVANIAGDSSQLRDYVIKCHGVEALMHLMEKVD--QLGDSHVRTIAWAFSNMC  247

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
            R+KNP  P++ +  +   LV+L+ H D +V  D CWA+SYLTDGP+E+I +  ++GV+P 
Sbjct  248  RHKNPHAPLEVLRVLSKGLVKLVQHTDRQVRQDACWAVSYLTDGPDEQIELARESGVLPH  307

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEAT  356
            +V     +E  +V PALR +GN+ TG D  TQ VID G+L  + P +     ++I KE  
Sbjct  308  VVAFFKEAE-NLVAPALRTLGNVATGNDSLTQAVIDLGSLDEILPLMEKTRSSSIVKECC  366

Query  357  WTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL  416
            W +SNI AG Q QIQ V++  L+P L++VL   D K Q EA WA++N   GGT  Q+V +
Sbjct  367  WLVSNIIAGTQKQIQAVLDANLLPVLINVLKSGDHKCQFEASWALSNLAQGGTNRQVVAM  426

Query  417  VHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM---IEECGGLDKI  473
            +   ++  L   L   +T ++   L+ +  +    +  G   K+ I+   +EE GGLD +
Sbjct  427  LEDNVVPALCQALLQTNTDMLNNTLETLYTLMLTVQN-GYPHKVDILHDQVEENGGLDSL  485

Query  474  EALQNHENESVYKASLSLIEKYFSVEE----EEDQNVVPETTSEGY  515
            E LQ  ++E +Y  +  +I ++F+ ++    E  +N  P+     +
Sbjct  486  ERLQESQSEQIYTQAYRIITQFFTDDDAGEKESHENADPQDNKWSF  531


> sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA8 PE=3 SV=1
Length=441

 Score =  423 bits (1087),  Expect = 1e-141, Method: Composition-based stats.
 Identities = 157/432 (36%), Positives = 240/432 (56%), Gaps = 20/432 (5%)

Query  71   QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR  130
            +  VN   DDI+ G+ S +   QL++    R++ S+     I  +IR+G++P+ V  L  
Sbjct  4    KTEVNEVSDDIIDGLWSDDPPLQLESVTKIRRITSQRD---ISCVIRSGVVPRLVQLLKN  60

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
                 +Q+E AWALTNIA                P  I L+ASP  ++ EQA+W L N+A
Sbjct  61   QVFPKLQYEVAWALTNIAVDNPGVVVNNNAV---PVLIQLIASPKDYVREQAIWTLSNVA  117

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE  250
            G    +RD V+  G + PLL LL            LR  TW L NLCR K P P  D V+
Sbjct  118  GHSIHYRDFVLNSGVLMPLLRLL-------YKDTTLRIATWALRNLCRGK-PHPAFDQVK  169

Query  251  QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
              LP L  LLH  D +VL + C A+ +L++G  + I  V++ G VP+LV++L      ++
Sbjct  170  PALPALEILLHSHDEDVLKNACMALCHLSEGSEDGIQSVIEAGFVPKLVQILQLPSPVVL  229

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQ  369
             PAL  IG +  G  +QTQ VI++GAL +  ++LT N +  I+K A W +SNITAG ++Q
Sbjct  230  VPALLTIGAMTAGNHQQTQCVINSGALPIISNMLTRNHENKIKKCACWVISNITAGTKEQ  289

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
            IQ V++  L+P LV++    DF  +KEAVWA++N    G+ +QI Y+     I+ L ++L
Sbjct  290  IQSVIDANLIPILVNLAQDTDFYMKKEAVWAISNMALNGSHDQIKYMAEQSCIKQLCDIL  349

Query  430  TAKDTK-IILVILDAISNIFQAAEKLGETE---KLSIMIEECGGLDKIEALQNHENESVY  485
               D +  IL  LD + N+ +A E    +E      ++IE+  GL+KI  LQ ++N+ +Y
Sbjct  350  VYSDERTTILKCLDGLENMLKAGEAEKNSEDVNPYCLLIEDAEGLEKISKLQMNKNDDIY  409

Query  486  KASLSL-IEKYF  496
            + +  + +  +F
Sbjct  410  EKAYKILVTNWF  421


> sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa 
subsp. japonica OX=39947 GN=Os01g0158000 PE=2 SV=1
Length=528

 Score =  329 bits (844),  Expect = 3e-104, Method: Composition-based stats.
 Identities = 117/525 (22%), Positives = 236/525 (45%), Gaps = 44/525 (8%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNN  70
                   K+  +++   RRR  E  + + K ++ + +++ + V   P   +   +    +
Sbjct  17   QHHREALKSSVRNTAASRRR--EQAIAIGKERR-EALIRAKRVCRAPISGSDEAEMEEGD  73

Query  71   ----------QGTVNWSVDDIVKGINSSNVENQ---LQATQAARKLLSREKQPPIDNIIR  117
                      +     +V+++   ++      Q   ++A +  R+LLS+ + P +D  I+
Sbjct  74   MVVDEEKACLEAKTAHAVEELKSALSIQGKGVQKKKIEALRDLRRLLSQPEVPLVDTAIK  133

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH  177
            AG +P  V +L          E+AW LTNIA+G  E+TK+++          L       
Sbjct  134  AGAVPLLVQYLSFGSSDEQLLEAAWCLTNIAAGEPEETKSLLPA-LPLLIAHLGEKSSTL  192

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
            ++EQ  WA+GN+AG+G+  R  ++  GA+ PL  L+      S      R   W +SNL 
Sbjct  193  VAEQCAWAIGNVAGEGAELRSTLLAQGALRPLTRLM-----FSSKGSTARTAAWAMSNLI  247

Query  238  RNKNPAP--PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
            +  +P     +  ++ +L  ++  L  +D E+  +  W + YL+   +  I ++V++ V 
Sbjct  248  KGPDPKAANELITIDGVLNAIIASLEKEDEELATEVAWVVVYLSALSDRGISLIVRSSVP  307

Query  296  PQLV-KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG------ALAVFPSLLTNPK  348
              L+ +L  +  L ++ P LR +GN++   D     V+  G      AL+     L +  
Sbjct  308  QLLIGRLFSSENLQLLIPVLRGLGNLIAADDYMVDSVLTVGHNIIDQALSGLIKCLKSDN  367

Query  349  TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG  408
              ++KE++W +SNI AG  +  + +      P L+ +++   F  ++EA + + N     
Sbjct  368  RVLRKESSWALSNIAAGSFEHKKLIFASEATPVLIRLVTSMQFDIRREAAYTLGNLCVVP  427

Query  409  T---------VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK  459
            T         VE +V +V  G +   ++L+ + D     + L  +  + +        + 
Sbjct  428  TGNCELPKIIVEHLVAIVDGGALPGFIHLVRSADVDTAGLGLQFLELVMRGYPNKQGPK-  486

Query  460  LSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQ  504
               ++E   G++ +E  Q HENE +   +  L+++YF  +   D+
Sbjct  487  ---LVEMEDGIEAMERFQFHENEQMRNMANGLVDEYFGEDYGLDE  528


> sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis 
thaliana OX=3702 GN=IMPA9 PE=3 SV=1
Length=519

 Score =  321 bits (824),  Expect = 2e-101, Method: Composition-based stats.
 Identities = 133/526 (25%), Positives = 242/526 (46%), Gaps = 42/526 (8%)

Query  9    TPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRR---------NVSSFPDD  59
            + + R    K+   +    RRR+  V V   K +++  +  +R            +  ++
Sbjct  6    SASNRRDPIKSSVGNVAGQRRRKQAVTVA--KERRELLVRAKRLCRVGTNGDVEDALVEN  63

Query  60   ATSPLQENRNNQGTVNWSVDDIVKGINSSN---VENQLQATQAARKLLSREKQPPIDNII  116
                 +E    +   + SV+++   +       ++ ++ A +  R+LLS+ + PP++  +
Sbjct  64   EMMVDEEQPILEAQASKSVEELKSAVQYQGKGAMQKRVTALRELRRLLSKSEFPPVEAAL  123

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA  176
            RAG IP  V  L          ESAW LTNIA+G  E+TKA++          L     A
Sbjct  124  RAGAIPLLVQCLSFGSPDEQLLESAWCLTNIAAGKPEETKALLPA-LPLLIAHLGEKSSA  182

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             ++EQ  WA+GN+AG+G   R++++  GA+ PL  ++  PD        +R   W LSNL
Sbjct  183  PVAEQCAWAIGNVAGEGEDLRNVLLSQGALPPLARMI-FPD----KGSTVRTAAWALSNL  237

Query  237  CRN--KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
             +      A  +  ++ IL  ++R L   D E   +  W I YL+   +    M++K G+
Sbjct  238  IKGPESKAAAQLVKIDGILDAILRHLKKTDEETATEIAWIIVYLSALSDIATSMLLKGGI  297

Query  295  VPQLV-KLLGASELPIVTPALRAIGNIVTGTDEQTQVVI------DAGALAVFPSLLTNP  347
            +  L+ +L  +S L ++ P LR++GN V    +    ++      +   + V    L + 
Sbjct  298  LQLLIDRLATSSSLQLLIPVLRSLGNFVAVDPKAVLTILIREQNTEESIIGVLAKCLRSE  357

Query  348  KTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG  407
               ++KEA W +SNI AG  +  + + +  ++P L+ +LS + F  +KE  + + N    
Sbjct  358  HRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMPLLLRILSTSPFDIRKEVAYVLGNLCVE  417

Query  408  GT---------VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
                        E +V +V  G +   + L+ + D +   + L  I  + +     GE  
Sbjct  418  SAEGDRKPRIIQEHLVSIVSGGCLRGFIELVRSPDIEAARLGLQFIELVLRGMPN-GEGP  476

Query  459  KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQ  504
            K   ++E   G+D +E  Q HENE +   + SL++KYF  +   D+
Sbjct  477  K---LVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGEDYGIDE  519


> sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis 
elegans OX=6239 GN=ima-1 PE=1 SV=1
Length=524

 Score =  299 bits (766),  Expect = 9e-93, Method: Composition-based stats.
 Identities = 107/538 (20%), Positives = 223/538 (41%), Gaps = 91/538 (17%)

Query  11   AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS----------------  54
              R   +K+  +D  EMRR+R E  V++RK ++D++  + R ++                
Sbjct  10   EERSKMYKSNVRDQNEMRRKRREDEVQIRKNRRDEKFERNRQITVQRSLSHEETSELLKS  69

Query  55   ----------SFPDDATSPLQENRNNQGTVNWSVDDIVKG---INSSNVENQLQATQAAR  101
                      +   +A + L EN NN     W++  +VK       S+V      +Q  R
Sbjct  70   VADGLQSMQETTIHEALTVLHENLNN---TVWTIHVLVKVQILHKLSDVYCNRVISQTTR  126

Query  102  KLLSRE--KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV  159
             L+SR   K   ID +       K+  +     C          + NI++  S +     
Sbjct  127  LLISRTLLKISGIDEV-------KYERYSSDDRCIQ------SLVFNISTYGSSEDILCD  173

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
               +I  FI                 + +I      +R+L +    V  L+      D S
Sbjct  174  TFQSIACFI-----------------IRSIT-----YRNLALDCAIVSELI------DAS  205

Query  220  SLACGYL--RNLTWTLSNLCRNKNPA-PPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
            ++    +  R+L W +   C   +   P +D +  +L  +   +   D  V  D   + +
Sbjct  206  TINMSIILHRSLMWLVFLFCEKLDRCSPHVDEIAPLLEIISNGIQSTDAMVQTDAASSCA  265

Query  277  YLTDGP---NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVID  333
             L + P   +    + + + +V  L    G +   +       I +I+  T   T+ +ID
Sbjct  266  SLAEWPPIYHYMSDLKLCSKLVANLRNDKGNARPKVK----AGINSIIQATGYFTEEMID  321

Query  334  AGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKT  393
            AG L V    +    + + +E  + +SNI    +  I ++++ G++  +  V+  +++++
Sbjct  322  AGLLEVLKGFVN--VSYMSQEVCFIISNICVEGEQTIDKLISSGVLREVARVMEASEYRS  379

Query  394  QKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            ++EA + + +  +    + + Y+V  G++    +LLT  D  ++  ILDAI  + Q  E 
Sbjct  380  RREAAFVICHCCASANQKHLEYVVELGMLSAFTDLLTCMDVSLVSYILDAIYLLLQFGEM  439

Query  454  L---GETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVP  508
                  +  ++I +EE G  +K+E L   ++  ++  + ++I++++ V+++   N  P
Sbjct  440  RLLPDNSNPVAIKLEEIGCREKLEFLCESQSVDIHARAYTIIDRFY-VDDDAPLNDDP  496


> sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain 
PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 
GN=VAC8 PE=3 SV=4
Length=559

 Score =  295 bits (755),  Expect = 9e-91, Method: Composition-based stats.
 Identities = 98/436 (22%), Positives = 171/436 (39%), Gaps = 31/436 (7%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +++ + S NVE Q  A      L + E+      I R+G +      L ++    +Q
Sbjct  130  LTPLIRQMMSPNVEVQCNAVGCITNLATHEENKA--KIARSGALGPLTR-LAKSRDMRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GAIP  + LL+SP   +      AL NIA D S  R
Sbjct  187  RNATGALLNM-THSDENRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRR  245

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +          L NL  ++     I     + P L+
Sbjct  246  KLAQS----EPKLVQSLVNLMDSTSPKVQCQAALALRNLASDEKYQLDIVRANGLHP-LL  300

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            RLL      ++      I  ++  P      +++T  +  LV LLG+++   I   A+  
Sbjct  301  RLLQSSYLPLILSAVACIRNISIHP-MNESPIIETNFLKPLVDLLGSTDNEEIQCHAIST  359

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +D    +V+DAGA+     L+ +    +Q E T  ++ +     D    ++N 
Sbjct  360  LRNLAASSDRNKALVLDAGAVQKCKQLVLDVPITVQSEMTAAIAVLAL-SDDLKSHLLNL  418

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSG-GTVEQIVY---LVHCGIIEPLMNLLTAK  432
            G+   L+ +      + Q  +  A+ N +S  G     V        GI   L   L + 
Sbjct  419  GVCGVLIPLTHSPSIEVQGNSAAALGNLSSKVGDYSIFVQNWTEPQGGIHGYLCRFLQSG  478

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI  492
            D     + +     + Q  E   +T          G + K E +  H    +   +   I
Sbjct  479  DATFQHIAV---WTLLQLFESEDKTL--------IGLIGKAEDIIEH----IRSIANRQI  523

Query  493  EKYFSVEEEEDQNVVP  508
            E     E+E++  VV 
Sbjct  524  EPDNEFEDEDEGEVVN  539


 Score =  210 bits (534),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 75/355 (21%), Positives = 149/355 (42%), Gaps = 21/355 (6%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + +S L  ++   +Q  ++     I    +E+    VD   +   + LL SP   +   A
Sbjct  52   RALSTLVFSENIDLQRSASLTFAEI----TERDVREVDRDTLEPILFLLQSPDIEVQRAA  107

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A D    + L+++ G + PL+  +  P++         N    ++NL  ++  
Sbjct  108  SAALGNLAVDTEN-KVLIVQLGGLTPLIRQMMSPNVE-----VQCNAVGCITNLATHEEN  161

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I      L  L RL    D  V  +   A+  +T   +E    +V  G +P LV+LL
Sbjct  162  KAKIAR-SGALGPLTRLAKSRDMRVQRNATGALLNMT-HSDENRQQLVNAGAIPVLVQLL  219

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEATWTMSN  361
             + ++ +      A+ NI      + ++      L     +L+ +    +Q +A   + N
Sbjct  220  SSPDVDVQYYCTTALSNIAVDASNRRKLAQSEPKLVQSLVNLMDSTSPKVQCQAALALRN  279

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +  + Q+  V  +GL P L+ +L  +       AV  + N +     E    ++    
Sbjct  280  LASDEKYQLDIVRANGLHP-LLRLLQSSYLPLILSAVACIRNISIHPMNESP--IIETNF  336

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            ++PL++LL + D + I     AIS +   A     +++   ++ + G + K + L
Sbjct  337  LKPLVDLLGSTDNEEIQ--CHAISTLRNLA---ASSDRNKALVLDAGAVQKCKQL  386


 Score =  198 bits (503),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 75/348 (22%), Positives = 142/348 (41%), Gaps = 27/348 (8%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
             G  + A  +L+ S +  +   A      I       R+  +    ++P+L LL  PD+ 
Sbjct  47   SGEPLRALSTLVFSENIDLQRSASLTFAEIT--ERDVRE--VDRDTLEPILFLLQSPDIE  102

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                   R  +  L NL  +      I  +   L  L+R +   + EV  +    I+ L 
Sbjct  103  -----VQRAASAALGNLAVDTENKVLIVQL-GGLTPLIRQMMSPNVEVQCNAVGCITNLA  156

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                E    + ++G +  L +L  + ++ +   A  A+ N+ T +DE  Q +++AGA+ V
Sbjct  157  TH-EENKAKIARSGALGPLTRLAKSRDMRVQRNATGALLNM-THSDENRQQLVNAGAIPV  214

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAV  398
               LL++P  ++Q   T  +SNI     ++ +       LV  LV+++     K Q +A 
Sbjct  215  LVQLLSSPDVDVQYYCTTALSNIAVDASNRRKLAQSEPKLVQSLVNLMDSTSPKVQCQAA  274

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLG---  455
             A+ N  S    +  + +V    + PL+ LL +    +IL  +  I NI           
Sbjct  275  LALRNLASDEKYQ--LDIVRANGLHPLLRLLQSSYLPLILSAVACIRNISIHPMNESPII  332

Query  456  ETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEED  503
            ET  L  +++          L + +NE +   ++S +    +  +   
Sbjct  333  ETNFLKPLVD---------LLGSTDNEEIQCHAISTLRNLAASSDRNK  371


> sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata 
(strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) 
OX=330879 GN=vac8 PE=3 SV=1
Length=578

 Score =  293 bits (749),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 84/388 (22%), Positives = 157/388 (40%), Gaps = 37/388 (10%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +++ + S NVE Q  A      L + E       I R+G +   +  L ++    +Q
Sbjct  149  LTPLIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLIR-LAKSKDMRVQ  205

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + +  + +V+ GAIP  + LL+SP   +      AL NIA D S  +
Sbjct  206  RNATGALLNM-THSDDNRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDASNRK  264

Query  198  DLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
             L   +   V  L+ L+      S            L NL  ++     I   +  LP L
Sbjct  265  RLAQTESRLVQSLVHLM-----DSSTPKVQCQAALALRNLASDEKYQLEIVRAKG-LPPL  318

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALR  315
            +RLL      ++      I  ++  P      ++  G +  LV LLG+++   I   A+ 
Sbjct  319  LRLLQSSYLPLILSAVACIRNISIHP-LNESPIIDAGFLKPLVDLLGSTDNEEIQCHAIS  377

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
             + N+   +D   ++V+ AGA+     L+     ++Q E T  ++ +     +    ++N
Sbjct  378  TLRNLAASSDRNKELVLQAGAVQKCKDLVLRVPLSVQSEMTAAIAVLAL-SDELKPHLLN  436

Query  376  HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS----------------GGTVEQIVYLVHC  419
             G+   L+ + +    + Q  +  A+ N +S                GG    +   +  
Sbjct  437  LGVFDVLIPLTNSESIEVQGNSAAALGNLSSKVGDYSIFVRDWADPNGGIHGYLKRFLAS  496

Query  420  G-------IIEPLMNLLTAKDTKIILVI  440
            G        I  L+ LL ++D ++I  I
Sbjct  497  GDPTFQHIAIWTLLQLLESEDKRLIGYI  524


 Score =  203 bits (516),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 76/347 (22%), Positives = 146/347 (42%), Gaps = 23/347 (7%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
             G  + A  +L+ S +  +   A      I       R+  +    ++P+L LL   D+ 
Sbjct  66   SGEPLRALSTLVYSDNVDLQRSASLTFAEIT--ERDVRE--VDRDTLEPILFLLQSSDIE  121

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                   R  +  L NL  N      I A+   L  L+R +   + EV  +    I+ L 
Sbjct  122  -----VQRAASAALGNLAVNAENKVLIVAL-GGLTPLIRQMMSPNVEVQCNAVGCITNLA  175

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                +    + ++G +  L++L  + ++ +   A  A+ N+    D + Q+V +AGA+ V
Sbjct  176  TH-EDNKAKIARSGALGPLIRLAKSKDMRVQRNATGALLNMTHSDDNRQQLV-NAGAIPV  233

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAV  398
               LL++P  ++Q   T  +SNI     ++ +       LV  LV ++  +  K Q +A 
Sbjct  234  LVQLLSSPDVDVQYYCTTALSNIAVDASNRKRLAQTESRLVQSLVHLMDSSTPKVQCQAA  293

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+ N  S    +  + +V    + PL+ LL +    +IL  +  I NI  +   L E+ 
Sbjct  294  LALRNLASDEKYQ--LEIVRAKGLPPLLRLLQSSYLPLILSAVACIRNI--SIHPLNESP  349

Query  459  KLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEEDQ  504
                 I + G L  + + L + +NE +   ++S +    +  +   +
Sbjct  350  -----IIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKE  391


 Score =  194 bits (492),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 90/443 (20%), Positives = 172/443 (39%), Gaps = 66/443 (15%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREK  108
            ++    +A S L     N+   ++   + ++ +     S NV+ Q  A+    ++  R+ 
Sbjct  41   LADNEREAVSDLLGYLENRAETDFFSGEPLRALSTLVYSDNVDLQRSASLTFAEITERD-  99

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWAL------------------------  144
               +  + R  L P    FL ++    +Q  ++ AL                        
Sbjct  100  ---VREVDRDTLEPIL--FLLQSSDIEVQRAASAALGNLAVNAENKVLIVALGGLTPLIR  154

Query  145  -----------------TNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
                             TN+A+    + K     GA+   I L  S    +   A  AL 
Sbjct  155  QMMSPNVEVQCNAVGCITNLATHEDNKAKIA-RSGALGPLIRLAKSKDMRVQRNATGALL  213

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            N+       + LV   GA+  L+ LL+ PD+           T  LSN+  + +    + 
Sbjct  214  NMTHSDDNRQQLV-NAGAIPVLVQLLSSPDVD-----VQYYCTTALSNIAVDASNRKRLA  267

Query  248  AVE-QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM-VVKTGVVPQLVKLLGAS  305
              E +++ +LV L+    P+V      A+  L    +E+  + +V+   +P L++LL +S
Sbjct  268  QTESRLVQSLVHLMDSSTPKVQCQAALALRNLA--SDEKYQLEIVRAKGLPPLLRLLQSS  325

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITA  364
             LP++  A+  I NI      ++  +IDAG L     LL +     IQ  A  T+ N+ A
Sbjct  326  YLPLILSAVACIRNISIHPLNESP-IIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAA  384

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
                  + V+  G V     ++ +     Q E   A+        ++   +L++ G+ + 
Sbjct  385  SSDRNKELVLQAGAVQKCKDLVLRVPLSVQSEMTAAIAVLALSDELKP--HLLNLGVFDV  442

Query  425  LMNLLTAKDTKIILVILDAISNI  447
            L+ L  ++  ++      A+ N+
Sbjct  443  LIPLTNSESIEVQGNSAAALGNL  465


> sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae 
(strain ATCC 42149 / RIB 40) OX=510516 GN=vac8 PE=3 SV=1
Length=578

 Score =  292 bits (748),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 83/389 (21%), Positives = 155/389 (40%), Gaps = 37/389 (10%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +++ + S NVE Q  A      L + E       I R+G +   +  L ++    +Q
Sbjct  149  LAPLIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLIR-LAKSKDMRVQ  205

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + +  + +V+ GAIP  + LL+S    +      AL NIA D S  +
Sbjct  206  RNATGALLNM-THSDDNRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRK  264

Query  198  DLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
             L   +   V  L+ L+      S            L NL  ++     I   +  LP L
Sbjct  265  RLAQTESRLVQSLVHLM-----DSSTPKVQCQAALALRNLASDEKYQLEIVRAKG-LPPL  318

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALR  315
            +RLL      ++      I  ++  P      ++  G +  LV LLG+++   I   A+ 
Sbjct  319  LRLLQSSYLPLILSAVACIRNISIHP-LNESPIIDAGFLKPLVDLLGSTDNEEIQCHAIS  377

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
             + N+   +D   ++V+ AGA+     L+     ++Q E T  ++ +     +    ++N
Sbjct  378  TLRNLAASSDRNKELVLQAGAVQKCKDLVLKVPLSVQSEMTAAIAVLAL-SDELKPHLLN  436

Query  376  HGLVPFLVSVLSKADFKTQKEAVWAVTNYTS----------------GGTVEQIVYLVHC  419
             G+   L+ +      + Q  +  A+ N +S                GG    +   +  
Sbjct  437  LGVFDVLIPLTESESIEVQGNSAAALGNLSSKVGDYSIFVRDWADPNGGIHGYLKRFLAS  496

Query  420  G-------IIEPLMNLLTAKDTKIILVIL  441
            G        I  L+ LL ++D ++I  I 
Sbjct  497  GDPTFQHIAIWTLLQLLESEDKRLISYIA  525


 Score =  212 bits (539),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 71/350 (20%), Positives = 148/350 (42%), Gaps = 21/350 (6%)

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L  +D   +Q  ++     I    +E+    VD   +   + LL S    +   A  ALG
Sbjct  76   LVYSDNVDLQRSASLTFAEI----TERDVREVDRDTLEPILFLLQSSDIEVQRAASAALG  131

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            N+A + +  + L++  G + PL+  +  P++         N    ++NL  +++    I 
Sbjct  132  NLAVN-ADNKVLIVALGGLAPLIRQMMSPNVE-----VQCNAVGCITNLATHEDNKAKIA  185

Query  248  AVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
                 L  L+RL    D  V  +   A+  +T   ++    +V  G +P LV+LL +S++
Sbjct  186  R-SGALGPLIRLAKSKDMRVQRNATGALLNMT-HSDDNRQQLVNAGAIPVLVQLLSSSDV  243

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAG-ALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
             +      A+ NI      + ++       +     L+ +    +Q +A   + N+ +  
Sbjct  244  DVQYYCTTALSNIAVDASNRKRLAQTESRLVQSLVHLMDSSTPKVQCQAALALRNLASDE  303

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
            + Q++ +V    +P L+ +L  +       AV  + N +     E    ++  G ++PL+
Sbjct  304  KYQLE-IVRAKGLPPLLRLLQSSYLPLILSAVACIRNISIHPLNESP--IIDAGFLKPLV  360

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            +LL + D + I     AIS +   A     +++   ++ + G + K + L
Sbjct  361  DLLGSTDNEEIQ--CHAISTLRNLA---ASSDRNKELVLQAGAVQKCKDL  405


 Score =  203 bits (516),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 75/346 (22%), Positives = 146/346 (42%), Gaps = 23/346 (7%)

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
            G  + A  +L+ S +  +   A      I       R+  +    ++P+L LL   D+  
Sbjct  67   GEPLSALSTLVYSDNVDLQRSASLTFAEIT--ERDVRE--VDRDTLEPILFLLQSSDIE-  121

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD  280
                  R  +  L NL  N +    I A+   L  L+R +   + EV  +    I+ L  
Sbjct  122  ----VQRAASAALGNLAVNADNKVLIVAL-GGLAPLIRQMMSPNVEVQCNAVGCITNLAT  176

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               +    + ++G +  L++L  + ++ +   A  A+ N+    D + Q+V +AGA+ V 
Sbjct  177  H-EDNKAKIARSGALGPLIRLAKSKDMRVQRNATGALLNMTHSDDNRQQLV-NAGAIPVL  234

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAVW  399
              LL++   ++Q   T  +SNI     ++ +       LV  LV ++  +  K Q +A  
Sbjct  235  VQLLSSSDVDVQYYCTTALSNIAVDASNRKRLAQTESRLVQSLVHLMDSSTPKVQCQAAL  294

Query  400  AVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK  459
            A+ N  S    +  + +V    + PL+ LL +    +IL  +  I NI  +   L E+  
Sbjct  295  ALRNLASDEKYQ--LEIVRAKGLPPLLRLLQSSYLPLILSAVACIRNI--SIHPLNESP-  349

Query  460  LSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEEDQ  504
                I + G L  + + L + +NE +   ++S +    +  +   +
Sbjct  350  ----IIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKE  391


 Score =  190 bits (484),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 91/438 (21%), Positives = 175/438 (40%), Gaps = 56/438 (13%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREK  108
            ++    +A S L     N+   ++   + +  +     S NV+ Q  A+    ++  R+ 
Sbjct  41   LADNEREAVSDLLGYLENRAETDFFRGEPLSALSTLVYSDNVDLQRSASLTFAEITERD-  99

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
               +  + R  L P    FL ++    +Q  ++ AL N+A   ++    +V  G +   I
Sbjct  100  ---VREVDRDTLEPIL--FLLQSSDIEVQRAASAALGNLAV-NADNKVLIVALGGLAPLI  153

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM--SSLACGYL  226
              + SP+  +   AV  + N+A      +  + + GA+ PL+ L    DM     A G L
Sbjct  154  RQMMSPNVEVQCNAVGCITNLATH-EDNKAKIARSGALGPLIRLAKSKDMRVQRNATGAL  212

Query  227  RN----------------------------------LTWTLSNLCRNKNPAPPIDAVE-Q  251
             N                                   T  LSN+  + +    +   E +
Sbjct  213  LNMTHSDDNRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRKRLAQTESR  272

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM-VVKTGVVPQLVKLLGASELPIV  310
            ++ +LV L+    P+V      A+  L    +E+  + +V+   +P L++LL +S LP++
Sbjct  273  LVQSLVHLMDSSTPKVQCQAALALRNLA--SDEKYQLEIVRAKGLPPLLRLLQSSYLPLI  330

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGRQDQ  369
              A+  I NI      ++  +IDAG L     LL +     IQ  A  T+ N+ A     
Sbjct  331  LSAVACIRNISIHPLNESP-IIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRN  389

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
             + V+  G V     ++ K     Q E   A+        ++   +L++ G+ + L+ L 
Sbjct  390  KELVLQAGAVQKCKDLVLKVPLSVQSEMTAAIAVLALSDELKP--HLLNLGVFDVLIPLT  447

Query  430  TAKDTKIILVILDAISNI  447
             ++  ++      A+ N+
Sbjct  448  ESESIEVQGNSAAALGNL  465


> sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa 
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 
987) OX=367110 GN=vac8 PE=3 SV=4
Length=559

 Score =  287 bits (734),  Expect = 1e-87, Method: Composition-based stats.
 Identities = 88/409 (22%), Positives = 160/409 (39%), Gaps = 38/409 (9%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +++ + S NVE Q  A      L + E       I R+G +      L ++    +Q
Sbjct  130  LAPLIRQMMSPNVEVQCNAVGCITNLATHEDNKA--KIARSGALGPLTR-LAKSRDMRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GAIP  + LL+S    +      AL NIA D +  R
Sbjct  187  RNATGALLNM-THSDENRQQLVNAGAIPVLVQLLSSTDVDVQYYCTTALSNIAVDANNRR  245

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +          L NL  ++     I      L  L+
Sbjct  246  KL----AQTEPRLVQSLVNLMDSSSPKVQCQAALALRNLASDEKYQLEIVRASG-LGPLL  300

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            RLL      ++      I  ++  P      +++ G +  LV LLG+++   I   A+  
Sbjct  301  RLLQSSYLPLILSAVACIRNISIHP-MNESPIIEAGFLKPLVDLLGSTDNEEIQCHAIST  359

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +D    +V++AGA+     L+      +Q E T  ++ +     +    ++  
Sbjct  360  LRNLAASSDRNKALVLEAGAVQKCKQLVLEVPVTVQSEMTAAIAVLAL-SDELKTNLLEL  418

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYT----------------SGGTVEQIVYLVHCG  420
            G+   L+ +      + Q  +  A+ N +                S G    +   +  G
Sbjct  419  GVFEVLIPLTKSPSIEVQGNSAAALGNLSSKVGDYSVFIHNWNEPSDGIHGYLSRFLASG  478

Query  421  -------IIEPLMNLLTAKDTKIILVI---LDAISNIFQAAEKLGETEK  459
                    I  L+ LL ++D K+I +I    D +  I Q A +  E++ 
Sbjct  479  DATFQHIAIWTLLQLLESEDKKLIGLIGKSNDIVDMIRQIANRQIESDN  527


 Score =  206 bits (523),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 71/355 (20%), Positives = 151/355 (43%), Gaps = 21/355 (6%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + +S L  ++   +Q  ++     I    +E+    VD   +   + LL +    +   A
Sbjct  52   RALSTLVYSENIDLQRSASLTFAEI----TERDVRAVDRDTLEPILFLLQNSDIEVQRAA  107

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + L+++ G + PL+  +  P++         N    ++NL  +++ 
Sbjct  108  SAALGNLAVNT-DNKVLIVQLGGLAPLIRQMMSPNVE-----VQCNAVGCITNLATHEDN  161

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I      L  L RL    D  V  +   A+  +T   +E    +V  G +P LV+LL
Sbjct  162  KAKIAR-SGALGPLTRLAKSRDMRVQRNATGALLNMT-HSDENRQQLVNAGAIPVLVQLL  219

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAG-ALAVFPSLLTNPKTNIQKEATWTMSN  361
             ++++ +      A+ NI    + + ++       +    +L+ +    +Q +A   + N
Sbjct  220  SSTDVDVQYYCTTALSNIAVDANNRRKLAQTEPRLVQSLVNLMDSSSPKVQCQAALALRN  279

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +  + Q++ V   G +  L+ +L  +       AV  + N +     E    ++  G 
Sbjct  280  LASDEKYQLEIVRASG-LGPLLRLLQSSYLPLILSAVACIRNISIHPMNESP--IIEAGF  336

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            ++PL++LL + D + I     AIS +   A     +++   ++ E G + K + L
Sbjct  337  LKPLVDLLGSTDNEEIQ--CHAISTLRNLA---ASSDRNKALVLEAGAVQKCKQL  386


 Score =  197 bits (502),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 73/346 (21%), Positives = 140/346 (40%), Gaps = 23/346 (7%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
             G  + A  +L+ S +  +   A      I           +    ++P+L LL   D+ 
Sbjct  47   SGEPLRALSTLVYSENIDLQRSASLTFAEIT----ERDVRAVDRDTLEPILFLLQNSDIE  102

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                   R  +  L NL  N +    I  +   L  L+R +   + EV  +    I+ L 
Sbjct  103  -----VQRAASAALGNLAVNTDNKVLIVQL-GGLAPLIRQMMSPNVEVQCNAVGCITNLA  156

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                +    + ++G +  L +L  + ++ +   A  A+ N+ T +DE  Q +++AGA+ V
Sbjct  157  TH-EDNKAKIARSGALGPLTRLAKSRDMRVQRNATGALLNM-THSDENRQQLVNAGAIPV  214

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAV  398
               LL++   ++Q   T  +SNI     ++ +       LV  LV+++  +  K Q +A 
Sbjct  215  LVQLLSSTDVDVQYYCTTALSNIAVDANNRRKLAQTEPRLVQSLVNLMDSSSPKVQCQAA  274

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+ N  S    +  + +V    + PL+ LL +    +IL  +  I NI           
Sbjct  275  LALRNLASDEKYQ--LEIVRASGLGPLLRLLQSSYLPLILSAVACIRNISIHPMNESP--  330

Query  459  KLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEED  503
                 I E G L  + + L + +NE +   ++S +    +  +   
Sbjct  331  -----IIEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNK  371


 Score =  109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 61/316 (19%), Positives = 123/316 (39%), Gaps = 14/316 (4%)

Query  65   QENRNNQGTVN-WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              + N Q  VN  ++  +V+ ++S++V+ Q   T A   +                L+  
Sbjct  198  HSDENRQQLVNAGAIPVLVQLLSSTDVDVQYYCTTALSNIAVDANNRRKLAQTEPRLVQS  257

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
             V+ +  +    +Q ++A AL N+AS    Q + V   G  P    LL S +  +   AV
Sbjct  258  LVNLM-DSSSPKVQCQAALALRNLASDEKYQLEIVRASGLGPLL-RLLQSSYLPLILSAV  315

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
              + NI+    +    +I+ G + PL+ LL   D   + C        TL NL  + +  
Sbjct  316  ACIRNISIH-PMNESPIIEAGFLKPLVDLLGSTDNEEIQCH----AISTLRNLAASSDRN  370

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
              +      +    +L+      V ++   AI+ L    +E    +++ GV   L+ L  
Sbjct  371  KALVLEAGAVQKCKQLVLEVPVTVQSEMTAAIAVLA-LSDELKTNLLELGVFEVLIPLTK  429

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVID-----AGALAVFPSLLTNPKTNIQKEATWT  358
            +  + +   +  A+GN+ +   + +  + +      G        L +     Q  A WT
Sbjct  430  SPSIEVQGNSAAALGNLSSKVGDYSVFIHNWNEPSDGIHGYLSRFLASGDATFQHIAIWT  489

Query  359  MSNITAGRQDQIQQVV  374
            +  +      ++  ++
Sbjct  490  LLQLLESEDKKLIGLI  505


> sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica 
(strain CLIB 122 / E 150) OX=284591 GN=VAC8 PE=3 SV=1
Length=573

 Score =  277 bits (709),  Expect = 8e-84, Method: Composition-based stats.
 Identities = 85/410 (21%), Positives = 164/410 (40%), Gaps = 21/410 (5%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
            + +++ + S NVE Q  A      L + E       I R+G +    + L ++    +Q 
Sbjct  152  EPLIRQMMSPNVEVQCNAVGCITNLATHEANK--SKIARSGALLPL-TKLAKSKDMRVQR  208

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD  198
             +  AL N+ + + +  + +V+ GAIP  +SLL+S    +   +  AL NIA D S  + 
Sbjct  209  NATGALLNM-THSDQNRQELVNAGAIPILVSLLSSRDPDVQYYSTTALSNIAVDESNRKK  267

Query  199  LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR  258
            L     + +P L    +  M S +          L NL  + +    I      LP L  
Sbjct  268  LS----SSEPRLVEHLIKLMDSGSPRVQCQAALALRNLASDSDYQLEIVKANG-LPHLFN  322

Query  259  LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRAI  317
            L       ++      I  ++  P      +++ G +  LV+LLG +    I    +  +
Sbjct  323  LFQSTHTPLVLAAVACIRNISIHPLNET-PIIEAGFLKTLVELLGASDNEEIQCHTISTL  381

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHG  377
             N+   ++     +++AGA+     L+ +    +Q E T  ++ +  G  +    ++  G
Sbjct  382  RNLAASSERNKLEIVEAGAVQKCKELVLDAPRLVQSEMTACLAVLALGD-ELKGTLLELG  440

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYTSG-GTVEQIVYL---VHCGIIEPLMNLLTAKD  433
            +   L+ +    + + Q  +  A+ N +S  G  +  V        GI E L+  LT+ D
Sbjct  441  IAEVLIPLTLSDNIEVQGNSAAALGNLSSKVGNYDTFVNHWNEPSGGIREFLIRFLTSGD  500

Query  434  TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENES  483
            +    + +     + Q  E   +  K  ++      +D I  L +  N  
Sbjct  501  STFGHIAV---WTVLQLLESKDQRLK-DLLKNSNEIVDAIHQL-SSMNSD  545


 Score =  207 bits (527),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 79/350 (23%), Positives = 143/350 (41%), Gaps = 27/350 (8%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDG--SVFRDLVIKYGAVDPLLALLAVPDMS  219
            G + A  +L+ S +  +   A  A   I       V RD       ++P+L LL   D  
Sbjct  70   GPLRALSTLVYSDNIDLQRSAALAFAEITEKDIRPVNRDC------LEPVLLLLQNTD--  121

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                   R  +  L NL  N N    +         L+R +   + EV  +    I+ L 
Sbjct  122  ---PDIQRAASAALGNLAVN-NENKVLIVEMGGFEPLIRQMMSPNVEVQCNAVGCITNLA  177

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                     + ++G +  L KL  + ++ +   A  A+ N+ T +D+  Q +++AGA+ +
Sbjct  178  TH-EANKSKIARSGALLPLTKLAKSKDMRVQRNATGALLNM-THSDQNRQELVNAGAIPI  235

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVLSKADFKTQKEAV  398
              SLL++   ++Q  +T  +SNI     ++ +       LV  L+ ++     + Q +A 
Sbjct  236  LVSLLSSRDPDVQYYSTTALSNIAVDESNRKKLSSSEPRLVEHLIKLMDSGSPRVQCQAA  295

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+ N  S    +  + +V    +  L NL  +  T ++L  +  I NI  +   L ET 
Sbjct  296  LALRNLASDSDYQ--LEIVKANGLPHLFNLFQSTHTPLVLAAVACIRNI--SIHPLNETP  351

Query  459  KLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEEDQNVV  507
                 I E G L  + E L   +NE +   ++S +    +  E     +V
Sbjct  352  -----IIEAGFLKTLVELLGASDNEEIQCHTISTLRNLAASSERNKLEIV  396


 Score =  186 bits (473),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 89/435 (20%), Positives = 167/435 (38%), Gaps = 62/435 (14%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREKQPPIDN  114
            +A + L     N+G V++  +  ++ +     S N++ Q  A  A  ++  ++ +P    
Sbjct  49   EAVALLLRYLENRGEVDFFSNGPLRALSTLVYSDNIDLQRSAALAFAEITEKDIRP----  104

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            + R  L P  +  L  TD   IQ  ++ AL N+A    E    +V+ G     I  + SP
Sbjct  105  VNRDCLEPVLL-LLQNTD-PDIQRAASAALGNLAVNN-ENKVLIVEMGGFEPLIRQMMSP  161

Query  175  HAHISEQAVWALGNIAGDGSV---------------------------------------  195
            +  +   AV  + N+A   +                                        
Sbjct  162  NVEVQCNAVGCITNLATHEANKSKIARSGALLPLTKLAKSKDMRVQRNATGALLNMTHSD  221

Query  196  -FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ-IL  253
              R  ++  GA+  L++LL+  D            T  LSN+  +++    + + E  ++
Sbjct  222  QNRQELVNAGAIPILVSLLSSRD-----PDVQYYSTTALSNIAVDESNRKKLSSSEPRLV  276

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              L++L+    P V      A+  L    + ++  +VK   +P L  L  ++  P+V  A
Sbjct  277  EHLIKLMDSGSPRVQCQAALALRNLASDSDYQLE-IVKANGLPHLFNLFQSTHTPLVLAA  335

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            +  I NI      +T  +I+AG L     LL  +    IQ     T+ N+ A  +    +
Sbjct  336  VACIRNISIHPLNETP-IIEAGFLKTLVELLGASDNEEIQCHTISTLRNLAASSERNKLE  394

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            +V  G V     ++  A    Q E    +     G  ++    L+  GI E L+ L  + 
Sbjct  395  IVEAGAVQKCKELVLDAPRLVQSEMTACLAVLALGDELKG--TLLELGIAEVLIPLTLSD  452

Query  433  DTKIILVILDAISNI  447
            + ++      A+ N+
Sbjct  453  NIEVQGNSAAALGNL  467


> sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans 
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) 
OX=214684 GN=VAC8 PE=3 SV=1
Length=630

 Score =  277 bits (709),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 78/390 (20%), Positives = 155/390 (40%), Gaps = 18/390 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S NVE Q  A      L + ++      I ++G +      L ++    +Q
Sbjct  129  LEPLIRQMLSPNVEVQCNAVGCITNLATHDENK--TQIAKSGALVPLTR-LAKSKDMRVQ  185

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V  GAIP  +SLL SP   +      AL NIA D +  +
Sbjct  186  RNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDAANRK  244

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +          L NL  +      I      L  L+
Sbjct  245  KLAQS----EPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIVKF-GGLKPLL  299

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRA  316
            RLLH     ++      +  ++  P      ++++G +  L++LL       +   A+  
Sbjct  300  RLLHSSYLPLILSAAACVRNVSIHP-ANESPIIESGFLQPLIELLSFDENEEVQCHAIST  358

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++    +++AGA+    SL+      +Q E T  ++ +     D   Q++  
Sbjct  359  LRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLAL-SDDLKPQLLEM  417

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV-----HCGIIEPLMNLLTA  431
            G+   L+ + +    + Q  +  A+ N +S    +   +         G+   L+  L++
Sbjct  418  GICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAVWNKPDGGLHAYLVRFLSS  477

Query  432  KDTKIILVILDAISNIFQAAEKLGETEKLS  461
             D     + +  I  +   AE    T  + 
Sbjct  478  ADITFQHIAVWTIVQLL-EAEDEQLTNNIR  506


 Score =  205 bits (521),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 91/390 (23%), Positives = 153/390 (39%), Gaps = 38/390 (10%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ  181
            P  +          +Q+    + TN  +G+            + A  +L  S +  +   
Sbjct  19   PLLLETEREAVADLLQYLENRSTTNFFAGSP-----------LAALTTLSFSENVDLQRS  67

Query  182  AVWALGNIAGDG--SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            A  A   I       V RD       +DP+L LL+  D         R  +  L NL  N
Sbjct  68   AALAFAEITEKEVREVGRDT------LDPVLYLLSSHD-----PEVQRAASAALGNLAVN  116

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
                  +      L  L+R +   + EV  +    I+ L    +E    + K+G +  L 
Sbjct  117  A-ENKLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATH-DENKTQIAKSGALVPLT  174

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +L  + ++ +   A  A+ N+ T +DE  Q ++ AGA+ V  SLL +P T++Q   T  +
Sbjct  175  RLAKSKDMRVQRNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTAL  233

Query  360  SNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
            SNI     ++ +       LV  LV ++     K Q +A  A+ N  S    +  + +V 
Sbjct  234  SNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQ--LEIVK  291

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK-IEALQ  477
             G ++PL+ LL +    +IL     + N+                I E G L   IE L 
Sbjct  292  FGGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESP-------IIESGFLQPLIELLS  344

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVV  507
              ENE V   ++S +    +  E+    +V
Sbjct  345  FDENEEVQCHAISTLRNLAASSEKNKGAIV  374


 Score =  192 bits (489),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 98/471 (21%), Positives = 175/471 (37%), Gaps = 73/471 (15%)

Query  39   RKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQL  94
            RK   +  +L+         +A + L +   N+ T N+     +  +     S NV+ Q 
Sbjct  13   RKNAYEPLLLETER------EAVADLLQYLENRSTTNFFAGSPLAALTTLSFSENVDLQR  66

Query  95   QATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ  154
             A  A  ++  +E    +  + R  L P    +L  +    +Q  ++ AL N+A   +E 
Sbjct  67   SAALAFAEITEKE----VREVGRDTLDPVL--YLLSSHDPEVQRAASAALGNLAV-NAEN  119

Query  155  TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA  214
               VV  G +   I  + SP+  +   AV  + N+A      +  + K GA+ PL  L  
Sbjct  120  KLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDEN-KTQIAKSGALVPLTRLAK  178

Query  215  VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA  274
              DM        RN T  L N+  + +           +P LV LL+  D +V      A
Sbjct  179  SKDM-----RVQRNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTA  232

Query  275  ISYLT-DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV---  330
            +S +  D  N +     +  +V  LV+L+ +  L +   A  A+ N+ + +  Q ++   
Sbjct  233  LSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIVKF  292

Query  331  -------------------------------------VIDAGALAVFPSLLT-NPKTNIQ  352
                                                 +I++G L     LL+ +    +Q
Sbjct  293  GGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESPIIESGFLQPLIELLSFDENEEVQ  352

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTV  410
              A  T+ N+ A  +     +V  G V  + S++       Q E  A  AV   +     
Sbjct  353  CHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKP  412

Query  411  EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI-FQAAEKLGETEKL  460
            +    L+  GI E L+ L  +   ++      A+ N+  +AAE       +
Sbjct  413  Q----LLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAV  459


 Score = 82.7 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 112/305 (37%), Gaps = 53/305 (17%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWS----VDDIVKGINSSNVENQLQATQAARKLLSREK  108
            V  +   A S +  +  N+  +  S    V  +V+ ++S +++ Q QA  A R L S  K
Sbjct  225  VQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSK  284

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
                  I++ G +   +  L  +   P+   +A  + N++   + ++  +++ G +   I
Sbjct  285  YQL--EIVKFGGLKPLLRLL-HSSYLPLILSAAACVRNVSIHPANES-PIIESGFLQPLI  340

Query  169  SLLA-SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV------------  215
             LL+   +  +   A+  L N+A      +  +++ GAV+ + +L+              
Sbjct  341  ELLSFDENEEVQCHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTAC  400

Query  216  ------------------------PDMSSLACGYLRNLTWTLSNLC-RNKNPAPPIDAV-  249
                                    P  +S +     N    L NL  +      P +AV 
Sbjct  401  VAVLALSDDLKPQLLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAVW  460

Query  250  ----EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG--VVPQLVKLLG  303
                  +   LVR L   D        W I  L +  +E++   +++   ++  + +L  
Sbjct  461  NKPDGGLHAYLVRFLSSADITFQHIAVWTIVQLLEAEDEQLTNNIRSSPILISSIRQLAK  520

Query  304  ASELP  308
            +    
Sbjct  521  SPPPS  525


> sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans 
var. neoformans serotype D (strain B-3501A) OX=283643 
GN=VAC8 PE=3 SV=1
Length=630

 Score =  277 bits (709),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 78/390 (20%), Positives = 155/390 (40%), Gaps = 18/390 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S NVE Q  A      L + ++      I ++G +      L ++    +Q
Sbjct  129  LEPLIRQMLSPNVEVQCNAVGCITNLATHDENK--TQIAKSGALVPLTR-LAKSKDMRVQ  185

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V  GAIP  +SLL SP   +      AL NIA D +  +
Sbjct  186  RNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDAANRK  244

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +          L NL  +      I      L  L+
Sbjct  245  KLAQS----EPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIVKF-GGLKPLL  299

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRA  316
            RLLH     ++      +  ++  P      ++++G +  L++LL       +   A+  
Sbjct  300  RLLHSSYLPLILSAAACVRNVSIHP-ANESPIIESGFLQPLIELLSFDENEEVQCHAIST  358

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++    +++AGA+    SL+      +Q E T  ++ +     D   Q++  
Sbjct  359  LRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLAL-SDDLKPQLLEM  417

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV-----HCGIIEPLMNLLTA  431
            G+   L+ + +    + Q  +  A+ N +S    +   +         G+   L+  L++
Sbjct  418  GICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAVWNKPDGGLHAYLVRFLSS  477

Query  432  KDTKIILVILDAISNIFQAAEKLGETEKLS  461
             D     + +  I  +   AE    T  + 
Sbjct  478  ADITFQHIAVWTIVQLL-EAEDEQLTNNIR  506


 Score =  205 bits (521),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 91/390 (23%), Positives = 153/390 (39%), Gaps = 38/390 (10%)

Query  122  PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ  181
            P  +          +Q+    + TN  +G+            + A  +L  S +  +   
Sbjct  19   PLLLETEREAVADLLQYLENRSTTNFFAGSP-----------LAALTTLSFSENVDLQRS  67

Query  182  AVWALGNIAGDG--SVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            A  A   I       V RD       +DP+L LL+  D         R  +  L NL  N
Sbjct  68   AALAFAEITEKEVREVGRDT------LDPVLYLLSSHD-----PEVQRAASAALGNLAVN  116

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
                  +      L  L+R +   + EV  +    I+ L    +E    + K+G +  L 
Sbjct  117  A-ENKLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATH-DENKTQIAKSGALVPLT  174

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            +L  + ++ +   A  A+ N+ T +DE  Q ++ AGA+ V  SLL +P T++Q   T  +
Sbjct  175  RLAKSKDMRVQRNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTAL  233

Query  360  SNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
            SNI     ++ +       LV  LV ++     K Q +A  A+ N  S    +  + +V 
Sbjct  234  SNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQ--LEIVK  291

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK-IEALQ  477
             G ++PL+ LL +    +IL     + N+                I E G L   IE L 
Sbjct  292  FGGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESP-------IIESGFLQPLIELLS  344

Query  478  NHENESVYKASLSLIEKYFSVEEEEDQNVV  507
              ENE V   ++S +    +  E+    +V
Sbjct  345  FDENEEVQCHAISTLRNLAASSEKNKGAIV  374


 Score =  192 bits (489),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 98/471 (21%), Positives = 175/471 (37%), Gaps = 73/471 (15%)

Query  39   RKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQL  94
            RK   +  +L+         +A + L +   N+ T N+     +  +     S NV+ Q 
Sbjct  13   RKNAYEPLLLETER------EAVADLLQYLENRSTTNFFAGSPLAALTTLSFSENVDLQR  66

Query  95   QATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ  154
             A  A  ++  +E    +  + R  L P    +L  +    +Q  ++ AL N+A   +E 
Sbjct  67   SAALAFAEITEKE----VREVGRDTLDPVL--YLLSSHDPEVQRAASAALGNLAV-NAEN  119

Query  155  TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA  214
               VV  G +   I  + SP+  +   AV  + N+A      +  + K GA+ PL  L  
Sbjct  120  KLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDEN-KTQIAKSGALVPLTRLAK  178

Query  215  VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA  274
              DM        RN T  L N+  + +           +P LV LL+  D +V      A
Sbjct  179  SKDM-----RVQRNATGALLNM-THSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTA  232

Query  275  ISYLT-DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV---  330
            +S +  D  N +     +  +V  LV+L+ +  L +   A  A+ N+ + +  Q ++   
Sbjct  233  LSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIVKF  292

Query  331  -------------------------------------VIDAGALAVFPSLLT-NPKTNIQ  352
                                                 +I++G L     LL+ +    +Q
Sbjct  293  GGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESPIIESGFLQPLIELLSFDENEEVQ  352

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTV  410
              A  T+ N+ A  +     +V  G V  + S++       Q E  A  AV   +     
Sbjct  353  CHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKP  412

Query  411  EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI-FQAAEKLGETEKL  460
            +    L+  GI E L+ L  +   ++      A+ N+  +AAE       +
Sbjct  413  Q----LLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAV  459


 Score = 82.7 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 112/305 (37%), Gaps = 53/305 (17%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWS----VDDIVKGINSSNVENQLQATQAARKLLSREK  108
            V  +   A S +  +  N+  +  S    V  +V+ ++S +++ Q QA  A R L S  K
Sbjct  225  VQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSK  284

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
                  I++ G +   +  L  +   P+   +A  + N++   + ++  +++ G +   I
Sbjct  285  YQL--EIVKFGGLKPLLRLL-HSSYLPLILSAAACVRNVSIHPANES-PIIESGFLQPLI  340

Query  169  SLLA-SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV------------  215
             LL+   +  +   A+  L N+A      +  +++ GAV+ + +L+              
Sbjct  341  ELLSFDENEEVQCHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTAC  400

Query  216  ------------------------PDMSSLACGYLRNLTWTLSNLC-RNKNPAPPIDAV-  249
                                    P  +S +     N    L NL  +      P +AV 
Sbjct  401  VAVLALSDDLKPQLLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAVW  460

Query  250  ----EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG--VVPQLVKLLG  303
                  +   LVR L   D        W I  L +  +E++   +++   ++  + +L  
Sbjct  461  NKPDGGLHAYLVRFLSSADITFQHIAVWTIVQLLEAEDEQLTNNIRSSPILISSIRQLAK  520

Query  304  ASELP  308
            +    
Sbjct  521  SPPPS  525


> sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum 
(strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 
1970) OX=306901 GN=VAC8 PE=3 SV=3
Length=560

 Score =  266 bits (679),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 86/417 (21%), Positives = 166/417 (40%), Gaps = 23/417 (6%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  ++K + S NVE Q  A      L + E+      I R+G +      L ++    +Q
Sbjct  130  LQPLIKQMMSPNVEVQCNAVGCITNLATHEENKA--KIARSGALGPLTR-LAKSKDMRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GAIP  + LL+S    +      AL NIA D +  R
Sbjct  187  RNATGALLNM-THSDENRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRR  245

Query  198  DLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
             L   +   V  L+ L       S +          L NL  ++     I     + P L
Sbjct  246  KLAETEQRLVQYLVNL-----TESSSPKVQCQAALALRNLASDEKYQLEIVQAHGLGPLL  300

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALR  315
              L     P +L      I  ++  P      +++ G +  LV LLG+++   I   A+ 
Sbjct  301  RLLRSSYLPLIL-SAVACIRNISIHPQNE-SPIIEAGFLKPLVDLLGSTDNEEIQCHAIS  358

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
             + N+   +D    +V++AGA+     L+      +Q E T  ++ +     +    ++ 
Sbjct  359  TLRNLAASSDRNKSLVLEAGAVQKCKQLVLEVPVTVQSEMTAAIAVLAL-SDELKTHLLE  417

Query  376  HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG-GTVEQIVY---LVHCGIIEPLMNLLTA  431
             G+   L+ +      + Q  +  A+ N +S  G     V        GI   L   L +
Sbjct  418  LGVFDVLIPLTMSPSVEVQGNSAAALGNLSSKVGDYSIFVQNWMEPRDGIHGYLNRFLAS  477

Query  432  KDTKIILVILDAISNIFQAAEK-----LGETEKLSIMIEECGGLDKIEALQNHENES  483
             D     + +  +  + ++ +K     +G+++ +  MI++      +E+    E++ 
Sbjct  478  GDATFQHIAIWTLLQLLESEDKKLIGLIGKSDGVVDMIKQIANRQMMESDNEAEDDD  534


 Score =  181 bits (459),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/435 (19%), Positives = 158/435 (36%), Gaps = 62/435 (14%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREKQPPIDN  114
            +A + L +   N+   ++   + ++ +     S N++ Q  A+    ++  R+    +  
Sbjct  28   EAVADLLQYLENRAETDFFSGEPLRALSTLVYSDNIDLQRSASLTFAEITERD----VRA  83

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            + R  L P    FL       +Q  ++ AL N+A   ++    +V  G +   I  + SP
Sbjct  84   VDRDTLGPIL--FLLENSDIEVQRAASAALGNLAV-NTDNKVLIVQLGGLQPLIKQMMSP  140

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
            +  +   AV  + N+A      +  + + GA+ PL  L    DM        RN T  L 
Sbjct  141  NVEVQCNAVGCITNLATHEEN-KAKIARSGALGPLTRLAKSKDM-----RVQRNATGALL  194

Query  235  NLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT-DGPNERIGMVVKTG  293
            N+  + +           +P LV+LL   D +V      A+S +  D  N R     +  
Sbjct  195  NM-THSDENRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLAETEQR  253

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV-----------------------  330
            +V  LV L  +S   +   A  A+ N+ +    Q ++                       
Sbjct  254  LVQYLVNLTESSSPKVQCQAALALRNLASDEKYQLEIVQAHGLGPLLRLLRSSYLPLILS  313

Query  331  -----------------VIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGRQDQIQQ  372
                             +I+AG L     LL +     IQ  A  T+ N+ A        
Sbjct  314  AVACIRNISIHPQNESPIIEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKSL  373

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            V+  G V     ++ +     Q E   A+        ++   +L+  G+ + L+ L  + 
Sbjct  374  VLEAGAVQKCKQLVLEVPVTVQSEMTAAIAVLALSDELK--THLLELGVFDVLIPLTMSP  431

Query  433  DTKIILVILDAISNI  447
              ++      A+ N+
Sbjct  432  SVEVQGNSAAALGNL  446


 Score =  176 bits (447),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 73/346 (21%), Positives = 140/346 (40%), Gaps = 23/346 (7%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
             G  + A  +L+ S +  +   A      I           +    + P+L LL   D+ 
Sbjct  47   SGEPLRALSTLVYSDNIDLQRSASLTFAEIT----ERDVRAVDRDTLGPILFLLENSDIE  102

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                   R  +  L NL  N +    I  +   L  L++ +   + EV  +    I+ L 
Sbjct  103  -----VQRAASAALGNLAVNTDNKVLIVQL-GGLQPLIKQMMSPNVEVQCNAVGCITNLA  156

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                E    + ++G +  L +L  + ++ +   A  A+ N+ T +DE  Q +++AGA+ V
Sbjct  157  TH-EENKAKIARSGALGPLTRLAKSKDMRVQRNATGALLNM-THSDENRQQLVNAGAIPV  214

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAV  398
               LL++   ++Q   T  +SNI     ++ +       LV +LV++   +  K Q +A 
Sbjct  215  LVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLAETEQRLVQYLVNLTESSSPKVQCQAA  274

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+ N  S    +  + +V    + PL+ LL +    +IL  +  I NI    +      
Sbjct  275  LALRNLASDEKYQ--LEIVQAHGLGPLLRLLRSSYLPLILSAVACIRNISIHPQNESP--  330

Query  459  KLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEED  503
                 I E G L  + + L + +NE +   ++S +    +  +   
Sbjct  331  -----IIEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNK  371


> sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis 
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL 
Y-1140 / WM37) OX=284590 GN=VAC8 PE=3 SV=3
Length=579

 Score =  264 bits (675),  Expect = 7e-79, Method: Composition-based stats.
 Identities = 91/386 (24%), Positives = 156/386 (40%), Gaps = 21/386 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S NVE Q  A      L +++       I ++G +    + L R+    +Q
Sbjct  130  LEPLIEQMKSDNVEVQCNAVGCITNLATQDDNKI--EIAQSGALVPL-TKLARSSNIRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  K +VD GA+P  +SLL+S  A +      AL NIA D S  R
Sbjct  187  RNATGALLNM-THSGENRKELVDAGAVPVLVSLLSSMDADVQYYCTTALSNIAVDESNRR  245

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L        P L    V  M+S +       T  L NL  + N    I      LP LV
Sbjct  246  YLSKHA----PKLVTKLVSLMNSTSPRVKCQATLALRNLASDTNYQLEIVR-AGGLPDLV  300

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            +L+  D   ++  +   I  ++  P    G++V  G +P LVKLL   E   I   A+  
Sbjct  301  QLIQSDSLPLVLASVACIRNISIHP-LNEGLIVDAGFLPPLVKLLDYQESEEIQCHAVST  359

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++       +G +  F  L      ++Q E +   + I A   +    ++  
Sbjct  360  LRNLAASSEKNRAEFFQSGVIEKFKQLALTCPISVQSEISACFA-ILALSDNTKYDLLQQ  418

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC-----GIIEPLMNLLTA  431
             ++  L+ +    D +    +  AV N  S   V  +  ++         I+  +    +
Sbjct  419  DVLKVLIPMTMSQDQEISGNSAAAVANLIS--RVSNLEKILEYWGQPNDGIKGFLIRFLS  476

Query  432  KDTKIILVILDAISNIFQAAEKLGET  457
             D      I  A+  I Q  E   ET
Sbjct  477  SDFPTYEHI--ALWTILQLFECHNET  500


 Score =  190 bits (484),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 80/374 (21%), Positives = 150/374 (40%), Gaps = 33/374 (9%)

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD--GSV  195
             E+  +L        +       G  + A  +L+ S + ++   A  A   I       V
Sbjct  27   REAVTSLLEFLENKDQYD--FYSGKPLRALTTLVYSDNLNLQRSAALAFAEITEKYVSPV  84

Query  196  FRDLVIKYGAVDPLLALLAVPDMSS--LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
             RD       ++P+L LL  PD      +C  L NL     N          +      L
Sbjct  85   SRD------VLEPILMLLTNPDPQIRIASCAALGNLAVNNEN--------KLLIVEMGGL  130

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              L+  +  D+ EV  +    I+ L    + +I  + ++G +  L KL  +S + +   A
Sbjct  131  EPLIEQMKSDNVEVQCNAVGCITNLATQDDNKIE-IAQSGALVPLTKLARSSNIRVQRNA  189

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI-QQ  372
              A+ N+ T + E  + ++DAGA+ V  SLL++   ++Q   T  +SNI     ++    
Sbjct  190  TGALLNM-THSGENRKELVDAGAVPVLVSLLSSMDADVQYYCTTALSNIAVDESNRRYLS  248

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
                 LV  LVS+++    + + +A  A+ N  S    +  + +V  G +  L+ L+ + 
Sbjct  249  KHAPKLVTKLVSLMNSTSPRVKCQATLALRNLASDTNYQ--LEIVRAGGLPDLVQLIQSD  306

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EALQNHENESVYKASLSL  491
               ++L  +  I NI       G       +I + G L  + + L   E+E +   ++S 
Sbjct  307  SLPLVLASVACIRNISIHPLNEG-------LIVDAGFLPPLVKLLDYQESEEIQCHAVST  359

Query  492  IEKYFSVEEEEDQN  505
            +    +  E+    
Sbjct  360  LRNLAASSEKNRAE  373


 Score =  183 bits (464),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 88/453 (19%), Positives = 167/453 (37%), Gaps = 68/453 (15%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREK  108
            ++    +A + L E   N+   ++     ++ +     S N+  Q  A  A  ++  +  
Sbjct  22   IAENEREAVTSLLEFLENKDQYDFYSGKPLRALTTLVYSDNLNLQRSAALAFAEITEKYV  81

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
             P   +++        +  L   D   I+  S  AL N+A    E    +V+ G +   I
Sbjct  82   SPVSRDVLE-----PILMLLTNPD-PQIRIASCAALGNLAVNN-ENKLLIVEMGGLEPLI  134

Query  169  SLLASPHAHISEQAV-----------------------------------------WALG  187
              + S +  +   AV                                          AL 
Sbjct  135  EQMKSDNVEVQCNAVGCITNLATQDDNKIEIAQSGALVPLTKLARSSNIRVQRNATGALL  194

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            N+   G   ++LV   GAV  L++LL+  D            T  LSN+  +++    + 
Sbjct  195  NMTHSGENRKELV-DAGAVPVLVSLLSSMDAD-----VQYYCTTALSNIAVDESNRRYLS  248

Query  248  AVEQILPT-LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
                 L T LV L++   P V      A+  L    N ++  +V+ G +P LV+L+ +  
Sbjct  249  KHAPKLVTKLVSLMNSTSPRVKCQATLALRNLASDTNYQLE-IVRAGGLPDLVQLIQSDS  307

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAG  365
            LP+V  ++  I NI      +  +++DAG L     LL       IQ  A  T+ N+ A 
Sbjct  308  LPLVLASVACIRNISIHPLNEG-LIVDAGFLPPLVKLLDYQESEEIQCHAVSTLRNLAAS  366

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIE  423
             +    +    G++     +        Q E  A +A+   +     +    L+   +++
Sbjct  367  SEKNRAEFFQSGVIEKFKQLALTCPISVQSEISACFAILALSDNTKYD----LLQQDVLK  422

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
             L+ +  ++D +I      A++N+      L +
Sbjct  423  VLIPMTMSQDQEISGNSAAAVANLISRVSNLEK  455


> sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain 
SC5314 / ATCC MYA-2876) OX=237561 GN=VAC8 PE=3 SV=3
Length=585

 Score =  255 bits (651),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 82/406 (20%), Positives = 167/406 (41%), Gaps = 22/406 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S+N+E Q  A      L +++       I ++G +    + L ++    +Q
Sbjct  130  LEPLIRQMMSTNIEVQCNAVGCITNLATQDDNK--SKIAKSGALIPL-TKLAKSKDIRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GA+P  +SLL++  A +      AL NIA D    +
Sbjct  187  RNATGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVDEVNRK  245

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L     + +P L    V  M S +       T  L NL  +      I      LP LV
Sbjct  246  KL----ASTEPKLVGQLVHLMDSPSPRVQCQATLALRNLASDSGYQVEIVR-AGGLPHLV  300

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            +LL  +   ++      I  ++  P     ++++ G +  LV LL  ++   I   A+  
Sbjct  301  QLLTCNHQPLVLAAVACIRNISIHP-LNEALIIEAGFLKPLVGLLDYTDSEEIQCHAVST  359

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++    ++ AGA+     L+      +Q E +   + I A   D   ++   
Sbjct  360  LRNLAASSEKNRTALLAAGAVDKCKELVLKVPLTVQSEISACFA-ILALADDLKPKLYES  418

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV------HCGIIEPLMNLLT  430
             ++  L+ +    + +    +  A+ N  S  + E   Y++      + GI   L+  L 
Sbjct  419  HIIDVLIPLTFSENGEVCGNSAAALANLCSRVSNEHKQYILNNWAQPNEGIYGFLIRFLE  478

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            +       + L  I  + ++      TE  +++ E    L  I+ L
Sbjct  479  SGSPTFEHIALWTILQLLES----NNTEINALIKENETILAGIKNL  520


 Score =  214 bits (545),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 85/371 (23%), Positives = 147/371 (40%), Gaps = 33/371 (9%)

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG--SV  195
             E+  AL       S+        G + A  +L+ S +  +   A  A   I       V
Sbjct  27   REAISALLQYLENRSDVD--FFSNGPLRALSTLVYSENIDLQRSAALAFAEITEKDVREV  84

Query  196  FRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
             RD       ++P+L LL   D  +   ACG L NL     N          +      L
Sbjct  85   NRD------VLEPILILLQSADSEVQRAACGALGNLAVNTEN--------KILIVEMGGL  130

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              L+R +   + EV  +    I+ L    ++    + K+G +  L KL  + ++ +   A
Sbjct  131  EPLIRQMMSTNIEVQCNAVGCITNLATQ-DDNKSKIAKSGALIPLTKLAKSKDIRVQRNA  189

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ-Q  372
              A+ N+ T + E  Q +++AGA+ V  SLL+N   ++Q   T  +SNI     ++ +  
Sbjct  190  TGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVDEVNRKKLA  248

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
                 LV  LV ++     + Q +A  A+ N  S    +  V +V  G +  L+ LLT  
Sbjct  249  STEPKLVGQLVHLMDSPSPRVQCQATLALRNLASDSGYQ--VEIVRAGGLPHLVQLLTCN  306

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EALQNHENESVYKASLSL  491
               ++L  +  I NI               +I E G L  +   L   ++E +   ++S 
Sbjct  307  HQPLVLAAVACIRNISIHPLNEA-------LIIEAGFLKPLVGLLDYTDSEEIQCHAVST  359

Query  492  IEKYFSVEEEE  502
            +    +  E+ 
Sbjct  360  LRNLAASSEKN  370


 Score =  196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 79/355 (22%), Positives = 145/355 (41%), Gaps = 21/355 (6%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + +S L  ++   +Q  +A A   I    +E+    V+   +   + LL S  + +   A
Sbjct  52   RALSTLVYSENIDLQRSAALAFAEI----TEKDVREVNRDVLEPILILLQSADSEVQRAA  107

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + L+++ G ++PL+  +      S       N    ++NL    + 
Sbjct  108  CGALGNLAVNTEN-KILIVEMGGLEPLIRQMM-----STNIEVQCNAVGCITNLATQDDN  161

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I      L  L +L    D  V  +   A+  +T    E    +V  G VP LV LL
Sbjct  162  KSKIAK-SGALIPLTKLAKSKDIRVQRNATGALLNMT-HSGENRQELVNAGAVPVLVSLL  219

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV-FPSLLTNPKTNIQKEATWTMSN  361
               +  +      A+ NI      + ++      L      L+ +P   +Q +AT  + N
Sbjct  220  SNEDADVQYYCTTALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQCQATLALRN  279

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +    Q++ +V  G +P LV +L+         AV  + N +     E +  ++  G 
Sbjct  280  LASDSGYQVE-IVRAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEAL--IIEAGF  336

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            ++PL+ LL   D++ I     A+S +   A     +EK    +   G +DK + L
Sbjct  337  LKPLVGLLDYTDSEEIQ--CHAVSTLRNLA---ASSEKNRTALLAAGAVDKCKEL  386


 Score =  100 bits (250),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 57/294 (19%), Positives = 107/294 (36%), Gaps = 22/294 (7%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWSVDDIVKG----INSSNVENQLQATQAARKLLSREK  108
            V  +   A S +  +  N+  +  +   +V      ++S +   Q QAT A R L S   
Sbjct  226  VQYYCTTALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQCQATLALRNLASDSG  285

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
                  I+RAG +P  V  L   +  P+   +   + NI+         +++ G +   +
Sbjct  286  YQV--EIVRAGGLPHLVQLLT-CNHQPLVLAAVACIRNISIH-PLNEALIIEAGFLKPLV  341

Query  169  SLLA-SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
             LL  +    I   AV  L N+A      R  ++  GAVD    L+    ++  +     
Sbjct  342  GLLDYTDSEEIQCHAVSTLRNLAASSEKNRTALLAAGAVDKCKELVLKVPLTVQSEISAC  401

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG-PNERI  286
                 L+      +   P      I+  L+ L   ++ EV  ++  A++ L     NE  
Sbjct  402  FAILALA------DDLKPKLYESHIIDVLIPLTFSENGEVCGNSAAALANLCSRVSNEHK  455

Query  287  GMVVKTGVVPQ------LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
              ++     P       L++ L +        AL  I  ++   + +   +I  
Sbjct  456  QYILNNWAQPNEGIYGFLIRFLESGSPTFEHIALWTILQLLESNNTEINALIKE  509


> sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii 
(strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 
2968) OX=284592 GN=VAC8 PE=3 SV=4
Length=560

 Score =  251 bits (642),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 83/406 (20%), Positives = 161/406 (40%), Gaps = 22/406 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S+N+E Q  A      L +++       I ++G +    + L ++    +Q
Sbjct  130  LEPLIRQMMSTNIEVQCNAVGCITNLATQDDNK--TKIAKSGALIPL-AKLAKSKDIRVQ  186

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GA+P  +SLL++  A +      AL NIA D    +
Sbjct  187  RNATGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVDEMNRK  245

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +       T  L NL  +      I      LP LV
Sbjct  246  KLSTT----EPKLVSQLVNLMDSPSPRVQCQATLALRNLASDSGYQVEIVR-AGGLPHLV  300

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRA  316
            +LL  +   ++      I  ++  P     +++  G +  LV LL       I   A+  
Sbjct  301  QLLTCNHQPLVLAAVACIRNISIHP-LNEALIIDAGFLKPLVGLLDFNDSEEIQCHAVST  359

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   ++     ++ AGA+     L+     ++Q E +   + I A   D   ++   
Sbjct  360  LRNLAASSERNRLALLAAGAVDKCKELVLKVPLSVQSEISACFA-ILALADDLKPKLYES  418

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH------CGIIEPLMNLLT  430
             ++  L+ +    + +    +  A+ N  S  + E   Y+         GI   L+  L 
Sbjct  419  HIIDVLIPLTFSENGEVCGNSAAALANLCSRVSSEHKQYIFKNWSEPNEGIYGFLLRFLQ  478

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            +       + L  I  + ++      TE  S++ E    L  I+ L
Sbjct  479  SGSATFEHIALWTILQLLES----NNTEINSLIKENESILSGIKNL  520


 Score =  214 bits (545),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 84/376 (22%), Positives = 150/376 (40%), Gaps = 33/376 (9%)

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG--SV  195
             E+  AL       S+        G + A  +L+ S +  +   A  A   I       V
Sbjct  27   REAISALLQYLENRSDVD--FFSNGPLRALSTLVYSENIDLQRSAALAFAEITEKDVREV  84

Query  196  FRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL  253
             RD       ++P+L LL   D  +   ACG L NL     N          +      L
Sbjct  85   NRD------VLEPILILLQSADSEVQRAACGALGNLAVNNEN--------KILIVEMGGL  130

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              L+R +   + EV  +    I+ L    + +   + K+G +  L KL  + ++ +   A
Sbjct  131  EPLIRQMMSTNIEVQCNAVGCITNLATQDDNKTK-IAKSGALIPLAKLAKSKDIRVQRNA  189

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ-Q  372
              A+ N+ T + E  Q +++AGA+ V  SLL+N   ++Q   T  +SNI     ++ +  
Sbjct  190  TGALLNM-THSGENRQELVNAGAVPVLVSLLSNEDADVQYYCTTALSNIAVDEMNRKKLS  248

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
                 LV  LV+++     + Q +A  A+ N  S    +  V +V  G +  L+ LLT  
Sbjct  249  TTEPKLVSQLVNLMDSPSPRVQCQATLALRNLASDSGYQ--VEIVRAGGLPHLVQLLTCN  306

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EALQNHENESVYKASLSL  491
               ++L  +  I NI               +I + G L  +   L  +++E +   ++S 
Sbjct  307  HQPLVLAAVACIRNISIHPLNEA-------LIIDAGFLKPLVGLLDFNDSEEIQCHAVST  359

Query  492  IEKYFSVEEEEDQNVV  507
            +    +  E     ++
Sbjct  360  LRNLAASSERNRLALL  375


 Score =  195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 78/355 (22%), Positives = 148/355 (42%), Gaps = 21/355 (6%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + +S L  ++   +Q  +A A   I    +E+    V+   +   + LL S  + +   A
Sbjct  52   RALSTLVYSENIDLQRSAALAFAEI----TEKDVREVNRDVLEPILILLQSADSEVQRAA  107

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + L+++ G ++PL+  +      S       N    ++NL    + 
Sbjct  108  CGALGNLAVNNEN-KILIVEMGGLEPLIRQMM-----STNIEVQCNAVGCITNLATQDDN  161

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I      L  L +L    D  V  +   A+  +T    E    +V  G VP LV LL
Sbjct  162  KTKIAK-SGALIPLAKLAKSKDIRVQRNATGALLNMT-HSGENRQELVNAGAVPVLVSLL  219

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEATWTMSN  361
               +  +      A+ NI      + ++      L +   +L+ +P   +Q +AT  + N
Sbjct  220  SNEDADVQYYCTTALSNIAVDEMNRKKLSTTEPKLVSQLVNLMDSPSPRVQCQATLALRN  279

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +    Q++ +V  G +P LV +L+         AV  + N +     E +  ++  G 
Sbjct  280  LASDSGYQVE-IVRAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEAL--IIDAGF  336

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            ++PL+ LL   D++ I     A+S +   A     +E+  + +   G +DK + L
Sbjct  337  LKPLVGLLDFNDSEEIQ--CHAVSTLRNLA---ASSERNRLALLAAGAVDKCKEL  386


> sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain 
ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) 
OX=284593 GN=VAC8 PE=3 SV=3
Length=582

 Score =  248 bits (632),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 66/317 (21%), Positives = 132/317 (42%), Gaps = 12/317 (4%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ ++  +  +NVE Q  A      L +R+       I  +G +    + L ++    +Q
Sbjct  128  LEPLINQMMGTNVEVQCNAVGCITNLATRDDNK--HKIATSGALVPL-TKLAKSKHIRVQ  184

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ GA+P  +SLL+S    +      AL NIA D +  +
Sbjct  185  RNATGALLNM-THSEENRRELVNAGAVPVLVSLLSSNDPDVQYYCTTALSNIAVDEANRK  243

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +       T  L NL  + +    I      LP LV
Sbjct  244  KL----AQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVR-AGGLPHLV  298

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA-SELPIVTPALRA  316
             L+  +   ++  +   I  ++  P    G++V  G +P LVKLL       I   A+  
Sbjct  299  NLIQSESVPLILASVACIRNISIHP-LNEGLIVDAGFLPPLVKLLDYRDSEEIQCHAVST  357

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++  +   ++GA+     L  +   ++Q E +   + +        Q +++ 
Sbjct  358  LRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISACFAILALADVS-KQDLLDA  416

Query  377  GLVPFLVSVLSKADFKT  393
             ++  L+ +    + + 
Sbjct  417  DILQALIPMTFSTNQEV  433


 Score =  189 bits (481),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 73/350 (21%), Positives = 146/350 (42%), Gaps = 27/350 (8%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV--PD  217
             GG + A  +L+ S + ++   A  A   +       R +      ++P+L LL    P 
Sbjct  45   SGGPLKALTTLVYSDNLNLQRSAALAFAEVTEK--YVRQVSRD--VLEPILILLQSQDPQ  100

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
            +   AC  L NL     N          +      L  L+  +   + EV  +    I+ 
Sbjct  101  IQVAACAALGNLAVNNEN--------KLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITN  152

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L    ++    +  +G +  L KL  +  + +   A  A+ N+ T ++E  + +++AGA+
Sbjct  153  LATR-DDNKHKIATSGALVPLTKLAKSKHIRVQRNATGALLNM-THSEENRRELVNAGAV  210

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKE  396
             V  SLL++   ++Q   T  +SNI     ++ +       LV  LVS++     + + +
Sbjct  211  PVLVSLLSSNDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQ  270

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            A  A+ N  S  + +  + +V  G +  L+NL+ ++   +IL  +  I NI       G 
Sbjct  271  ATLALRNLASDTSYQ--LEIVRAGGLPHLVNLIQSESVPLILASVACIRNISIHPLNEG-  327

Query  457  TEKLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
                  +I + G L  + + L   ++E +   ++S +    +  E+  + 
Sbjct  328  ------LIVDAGFLPPLVKLLDYRDSEEIQCHAVSTLRNLAASSEKNRKE  371


 Score =  182 bits (462),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 81/433 (19%), Positives = 157/433 (36%), Gaps = 68/433 (16%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWS----VDDIVKGINSSNVENQLQATQAARKLLSREK  108
            ++    +A + L     ++  +++     +  +   + S N+  Q  A  A  ++     
Sbjct  20   ITDNEREAVTLLLGYLEDKDRLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEV----T  75

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
            +  +  + R  L P  +  L ++    IQ  +  AL N+A    E    +VD G +   I
Sbjct  76   EKYVRQVSRDVLEPILI--LLQSQDPQIQVAACAALGNLAVNN-ENKLLIVDMGGLEPLI  132

Query  169  S-----------------------------------------LLASPHAHISEQAVWALG  187
            +                                         L  S H  +   A  AL 
Sbjct  133  NQMMGTNVEVQCNAVGCITNLATRDDNKHKIATSGALVPLTKLAKSKHIRVQRNATGALL  192

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            N+       R+LV   GAV  L++LL+  D            T  LSN+  ++     + 
Sbjct  193  NMTHSEENRRELV-NAGAVPVLVSLLSSND-----PDVQYYCTTALSNIAVDEANRKKLA  246

Query  248  AVEQ-ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
              E  ++  LV L+      V      A+  L    + ++  +V+ G +P LV L+ +  
Sbjct  247  QTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLE-IVRAGGLPHLVNLIQSES  305

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAG  365
            +P++  ++  I NI      +  +++DAG L     LL       IQ  A  T+ N+ A 
Sbjct  306  VPLILASVACIRNISIHPLNEG-LIVDAGFLPPLVKLLDYRDSEEIQCHAVSTLRNLAAS  364

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIE  423
             +   ++    G V     +   +    Q E  A +A+         +    L+   I++
Sbjct  365  SEKNRKEFFESGAVKKCKELALDSPVSVQSEISACFAILALADVSKQD----LLDADILQ  420

Query  424  PLMNLLTAKDTKI  436
             L+ +  + + ++
Sbjct  421  ALIPMTFSTNQEV  433


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 78/220 (35%), Gaps = 15/220 (7%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +V  I S +V   L +    R +        +  I+ AG +P  V  L   D   IQ
Sbjct  294  LPHLVNLIQSESVPLILASVACIRNISIHPLNEGL--IVDAGFLPPLVKLLDYRDSEEIQ  351

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS-----EQAVWALGNIAGD  192
              +   L N+A+ + +  K   + GA+     L       +        A+ AL +++  
Sbjct  352  CHAVSTLRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISACFAILALADVS--  409

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
                +  ++    +  L+  +       ++      L    S +          D  ++ 
Sbjct  410  ----KQDLLDADILQALIP-MTFSTNQEVSGNAAAALANLCSRIDNYSKIISSWDQPKEG  464

Query  253  L-PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            +   L R L  +         WAI  L++  N+++  ++K
Sbjct  465  IRGFLKRFLQSNYATFEHIALWAILQLSESHNDKVIYLIK  504


> sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) OX=559292 GN=VAC8 PE=1 SV=3
Length=578

 Score =  247 bits (631),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 77/386 (20%), Positives = 153/386 (40%), Gaps = 20/386 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ ++  +   NVE Q  A      L +R+       I  +G +    + L ++    +Q
Sbjct  128  LEPLINQMMGDNVEVQCNAVGCITNLATRDDNK--HKIATSGALIPL-TKLAKSKHIRVQ  184

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  K +V+ GA+P  +SLL+S    +      AL NIA D +  +
Sbjct  185  RNATGALLNM-THSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRK  243

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L       +P L    V  M S +       T  L NL  + +    I      LP LV
Sbjct  244  KL----AQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVR-AGGLPHLV  298

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            +L+  D   ++  +   I  ++  P    G++V  G +  LV+LL   +   I   A+  
Sbjct  299  KLIQSDSIPLVLASVACIRNISIHP-LNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVST  357

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++  +   ++GA+     L  +   ++Q E +   + +      ++  ++  
Sbjct  358  LRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLD-LLEA  416

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC------GIIEPLMNLLT  430
             ++  L+ +    + +    A  A+ N  S   V     ++        GI   L+  L 
Sbjct  417  NILDALIPMTFSQNQEVSGNAAAALANLCS--RVNNYTKIIEAWDRPNEGIRGFLIRFLK  474

Query  431  AKDTKIILVILDAISNIFQAAEKLGE  456
            +       + L  I  + ++     E
Sbjct  475  SDYATFEHIALWTILQLLESHNDKVE  500


 Score =  190 bits (482),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 73/350 (21%), Positives = 145/350 (41%), Gaps = 27/350 (8%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV--PD  217
             GG + A  +L+ S + ++   A  A   I       R +  +   ++P+L LL    P 
Sbjct  45   SGGPLKALTTLVYSDNLNLQRSAALAFAEITEK--YVRQVSRE--VLEPILILLQSQDPQ  100

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
            +   AC  L NL     N          +      L  L+  +  D+ EV  +    I+ 
Sbjct  101  IQVAACAALGNLAVNNEN--------KLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITN  152

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L    ++    +  +G +  L KL  +  + +   A  A+ N+ T ++E  + +++AGA+
Sbjct  153  LATR-DDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNM-THSEENRKELVNAGAV  210

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKE  396
             V  SLL++   ++Q   T  +SNI     ++ +       LV  LVS++     + + +
Sbjct  211  PVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQ  270

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            A  A+ N  S  + +  + +V  G +  L+ L+ +    ++L  +  I NI       G 
Sbjct  271  ATLALRNLASDTSYQ--LEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEG-  327

Query  457  TEKLSIMIEECGGLDKIEAL-QNHENESVYKASLSLIEKYFSVEEEEDQN  505
                  +I + G L  +  L    ++E +   ++S +    +  E+  + 
Sbjct  328  ------LIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKE  371


 Score =  176 bits (447),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 77/432 (18%), Positives = 160/432 (37%), Gaps = 66/432 (15%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWS----VDDIVKGINSSNVENQLQATQAARKLLSREK  108
            ++    +A + L     ++  +++     +  +   + S N+  Q  A  A  ++     
Sbjct  20   IADNEREAVTLLLGYLEDKDQLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEI----T  75

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
            +  +  + R  L P  +  L ++    IQ  +  AL N+A    E    +V+ G +   I
Sbjct  76   EKYVRQVSREVLEPILI--LLQSQDPQIQVAACAALGNLAVNN-ENKLLIVEMGGLEPLI  132

Query  169  SLLASPHAHISEQAVWALGNIA--------------------------------------  190
            + +   +  +   AV  + N+A                                      
Sbjct  133  NQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALL  192

Query  191  --GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
                    R  ++  GAV  L++LL+  D            T  LSN+  ++     +  
Sbjct  193  NMTHSEENRKELVNAGAVPVLVSLLSSTD-----PDVQYYCTTALSNIAVDEANRKKLAQ  247

Query  249  VEQ-ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
             E  ++  LV L+      V      A+  L    + ++  +V+ G +P LVKL+ +  +
Sbjct  248  TEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLE-IVRAGGLPHLVKLIQSDSI  306

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGR  366
            P+V  ++  I NI      +  +++DAG L     LL    +  IQ  A  T+ N+ A  
Sbjct  307  PLVLASVACIRNISIHPLNEG-LIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASS  365

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            +   ++    G V     +   +    Q E  A +A+        ++    L+   I++ 
Sbjct  366  EKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLD----LLEANILDA  421

Query  425  LMNLLTAKDTKI  436
            L+ +  +++ ++
Sbjct  422  LIPMTFSQNQEV  433


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 55/285 (19%), Positives = 89/285 (31%), Gaps = 50/285 (18%)

Query  53   VSSFPDDATSPLQENRNNQGTVNWSVDDIVKG----INSSNVENQLQATQAARKLLSREK  108
            V  +   A S +  +  N+  +  +   +V      ++S +   + QAT A R L S   
Sbjct  224  VQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTS  283

Query  109  QPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
                  I+RAG +P  V  +       +   S   + NI+         +VD G +   +
Sbjct  284  YQL--EIVRAGGLPHLVKLIQSDSIPLV-LASVACIRNISIH-PLNEGLIVDAGFLKPLV  339

Query  169  SLLA-SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
             LL       I   AV  L N+A      R    + GAV+    L     +S  +     
Sbjct  340  RLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISAC  399

Query  228  NLTWTLSNL------------------------------------CRNKNPAPPIDAV--  249
                 L+++                                    C   N    I     
Sbjct  400  FAILALADVSKLDLLEANILDALIPMTFSQNQEVSGNAAAALANLCSRVNNYTKIIEAWD  459

Query  250  ---EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
               E I   L+R L  D         W I  L +  N+++  +VK
Sbjct  460  RPNEGIRGFLIRFLKSDYATFEHIALWTILQLLESHNDKVEDLVK  504


> sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain 
ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 
GN=VAC8 PE=3 SV=3
Length=568

 Score =  246 bits (629),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 82/385 (21%), Positives = 159/385 (41%), Gaps = 19/385 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S+NVE Q  A      L +++       I  +G +    + L ++    +Q
Sbjct  128  LEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKA--KIAHSGALVPL-TKLAKSKNIRVQ  184

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  K +VD GA+P  +SLL+S  A +      AL NIA D S  R
Sbjct  185  RNATGALLNM-THSGENRKELVDAGAVPVLVSLLSSSDADVQYYCTTALSNIAVDESNRR  243

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L      +   L +L      S +       T  L NL  +      I      L  LV
Sbjct  244  KLSQTEPRLVSKLVVLTD----SPSARVKCQATLALRNLASDTGYQLEIVR-AGGLSHLV  298

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
            +L+  +   ++  +   I  ++  P    G++V  G +  LVKLL  ++   I   A+  
Sbjct  299  KLIQCNSMPLVLASVACIRNISIHP-LNEGLIVDAGFLKPLVKLLDYNDNEEIQCHAVST  357

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   +++  Q   ++GA+     L      ++Q E +   + +      +++ +++ 
Sbjct  358  LRNLAASSEKNRQEFFESGAVEKCKQLALVSPISVQSEISACFAILALADNSKLE-LLDA  416

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG-TVEQIVYL---VHCGIIEPLMNLLTAK  432
             ++  L+ +    + +    A  A+ N  S     E+I+        G+   L+  L ++
Sbjct  417  NILEALIPMTFSTNQEVAGNAAAALANLCSRINNYEKIIESWTEPSKGVCGFLIRFLQSE  476

Query  433  DTKIILVILDAISNIFQAAEKLGET  457
                  +   A+  I Q  E   ET
Sbjct  477  YPTFEHI---ALWTILQLLESHNET  498


 Score =  188 bits (478),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 73/350 (21%), Positives = 140/350 (40%), Gaps = 27/350 (8%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL--AVPD  217
             GG + A  +L+ S + ++   A  A   I           +    ++P+L LL    P 
Sbjct  45   SGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRP----VDREVLEPILILLQSHDPQ  100

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
            +   AC  L NL     N          +      L  L+  +  ++ EV  +    I+ 
Sbjct  101  IQIAACAALGNLAVNNEN--------KILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITN  152

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L    ++    +  +G +  L KL  +  + +   A  A+ N+ T + E  + ++DAGA+
Sbjct  153  LATQ-DDNKAKIAHSGALVPLTKLAKSKNIRVQRNATGALLNM-THSGENRKELVDAGAV  210

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKE  396
             V  SLL++   ++Q   T  +SNI     ++ +       LV  LV +      + + +
Sbjct  211  PVLVSLLSSSDADVQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTDSPSARVKCQ  270

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            A  A+ N  S    +  + +V  G +  L+ L+      ++L  +  I NI       G 
Sbjct  271  ATLALRNLASDTGYQ--LEIVRAGGLSHLVKLIQCNSMPLVLASVACIRNISIHPLNEG-  327

Query  457  TEKLSIMIEECGGLDKI-EALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
                  +I + G L  + + L  ++NE +   ++S +    +  E+  Q 
Sbjct  328  ------LIVDAGFLKPLVKLLDYNDNEEIQCHAVSTLRNLAASSEKNRQE  371


 Score =  181 bits (459),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/418 (20%), Positives = 152/418 (36%), Gaps = 64/418 (15%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L++  N        +  +   + S N+  Q  A  A  ++  +  +P    ++   LI  
Sbjct  35   LEDKDNYDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVDREVLEPILI--  92

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
                L ++    IQ  +  AL N+A    E    +V+ G +   I  + S +  +   AV
Sbjct  93   ----LLQSHDPQIQIAACAALGNLAVNN-ENKILIVEMGGLEPLIEQMKSNNVEVQCNAV  147

Query  184  -----------------------------------------WALGNIAGDGSVFRDLVIK  202
                                                      AL N+   G   ++LV  
Sbjct  148  GCITNLATQDDNKAKIAHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELV-D  206

Query  203  YGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ-ILPTLVRLLH  261
             GAV  L++LL+  D            T  LSN+  +++    +   E  ++  LV L  
Sbjct  207  AGAVPVLVSLLSSSDAD-----VQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTD  261

Query  262  HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
                 V      A+  L      ++  +V+ G +  LVKL+  + +P+V  ++  I NI 
Sbjct  262  SPSARVKCQATLALRNLASDTGYQLE-IVRAGGLSHLVKLIQCNSMPLVLASVACIRNIS  320

Query  322  TGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP  380
                 +  +++DAG L     LL  N    IQ  A  T+ N+ A  +   Q+    G V 
Sbjct  321  IHPLNEG-LIVDAGFLKPLVKLLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFESGAVE  379

Query  381  FLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI  436
                +   +    Q E  A +A+        +E    L+   I+E L+ +  + + ++
Sbjct  380  KCKQLALVSPISVQSEISACFAILALADNSKLE----LLDANILEALIPMTFSTNQEV  433


 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 82/231 (35%), Gaps = 15/231 (6%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK I  +++   L +    R +        +  I+ AG +   V  L   D   IQ
Sbjct  294  LSHLVKLIQCNSMPLVLASVACIRNISIHPLNEGL--IVDAGFLKPLVKLLDYNDNEEIQ  351

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIP-----AFISLLASPHAHISEQAVWALGNIAGD  192
              +   L N+A+ + +  +   + GA+      A +S ++      +  A+ AL +    
Sbjct  352  CHAVSTLRNLAASSEKNRQEFFESGAVEKCKQLALVSPISVQSEISACFAILALAD----  407

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
                +  ++    ++ L+ +    +                      K      +  + +
Sbjct  408  --NSKLELLDANILEALIPMTFSTNQEVAGNAAAALANLCSRINNYEKIIESWTEPSKGV  465

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG--VVPQLVKL  301
               L+R L  + P       W I  L +  NE +  ++K+   +V  + +L
Sbjct  466  CGFLIRFLQSEYPTFEHIALWTILQLLESHNETMLGLIKSNKEIVKSIKRL  516


> sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris 
OX=4922 GN=VAC8 PE=3 SV=3
Length=556

 Score =  242 bits (619),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 65/317 (21%), Positives = 136/317 (43%), Gaps = 12/317 (4%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ + S N+E Q  A      L ++++      I  +G +    + L ++    +Q
Sbjct  129  LEPLIRQMMSPNIEVQCNAVGCITNLATQDQNK--SKIATSGALIPL-TKLAKSKDLRVQ  185

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  AL N+ + + E  + +V+ G++P  + LL+S    +      AL NIA D    +
Sbjct  186  RNATGALLNM-THSLENRQELVNAGSVPILVQLLSSTDPDVQYYCTTALSNIAVDEGNRK  244

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             L     + +P L    V  M S +       T  L NL  + N    I      LP LV
Sbjct  245  KL----ASTEPKLISQLVQLMDSTSPRVQCQATLALRNLASDANYQLEIVR-AGGLPNLV  299

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRA  316
             LL+     ++      I  ++  P     +++  G +  LV LL  ++ + I   A+  
Sbjct  300  TLLNSTHQPLVLAAVACIRNISIHP-LNEALIIDAGFLKPLVSLLDYNDNVEIQCHAVST  358

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+   ++     ++++GA+     L+ N   ++Q E +   + I A   D   ++++ 
Sbjct  359  LRNLAASSERNRLALLESGAVEKCEKLVLNSPISVQSEISACFA-ILALADDLKMKLLDS  417

Query  377  GLVPFLVSVLSKADFKT  393
             ++  L+ + S  + + 
Sbjct  418  NIIEVLLPLTSSENGEV  434


 Score =  202 bits (513),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 89/426 (21%), Positives = 168/426 (39%), Gaps = 66/426 (15%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGI----NSSNVENQLQATQAARKLLSREKQPPIDN  114
            +A S L +   N+  V++  D  ++ +     S N++ Q  A  A  ++  ++ +P   +
Sbjct  27   EAISSLLQYLENRSEVDFFTDGPLRALSTLVYSENIDLQRSAALAFAEVTEKDVRPVTRD  86

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
            ++   LI      L ++  + +Q  +  AL N+A         +V+ G +   I  + SP
Sbjct  87   VLEPILI------LLQSSDAEVQRAACAALGNLAV-NDSNKVLIVNMGGLEPLIRQMMSP  139

Query  175  HAHISEQAVWALGNIA----------------------------------------GDGS  194
            +  +   AV  + N+A                                            
Sbjct  140  NIEVQCNAVGCITNLATQDQNKSKIATSGALIPLTKLAKSKDLRVQRNATGALLNMTHSL  199

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ-IL  253
              R  ++  G+V  L+ LL+  D            T  LSN+  ++     + + E  ++
Sbjct  200  ENRQELVNAGSVPILVQLLSSTD-----PDVQYYCTTALSNIAVDEGNRKKLASTEPKLI  254

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              LV+L+    P V      A+  L    N ++  +V+ G +P LV LL ++  P+V  A
Sbjct  255  SQLVQLMDSTSPRVQCQATLALRNLASDANYQLE-IVRAGGLPNLVTLLNSTHQPLVLAA  313

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQ  372
            +  I NI      +  ++IDAG L    SLL  N    IQ  A  T+ N+ A  +     
Sbjct  314  VACIRNISIHPLNE-ALIIDAGFLKPLVSLLDYNDNVEIQCHAVSTLRNLAASSERNRLA  372

Query  373  VVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
            ++  G V     ++  +    Q E  A +A+        ++    L+   IIE L+ L +
Sbjct  373  LLESGAVEKCEKLVLNSPISVQSEISACFAILALADDLKMK----LLDSNIIEVLLPLTS  428

Query  431  AKDTKI  436
            +++ ++
Sbjct  429  SENGEV  434


 Score =  169 bits (427),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 55/336 (16%), Positives = 118/336 (35%), Gaps = 56/336 (17%)

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW  273
                + S      R+     + +   K+  P       +L  ++ LL   D EV    C 
Sbjct  53   LSTLVYSENIDLQRSAALAFAEVTE-KDVRP---VTRDVLEPILILLQSSDAEVQRAACA  108

Query  274  AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV------------  321
            A+  L    +    ++V  G +  L++ + +  + +   A+  I N+             
Sbjct  109  ALGNLAV-NDSNKVLIVNMGGLEPLIRQMMSPNIEVQCNAVGCITNLATQDQNKSKIATS  167

Query  322  ----------------------------TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
                                        T + E  Q +++AG++ +   LL++   ++Q 
Sbjct  168  GALIPLTKLAKSKDLRVQRNATGALLNMTHSLENRQELVNAGSVPILVQLLSSTDPDVQY  227

Query  354  EATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ  412
              T  +SNI     ++ +       L+  LV ++     + Q +A  A+ N  S    + 
Sbjct  228  YCTTALSNIAVDEGNRKKLASTEPKLISQLVQLMDSTSPRVQCQATLALRNLASDANYQ-  286

Query  413  IVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK  472
             + +V  G +  L+ LL +    ++L  +  I NI               +I + G L  
Sbjct  287  -LEIVRAGGLPNLVTLLNSTHQPLVLAAVACIRNISIHPLNEA-------LIIDAGFLKP  338

Query  473  I-EALQNHENESVYKASLSLIEKYFSVEEEEDQNVV  507
            +   L  ++N  +   ++S +    +  E     ++
Sbjct  339  LVSLLDYNDNVEIQCHAVSTLRNLAASSERNRLALL  374


> sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=vac8 PE=1 SV=4
Length=550

 Score =  240 bits (612),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 78/410 (19%), Positives = 157/410 (38%), Gaps = 21/410 (5%)

Query  52   NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPP  111
              +S      +   EN+     +N  +D +++ + S +VE Q  A      L + ++   
Sbjct  103  RAASVALGNLAVNAENKALVVKLNG-LDLLIRQMMSPHVEVQCNAVGCITNLATLDENK-  160

Query  112  IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL  171
               I  +G +      L ++    +Q  +  AL N+ + + E  + +V  G IP  +SLL
Sbjct  161  -SKIAHSGALGPLTR-LAKSKDIRVQRNATGALLNM-THSYENRQQLVSAGTIPVLVSLL  217

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             S    +      ++ NIA D    + L       +P L    +  M + +         
Sbjct  218  PSSDTDVQYYCTTSISNIAVDAVHRKRLAQS----EPKLVRSLIQLMDTSSPKVQCQAAL  273

Query  232  TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
             L NL  ++     I     +   L  L     P +LA     I  ++  P      ++ 
Sbjct  274  ALRNLASDERYQIEIVQSNALPSLLRLLRSSYLPLILASVA-CIRNISIHP-LNESPIID  331

Query  292  TGVVPQLVKLLGASE-LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
             G +  LV LL  +E   I   A+  + N+   ++   + +I+A A+     L+ +   +
Sbjct  332  AGFLRPLVDLLSCTENEEIQCHAVSTLRNLAASSERNKRAIIEANAIQKLRCLILDAPVS  391

Query  351  IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV  410
            +Q E T  ++ +     +    ++N G+   L+ +      + Q  +  A+ N +S   V
Sbjct  392  VQSEMTACLAVLAL-SDEFKSYLLNFGICNVLIPLTDSMSIEVQGNSAAALGNLSS--NV  448

Query  411  EQIVYLVHC------GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL  454
            +     + C      GI   L+  L+++D+    +    I  + +A    
Sbjct  449  DDYSRFIECWDSPAGGIHGYLVRFLSSEDSTFAHIAAWTIVQLLEAGVPR  498


 Score =  189 bits (480),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 82/355 (23%), Positives = 146/355 (41%), Gaps = 21/355 (6%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            + ++ L  +D   +Q  +A A   I    +E+    VD   I   + LL SP A I   A
Sbjct  50   RALTILAYSDNLDLQRSAALAFAEI----TEKDVREVDRETIEPVLFLLQSPDAEIQRAA  105

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
              ALGN+A +    + LV+K   +D L+  +  P +  + C  +  +T  L+ L  NK+ 
Sbjct  106  SVALGNLAVNAEN-KALVVKLNGLDLLIRQMMSPHV-EVQCNAVGCIT-NLATLDENKSK  162

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
                      L  L RL    D  V  +   A+  +T    E    +V  G +P LV LL
Sbjct  163  IAH----SGALGPLTRLAKSKDIRVQRNATGALLNMT-HSYENRQQLVSAGTIPVLVSLL  217

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL-AVFPSLLTNPKTNIQKEATWTMSN  361
             +S+  +      +I NI      + ++      L      L+      +Q +A   + N
Sbjct  218  PSSDTDVQYYCTTSISNIAVDAVHRKRLAQSEPKLVRSLIQLMDTSSPKVQCQAALALRN  277

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
            + +  + QI+ +V    +P L+ +L  +       +V  + N +     E    ++  G 
Sbjct  278  LASDERYQIE-IVQSNALPSLLRLLRSSYLPLILASVACIRNISIHPLNESP--IIDAGF  334

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            + PL++LL+  + + I     A+S +   A     +E+    I E   + K+  L
Sbjct  335  LRPLVDLLSCTENEEIQ--CHAVSTLRNLA---ASSERNKRAIIEANAIQKLRCL  384


 Score =  164 bits (414),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 75/352 (21%), Positives = 139/352 (39%), Gaps = 23/352 (7%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            + A   L  S +  +   A  A   I           +    ++P+L LL  PD      
Sbjct  49   LRALTILAYSDNLDLQRSAALAFAEITEKDVRE----VDRETIEPVLFLLQSPDAE----  100

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
               R  +  L NL  N      +  +   L  L+R +     EV  +    I+ L    +
Sbjct  101  -IQRAASVALGNLAVNAENKALVVKLNG-LDLLIRQMMSPHVEVQCNAVGCITNLATL-D  157

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            E    +  +G +  L +L  + ++ +   A  A+ N+ T + E  Q ++ AG + V  SL
Sbjct  158  ENKSKIAHSGALGPLTRLAKSKDIRVQRNATGALLNM-THSYENRQQLVSAGTIPVLVSL  216

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFLVSVLSKADFKTQKEAVWAVT  402
            L +  T++Q   T ++SNI      + +       LV  L+ ++  +  K Q +A  A+ 
Sbjct  217  LPSSDTDVQYYCTTSISNIAVDAVHRKRLAQSEPKLVRSLIQLMDTSSPKVQCQAALALR  276

Query  403  NYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
            N  S    +  + +V    +  L+ LL +    +IL  +  I NI  +   L E+     
Sbjct  277  NLASDERYQ--IEIVQSNALPSLLRLLRSSYLPLILASVACIRNI--SIHPLNESP----  328

Query  463  MIEECGGLDKIEALQN-HENESVYKASLSLIEKYFSVEEEEDQNVVPETTSE  513
             I + G L  +  L +  ENE +   ++S +    +  E   + ++     +
Sbjct  329  -IIDAGFLRPLVDLLSCTENEEIQCHAVSTLRNLAASSERNKRAIIEANAIQ  379


> sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis 
thaliana OX=3702 GN=ABAP1 PE=1 SV=1
Length=737

 Score =  234 bits (597),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 86/396 (22%), Positives = 162/396 (41%), Gaps = 35/396 (9%)

Query  100  ARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT------DCSPIQFESAWALTNIASGTSE  153
              +L+  + +P ID ++    I + V  L  +      D   ++ E+A  + ++A    E
Sbjct  60   VTQLIDIDDEP-IDLVV---AIRRHVEVLNSSFSDPDFDHEAVK-EAAADIADLAK-IDE  113

Query  154  QTKAVVDGGAIPAFISLLASP-----------HAHISEQAVWALGNIAGDGSVFRDLVIK  202
              + +V+ GAIPA +  L SP              + +    ALG IA     ++ L++ 
Sbjct  114  NVEIIVENGAIPALVRYLESPLVVCGNVPKSCEHKLEKDCALALGLIAAIQPGYQQLIVD  173

Query  203  YGAVDPLLALLAVPDMSSLAC---GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL  259
             GA+ P + LL               +R     ++N+  +         VE  +  LV L
Sbjct  174  AGAIVPTVKLLKRRGECGECMFANAVIRRAADIITNIAHDNPRIKTNIRVEGGIAPLVEL  233

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            L+  D +V      A+  ++   +E    +V+   +P LV +L + +  +   A+ AIGN
Sbjct  234  LNFPDVKVQRAAAGALRTVSFRNDENKSQIVELNALPTLVLMLQSQDSTVHGEAIGAIGN  293

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            +V  + +  + VI AGAL     LL++     Q+EA   +    A   D    +   G +
Sbjct  294  LVHSSPDIKKEVIRAGALQPVIGLLSSTCLETQREAALLIGQFAAPDSDCKVHIAQRGAI  353

Query  380  PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV  439
              L+ +L  +D +  + + +A+         +    + H G I  L+NLL  K   +   
Sbjct  354  TPLIKMLESSDEQVVEMSAFALGRLAQDAHNQ--AGIAHRGGIISLLNLLDVKTGSVQHN  411

Query  440  ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
               A+  +    E + +         + GG+ K++ 
Sbjct  412  AAFALYGLADNEENVAD-------FIKAGGIQKLQD  440


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 57/289 (20%), Positives = 100/289 (35%), Gaps = 42/289 (15%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
             EN++    +N ++  +V  + S +     +A  A   L+          +IRAG +   
Sbjct  257  DENKSQIVELN-ALPTLVLMLQSQDSTVHGEAIGAIGNLV-HSSPDIKKEVIRAGALQPV  314

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            +  L  T C   Q E+A  +   A+  S+    +   GAI   I +L S    + E + +
Sbjct  315  IGLLSST-CLETQREAALLIGQFAAPDSDCKVHIAQRGAITPLIKMLESSDEQVVEMSAF  373

Query  185  ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            ALG +A D +  +  +   G +  LL LL V            N  + L  L  N+    
Sbjct  374  ALGRLAQD-AHNQAGIAHRGGIISLLNLLDVK-----TGSVQHNAAFALYGLADNEENVA  427

Query  245  PIDAVEQI--------------------------------LPTLVRLLHHDDPEVLADTC  272
                   I                                L  L+ L+   +  V     
Sbjct  428  DFIKAGGIQKLQDDNFTVQPTRDCVVRTLKRLQNKIHGPVLNQLLYLMRTAEKTVQIRIA  487

Query  273  WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
             A+++L D P +   + +    V  L++LL  S       +  A+  + 
Sbjct  488  LALAHLCD-PKDGKLIFIDNNGVEFLLELLYFSSNKQQRYSSSALYELA  535


> sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 
OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
Length=710

 Score =  207 bits (528),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 65/287 (23%), Positives = 121/287 (42%), Gaps = 17/287 (6%)

Query  140  SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP------------HAHISEQAVWALG  187
            +   L  +A    +    +VDGGA+PA ++ L +P               + + + +ALG
Sbjct  74   ATQVLAELAK-NEDLVNVIVDGGAVPALMTHLQAPPYNDGDLAEKPYEHEVEKGSAFALG  132

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA---CGYLRNLTWTLSNLCRNKNPAP  244
             +A     ++ L++  GA+  L+ LL      S +      +R     ++NL    +   
Sbjct  133  LLAI-KPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVIRRAADAITNLAHENSSIK  191

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
                VE  +P LV LL   D +V      A+  L    ++    +V+   +P L+ +LG+
Sbjct  192  TRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPTLILMLGS  251

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
             +  I   A+  IGN+V  +    + V+ AGAL     LL++     Q+EA   +    +
Sbjct  252  EDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSSCCPESQREAALLLGQFAS  311

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE  411
               D    +V  G V  L+ +L   D + ++ + +A+         +
Sbjct  312  TDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALGRLAQDAHNQ  358


 Score =  127 bits (319),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 121/320 (38%), Gaps = 18/320 (6%)

Query  94   LQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSE  153
             +A  A   L   E       +   G IP  V  L  +D S +Q  +A AL  +A    +
Sbjct  174  RRAADAITNLA-HENSSIKTRVRVEGGIPPLVELLEFSD-SKVQRAAAGALRTLAFKNDD  231

Query  154  QTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL  213
                +V+  A+P  I +L S  A I  +AV  +GN+       +  V+  GA+ P++ LL
Sbjct  232  NKNQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLL  291

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW  273
            +     S      R     L       +           +  L+ +L   D ++   + +
Sbjct  292  S-----SCCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAF  346

Query  274  AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVID  333
            A+  L    + + G +  +G +  L+KLL +    +   A  A+  +    ++     I 
Sbjct  347  ALGRLAQDAHNQAG-IAHSGGLGPLLKLLDSRNGSLQHNAAFALYGLA-DNEDNVSDFIR  404

Query  334  AGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKT  393
             G +        + +  +Q        +  +    ++++ ++  ++  L+ ++  ++   
Sbjct  405  VGGIQKL----QDGEFIVQ-----ATKDCVSKTLKRLEEKIHGRVLRHLLYLMRISEKSI  455

Query  394  QKEAVWAVTNYTSGGTVEQI  413
            Q+    A+ +  S      I
Sbjct  456  QRRVALALAHLCSPEDQRTI  475


 Score =  105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 72/374 (19%), Positives = 151/374 (40%), Gaps = 27/374 (7%)

Query  42   KKDDQMLKRRNVSSFPDDATSPL----QENRNNQGTVNWS--VDDIVKGINSSNVENQLQ  95
            K++      R V+S    A   +     EN + +  V     +  +V+ +  S+ + Q  
Sbjct  158  KRNKDGSSSRAVNSVIRRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFSDSKVQRA  217

Query  96   ATQAARKLLSR-EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ  154
            A  A R L  + +     + I+    +P  +  LG  D + I +E+   + N+   +   
Sbjct  218  AAGALRTLAFKNDDNK--NQIVECNALPTLILMLGSED-AAIHYEAVGVIGNLVHSSPHI  274

Query  155  TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLA  214
             K V+  GA+   I LL+S       +A   LG  A   S  +  +++ GAV PL+ +L 
Sbjct  275  KKEVLTAGALQPVIGLLSSCCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPLIEMLQ  334

Query  215  VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA  274
             PD+            + L  L ++ +    I A    L  L++LL   +  +  +  +A
Sbjct  335  SPDVQLKEMS-----AFALGRLAQDAHNQAGI-AHSGGLGPLLKLLDSRNGSLQHNAAFA  388

Query  275  ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
            +  L D   + +   ++ G + +L       +   +  A +   + V+ T ++ +  I  
Sbjct  389  LYGLAD-NEDNVSDFIRVGGIQKL------QDGEFIVQATK---DCVSKTLKRLEEKIHG  438

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ  394
              L     L+   + +IQ+     ++++ +  +DQ    ++   +  L+ +L   + K Q
Sbjct  439  RVLRHLLYLMRISEKSIQRRVALALAHLCS-PEDQRTIFIDDNGLELLLGLLGSLNTKQQ  497

Query  395  KEAVWAVTNYTSGG  408
             +   A+    +  
Sbjct  498  LDGAAALYKLANKS  511


> sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo 
sapiens OX=9606 GN=ARMC4 PE=1 SV=1
Length=1044

 Score =  192 bits (487),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 80/359 (22%), Positives = 138/359 (38%), Gaps = 20/359 (6%)

Query  113  DNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGG-AIPAFISLL  171
            + I +AG IP     L +T    +       L   AS   E  +A +     I   +  L
Sbjct  626  EAIRKAGGIPLLARLL-KTSHENMLIPVVGTLQECAS--EENYRAAIKAERIIENLVKNL  682

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             S +  + E    A+   A D    RDLV  +G + PL +LL   D        +    W
Sbjct  683  NSENEQLQEHCAMAIYQCAEDKET-RDLVRLHGGLKPLASLLNNTDNKE-RLAAVTGAIW  740

Query  232  TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
              S    N        A+E    TLV LL     EVL +   A+         R+ +V K
Sbjct  741  KCSISKENVTKFREYKAIE----TLVGLLTDQPEEVLVNVVGALGECCQERENRV-IVRK  795

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTN  350
             G +  LV LL      ++    +A+G      + ++ ++ID    + +  SLL NP  +
Sbjct  796  CGGIQPLVNLLVGINQALLVNVTKAVG--ACAVEPESMMIIDRLDGVRLLWSLLKNPHPD  853

Query  351  IQKEATWTMSNITAGRQDQIQQVVNH-GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
            ++  A W +       +D  + V +  G +  +V++L   + +       A+TN      
Sbjct  854  VKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKD--  911

Query  410  VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL---GETEKLSIMIE  465
             E +  +   G++  L  L    + K+   + +AIS            GE + ++ ++ 
Sbjct  912  QENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVR  970


 Score =  157 bits (397),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 81/408 (20%), Positives = 143/408 (35%), Gaps = 19/408 (5%)

Query  45    DQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL  104
             + ML    +           +EN          ++++VK +NS N + Q     A  +  
Sbjct  646   ENML----IPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCA  701

Query  105   SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAI  164
               E +   D +   G +    S L  TD          A+    S + E      +  AI
Sbjct  702   --EDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWK-CSISKENVTKFREYKAI  758

Query  165   PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
                + LL      +    V ALG    +    R +V K G + PL+ LL       +   
Sbjct  759   ETLVGLLTDQPEEVLVNVVGALGECCQEREN-RVIVRKCGGIQPLVNLLV-----GINQA  812

Query  225   YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE  284
              L N+T  +            ID ++ +   L  LL +  P+V A   WA+        +
Sbjct  813   LLVNVTKAVGACAVEPESMMIIDRLDGV-RLLWSLLKNPHPDVKASAAWALCPCIKNAKD  871

Query  285   RIGMVVK-TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
                MV    G +  +V LL +    ++     AI NI     E   V+ D G + +   L
Sbjct  872   AGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAK-DQENLAVITDHGVVPLLSKL  930

Query  344   LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
                    ++      +S      ++++     H  V  LV  L   D    +    A+  
Sbjct  931   ANTNNNKLRHHLAEAISRCCMWGRNRV-AFGEHKAVAPLVRYLKSNDTNVHRATAQALYQ  989

Query  404   YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAA  451
              +     +  + +   G ++ L++++ + D  +       ISNI + A
Sbjct  990   LSEDA--DNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLA  1035


 Score =  156 bits (394),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 89/446 (20%), Positives = 167/446 (37%), Gaps = 59/446 (13%)

Query  38   LRKA--KKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQ  95
            LRK+  K ++ +    + S   ++     QE   +  +  W +  +VK +   N    + 
Sbjct  412  LRKSAEKIEETVSDSSSESEEDEEPPDHRQEASADLPSEYWQIQKLVKYLKGGNQTATVI  471

Query  96   ATQAAR--KLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSE  153
            A  + R   L     Q  I ++   G +   ++ L  TD    +  S   L  I S   +
Sbjct  472  ALCSMRDFSLAQETCQLAIRDV---GGLEVLINLLE-TDEVKCKIGSLKILKEI-SHNPQ  526

Query  154  QTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL  213
              + +VD G +P  +++L SPH  +   A   + N+A      R +V ++G +  L+ALL
Sbjct  527  IRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARR-VVRQHGGITKLVALL  585

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW  273
                 S+                                 P    L    D EV      
Sbjct  586  DCAHDSTK--------------------------------PAQSSLYEARDVEVARCGAL  613

Query  274  AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVID  333
            A+ +     +     + K G +P L +LL  S   ++ P +  +      ++E  +  I 
Sbjct  614  AL-WSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQE--CASEENYRAAIK  670

Query  334  AG-ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFK  392
            A   +      L +    +Q+     +    A  ++    V  HG +  L S+L+  D  
Sbjct  671  AERIIENLVKNLNSENEQLQEHCAMAIYQ-CAEDKETRDLVRLHGGLKPLASLLNNTD--  727

Query  393  TQKEAVWAVTN--YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
              KE + AVT   +    + E +        IE L+ LLT +  ++++ ++ A+    Q 
Sbjct  728  -NKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQE  786

Query  451  AEKLGETEKLSIMIEECGGLDKIEAL  476
             E         +++ +CGG+  +  L
Sbjct  787  REN-------RVIVRKCGGIQPLVNL  805


 Score = 90.8 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/250 (18%), Positives = 96/250 (38%), Gaps = 24/250 (10%)

Query  271  TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV  330
               ++   +         +   G +  L+ LL   E+     +L+ +  I +   +  Q 
Sbjct  472  ALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEI-SHNPQIRQN  530

Query  331  VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKAD  390
            ++D G L +  ++L +P  +++  A  T++N+ A  +   + V  HG +  LV++L  A 
Sbjct  531  IVDLGGLPIMVNILDSPHKSLKCLAAETIANV-AKFKRARRVVRQHGGITKLVALLDCAH  589

Query  391  FKTQ------KEA-------VWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
              T+       EA         A+  ++   +      +   G I  L  LL      ++
Sbjct  590  DSTKPAQSSLYEARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENML  649

Query  438  LVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS  497
            + ++  +             E     I+    ++ +    N ENE + +     I  Y  
Sbjct  650  IPVVGTLQEC-------ASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAI--YQC  700

Query  498  VEEEEDQNVV  507
             E++E +++V
Sbjct  701  AEDKETRDLV  710


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/147 (14%), Positives = 60/147 (41%), Gaps = 11/147 (7%)

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE  396
            +      L          A  +M + +  ++     + + G +  L+++L   + K +  
Sbjct  454  IQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIG  513

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            ++  +   +    + Q   +V  G +  ++N+L +    +  +  + I+N+ +       
Sbjct  514  SLKILKEISHNPQIRQ--NIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKF------  565

Query  457  TEKLSIMIEECGGLDKIEAL--QNHEN  481
             ++   ++ + GG+ K+ AL    H++
Sbjct  566  -KRARRVVRQHGGITKLVALLDCAHDS  591


> sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus 
musculus OX=10090 GN=Armc4 PE=1 SV=1
Length=1037

 Score =  188 bits (477),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/359 (22%), Positives = 137/359 (38%), Gaps = 20/359 (6%)

Query  113  DNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGG-AIPAFISLL  171
            + I +AG IP     L +T    +       L   AS   E  +A +     I   +  L
Sbjct  619  EAIRKAGGIPLLARLL-KTSHENMLIPVVGTLQECAS--EENYRAAIKAERIIENLVKNL  675

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             S +  + E    A+   A D    RDLV  +G + PL +LL   D        +    W
Sbjct  676  NSENEQLQEHCAMAIYQCAEDEET-RDLVRLHGGLKPLASLLNNTDNKE-RLAAVTGAIW  733

Query  232  TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
              S    N        A+E    TLV LL     EVL +   A+         R+ +V K
Sbjct  734  KCSISKENVIKFREYKAIE----TLVGLLTDQPEEVLVNVVGALGECCQEYENRV-LVRK  788

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTN  350
             G +  LV LL      ++    +A+G      + ++  +ID    + +  SLL NP  +
Sbjct  789  CGGIQPLVNLLVGINQALLVNVTKAVG--ACAVEPESMAIIDRLDGVRLLWSLLKNPHPD  846

Query  351  IQKEATWTMSNITAGRQDQIQQVVNH-GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
            ++  A W +       +D  + V +  G +  +V++L   + +       A+TN      
Sbjct  847  VKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKD--  904

Query  410  VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL---GETEKLSIMIE  465
             E +  +   G++  L  L    + K+   + +AIS            GE + ++ ++ 
Sbjct  905  QENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVR  963


 Score =  162 bits (409),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 82/408 (20%), Positives = 145/408 (36%), Gaps = 19/408 (5%)

Query  45    DQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL  104
             + ML    +           +EN          ++++VK +NS N + Q     A  +  
Sbjct  639   ENML----IPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCA  694

Query  105   SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAI  164
               E +   D +   G +    S L  TD          A+    S + E      +  AI
Sbjct  695   --EDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWK-CSISKENVIKFREYKAI  751

Query  165   PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
                + LL      +    V ALG    +    R LV K G + PL+ LL       +   
Sbjct  752   ETLVGLLTDQPEEVLVNVVGALGECCQEYEN-RVLVRKCGGIQPLVNLLV-----GINQA  805

Query  225   YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE  284
              L N+T  +            ID ++ +   L  LL +  P+V A   WA+    +   +
Sbjct  806   LLVNVTKAVGACAVEPESMAIIDRLDGV-RLLWSLLKNPHPDVKASAAWALCPCIENAKD  864

Query  285   RIGMVVK-TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
                MV    G +  +V LL +    ++     AI NI     E   V+ D G + +   L
Sbjct  865   AGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAK-DQENLAVITDHGVVPLLSKL  923

Query  344   LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
                    +++     +S      ++++     H  V  LV  L   D    +    A+  
Sbjct  924   ANTNNDKLRRHLAEAISRCCMWGRNRV-AFGEHKAVAPLVRYLKSNDTNVHRATAQALYQ  982

Query  404   YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAA  451
              +     +  + +   G ++ L++++ + D  +       ISNI + A
Sbjct  983   LSEDA--DNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLA  1028


 Score =  160 bits (404),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 83/418 (20%), Positives = 160/418 (38%), Gaps = 59/418 (14%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAAR--KLLSREKQPPIDNIIRAGLIP  122
            QE   +  +  W +  +VK +   N    + A  + R   L     Q  I ++   G + 
Sbjct  434  QEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDV---GGLE  490

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
              ++ L  TD    +  S   L  I S   +  + +VD G +P  +++L SPH  +   +
Sbjct  491  VLINLL-DTDEVKCKIGSLKILKEI-SHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLS  548

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
               + N+A      R  V ++G +  L+ALL     S+                      
Sbjct  549  AETIANVAKFKRARR-AVRQHGGITKLVALLDCGQNST----------------------  585

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS-YLTDGPNERIGMVVKTGVVPQLVKL  301
                   E   P+L     ++  +V    C A++ +     +     + K G +P L +L
Sbjct  586  -------EPTQPSL-----YETRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARL  633

Query  302  LGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG-ALAVFPSLLTNPKTNIQKEATWTMS  360
            L  S   ++ P +  +      ++E  +  I A   +      L +    +Q+     + 
Sbjct  634  LKTSHENMLIPVVGTLQE--CASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIY  691

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN--YTSGGTVEQIVYLVH  418
               A  ++    V  HG +  L S+L+  D    KE + AVT   +    + E ++    
Sbjct  692  Q-CAEDEETRDLVRLHGGLKPLASLLNNTD---NKERLAAVTGAIWKCSISKENVIKFRE  747

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
               IE L+ LLT +  ++++ ++ A+    Q  E         +++ +CGG+  +  L
Sbjct  748  YKAIETLVGLLTDQPEEVLVNVVGALGECCQEYEN-------RVLVRKCGGIQPLVNL  798


> sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus OX=10116 
GN=Ctnnb1 PE=1 SV=1
Length=781

 Score =  170 bits (432),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 88/394 (22%), Positives = 154/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L      P ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GPHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQL  602


 Score =  129 bits (324),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 81/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGPHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 134/388 (35%), Gaps = 68/388 (18%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             A P  +  LA P   +   AV  L N   D        +   A+  L  LL   D    
Sbjct  116  AAHPTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ---  165

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTD  280
                +      +  L + +     I    Q++  +VR + +  D E    T   +  L+ 
Sbjct  166  --VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH  223

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L   
Sbjct  224  HR-EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKM  282

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV---------------  385
             +LL           T  +  +  G Q+    ++  G    LV++               
Sbjct  283  VALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSR  342

Query  386  ---------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
                                       L+    +  +  +W + N +   T ++ +    
Sbjct  343  VLKVLSVCSSNKPAIVEAGGMQALGPHLTDPSQRLVQNCLWTLRNLSDAATKQEGME---  399

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--L  476
             G++  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L
Sbjct  400  -GLLGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVL  452

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQ  504
            +  + E + + ++  +    S  +E + 
Sbjct  453  RAGDREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDVHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|Q7Z5J8|ANKAR_HUMAN Ankyrin and armadillo repeat-containing 
protein OS=Homo sapiens OX=9606 GN=ANKAR PE=2 SV=3
Length=1434

 Score =  172 bits (435),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 63/340 (19%), Positives = 130/340 (38%), Gaps = 14/340 (4%)

Query  120   LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
             +    V  L           +  +L  I     +  + ++D G IPA I+LL S    + 
Sbjct  701   VWKTLVEMLQCESYKRRMM-AVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQ  759

Query  180   EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLC  237
              + V  L NI+   S    LV + G +  L+ LL    P++ S     L ++       C
Sbjct  760   CKTVGLLSNISTHKSAVHALV-EAGGIPSLINLLVCDEPEVHSRCAVILYDIAQ-----C  813

Query  238   RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              NK+     + +    P+L+ LL+ +   VL +    I  L  G       V +   +P 
Sbjct  814   ENKDVIAKYNGI----PSLINLLNLNIENVLVNVMNCIRVLCIGNENNQRAVREHKGLPY  869

Query  298   LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
             L++ L +    +   +  AI  +     E    +   GA+    +L    + ++Q +   
Sbjct  870   LIRFLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAM  929

Query  358   TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
              + ++ +      +  +   L  +L+ +L       +++   A+     G T++Q  Y+ 
Sbjct  930   AVESLASHNALIQKAFLEKSLTKYLLKLLKAFQIDVKEQGAVALWALA-GQTLKQQKYMA  988

Query  418   HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET  457
                    ++N+L +   K+  V  +A+  + + +      
Sbjct  989   EQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQ  1028


 Score = 82.7 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 83/220 (38%), Gaps = 10/220 (5%)

Query  251  QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
             +  TLV +L  +  +       ++  +    ++    ++  G +P L+ LL +S++ + 
Sbjct  700  PVWKTLVEMLQCESYKRRMMAVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQ  759

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
               +  + NI T        +++AG +    +LL   +  +       + +I   + +  
Sbjct  760  CKTVGLLSNISTH-KSAVHALVEAGGIPSLINLLVCDEPEVHSRCAVILYDIA--QCENK  816

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
              +  +  +P L+++L+          +  +     G    Q   +     +  L+  L 
Sbjct  817  DVIAKYNGIPSLINLLNLNIENVLVNVMNCIRVLCIGNENNQ-RAVREHKGLPYLIRFL-  874

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
            + D+ ++  +  A       AE   + +++   I   G +
Sbjct  875  SSDSDVLKAVSSA-----AIAEVGRDNKEIQDAIAMEGAI  909


 Score = 49.2 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 76/232 (33%), Gaps = 8/232 (3%)

Query  94    LQATQAARKLLSREKQPPIDN-IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTS  152
             ++A  +    ++    P     ++     P  +  L       I+ E A++L  I  G  
Sbjct  1056  IRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGND  1115

Query  153   EQTKAVVDGGAIPA--FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVD-PL  209
                K + +         + LL S    I  +A +AL   A +    + L+++ G +   +
Sbjct  1116  VLQKDLHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISI  1175

Query  210   LALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA  269
                     + +        +   L+ + R+ +    I    + +  LV  L+      + 
Sbjct  1176  FERFLESTVETEKAMAAFQIV-VLAKVIRDMD---HITLSARGVTILVDSLYSVQTSTIV  1231

Query  270   DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
              T   I+ L              G + +L   L +    +      A+G + 
Sbjct  1232  LTGNLIASLAHSRAGIPEAFTTLGTIQRLCYHLYSGIEEVRAACSSALGYLT  1283


> sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris 
OX=9615 GN=CTNNB1 PE=1 SV=1
Length=781

 Score =  168 bits (426),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/394 (22%), Positives = 153/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQL  602


 Score =  128 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 81/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 134/388 (35%), Gaps = 68/388 (18%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             A P  +  LA P   +   AV  L N   D        +   A+  L  LL   D    
Sbjct  116  AAHPTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ---  165

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTD  280
                +      +  L + +     I    Q++  +VR + +  D E    T   +  L+ 
Sbjct  166  --VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH  223

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L   
Sbjct  224  HR-EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKM  282

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV---------------  385
             +LL           T  +  +  G Q+    ++  G    LV++               
Sbjct  283  VALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSR  342

Query  386  ---------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
                                       L+    +  +  +W + N +   T ++ +    
Sbjct  343  VLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGME---  399

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--L  476
             G++  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L
Sbjct  400  -GLLGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVL  452

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQ  504
            +  + E + + ++  +    S  +E + 
Sbjct  453  RAGDREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDVHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=CTNNB1 
PE=1 SV=1
Length=781

 Score =  168 bits (426),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/394 (22%), Positives = 153/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQL  602


 Score =  128 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 81/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 134/388 (35%), Gaps = 68/388 (18%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             A P  +  LA P   +   AV  L N   D        +   A+  L  LL   D    
Sbjct  116  AAHPTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ---  165

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTD  280
                +      +  L + +     I    Q++  +VR + +  D E    T   +  L+ 
Sbjct  166  --VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH  223

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L   
Sbjct  224  HR-EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKM  282

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV---------------  385
             +LL           T  +  +  G Q+    ++  G    LV++               
Sbjct  283  VALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSR  342

Query  386  ---------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
                                       L+    +  +  +W + N +   T ++ +    
Sbjct  343  VLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGME---  399

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--L  476
             G++  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L
Sbjct  400  -GLLGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVL  452

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQ  504
            +  + E + + ++  +    S  +E + 
Sbjct  453  RAGDREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDVHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 
GN=CTNNB1 PE=1 SV=1
Length=781

 Score =  168 bits (426),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/394 (22%), Positives = 153/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQL  602


 Score =  128 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 81/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 134/388 (35%), Gaps = 68/388 (18%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             A P  +  LA P   +   AV  L N   D        +   A+  L  LL   D    
Sbjct  116  AAHPTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ---  165

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTD  280
                +      +  L + +     I    Q++  +VR + +  D E    T   +  L+ 
Sbjct  166  --VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH  223

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L   
Sbjct  224  HR-EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKM  282

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV---------------  385
             +LL           T  +  +  G Q+    ++  G    LV++               
Sbjct  283  VALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSR  342

Query  386  ---------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
                                       L+    +  +  +W + N +   T ++ +    
Sbjct  343  VLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGME---  399

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--L  476
             G++  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L
Sbjct  400  -GLLGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVL  452

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQ  504
            +  + E + + ++  +    S  +E + 
Sbjct  453  RAGDREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDVHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus OX=10090 
GN=Ctnnb1 PE=1 SV=1
Length=781

 Score =  168 bits (426),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/394 (22%), Positives = 153/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQL  602


 Score =  128 bits (322),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 81/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 134/388 (35%), Gaps = 68/388 (18%)

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
             A P  +  LA P   +   AV  L N   D        +   A+  L  LL   D    
Sbjct  116  AAHPTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ---  165

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTD  280
                +      +  L + +     I    Q++  +VR + +  D E    T   +  L+ 
Sbjct  166  --VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSH  223

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
               E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L   
Sbjct  224  HR-EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKM  282

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV---------------  385
             +LL           T  +  +  G Q+    ++  G    LV++               
Sbjct  283  VALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSR  342

Query  386  ---------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH  418
                                       L+    +  +  +W + N +   T ++ +    
Sbjct  343  VLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGME---  399

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--L  476
             G++  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L
Sbjct  400  -GLLGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVL  452

Query  477  QNHENESVYKASLSLIEKYFSVEEEEDQ  504
            +  + E + + ++  +    S  +E + 
Sbjct  453  RAGDREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDVHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus 
OX=10090 GN=Spag6 PE=1 SV=1
Length=507

 Score =  165 bits (418),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 80/411 (19%), Positives = 161/411 (39%), Gaps = 18/411 (4%)

Query  45   DQMLKRRN--VSSFPDDATSPLQ-ENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAAR  101
            +Q  K R   V    + AT P   E   N G ++     ++  +       Q  A  A  
Sbjct  11   EQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVV----PTIQQTAALALG  66

Query  102  KLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDG  161
            +L +       + +++  ++P+ V  L        +  +A+ L  +   + +  +A+VD 
Sbjct  67   RLANYND-DLAEAVVKGDILPQLVYSLAEQ-NRFYKKAAAFVLRAVGKHSPQLAQAIVDC  124

Query  162  GAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSL  221
            GA+   +  L      + E A WALG IA   +     V+  GA+  L+  +  P+    
Sbjct  125  GALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPE----  180

Query  222  ACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG  281
                 R     LS++ ++             +  L +++ + D ++      A+S +   
Sbjct  181  -IALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKH  239

Query  282  PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP  341
              +   MVV+  + P ++  L   +  +   A   I  I   T E +Q++++AG +A   
Sbjct  240  SVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVI  299

Query  342  SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFL-VSVLSKADFKTQKEAVWA  400
              + + K NI+      +  + A  ++    V+    VP L + +  + +   +  A WA
Sbjct  300  DCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWA  359

Query  401  VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT--KIILVILDAISNIFQ  449
            +       T E    +     +  L++L  + ++   + L    AI NI Q
Sbjct  360  LGQLGRH-TPEHARAVAVTNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQ  409


 Score =  161 bits (408),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 73/369 (20%), Positives = 138/369 (37%), Gaps = 19/369 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++  F  +  +     +Q  +  A         +  + + + G +     LL      I 
Sbjct  6    VLQVFEQY-QKARTQFVQMVAELATR------PQNIETLQNAGVMSLLRPLLLDVVPTIQ  58

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            + A  ALG +A       + V+K   +  L+  LA  +             + L  + ++
Sbjct  59   QTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKA-----AAFVLRAVGKH  113

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
                         L TLV  L   DP V     WA+ Y+     E    VV  G +P LV
Sbjct  114  SPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLV  173

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
              +   E+ +   A  A+ +I   + E  Q V+DAGA+A    ++ NP   ++++    +
Sbjct  174  LCIQEPEIALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSAL  233

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            S I     D  + VV   + P +++ L   D   +K A   +       T E    +V+ 
Sbjct  234  SQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKH-TPELSQLIVNA  292

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNH  479
            G +  +++ + +    I       +  I         +E L++ +    G+ ++    + 
Sbjct  293  GGVAAVIDCIGSCKGNIR------LPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSE  346

Query  480  ENESVYKAS  488
            E E   KA+
Sbjct  347  EPEDHIKAA  355


 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 46/309 (15%), Positives = 99/309 (32%), Gaps = 43/309 (14%)

Query  45   DQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL  104
            +  LKR  +++      S              ++  + + I + + + + Q   A  ++ 
Sbjct  180  EIALKR--IAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIA  237

Query  105  SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAI  164
                    + ++ A + P  ++ L +     ++  +   +  IA  T E ++ +V+ G +
Sbjct  238  KHSV-DLAEMVVEAEIFPVVLTCL-KDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGV  295

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
             A I  + S   +I    +  LG +A         VI    V  L   L+      +   
Sbjct  296  AAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAA  355

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL-------------------------  259
                  W L  L R+        AV   LP L+ L                         
Sbjct  356  ----AAWALGQLGRHTPEHARAVAVTNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQKC  411

Query  260  ---------LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
                     L+   P +L       S +    ++   + V +G + ++ ++       + 
Sbjct  412  TYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQ  471

Query  311  TPALRAIGN  319
               + +I N
Sbjct  472  EY-INSINN  479


> sp|F1QGH7|CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=ctnnb1 
PE=1 SV=1
Length=780

 Score =  167 bits (424),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 86/394 (22%), Positives = 153/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  236  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  294

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +   +  E+ +W    +    SV  
Sbjct  295  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCS  350

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  351  SNKPAIVEAGGMQAL-----GLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  402

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  403  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  462

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   +    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  463  AICALRHLTSRHQDAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  514

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  515  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SMGGTQQQFVEGVRMEE  567

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  568  IVEGCTGALHILARDIHNRIVIRGLNTIPLFVQL  601


 Score =  128 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 80/402 (20%), Positives = 146/402 (36%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  128  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  185

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       ++  L N+ S   E   A+   G IPA + +L 
Sbjct  186  AIMRSPQMVSAIVRTMQNTNDVETARCTSGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  244

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  245  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  299

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  300  LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVE  358

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L      +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  359  AGGMQALGLHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  415

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  416  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  475

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  476  DAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  516


 Score =  101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 64/385 (17%), Positives = 133/385 (35%), Gaps = 68/385 (18%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  LA P   +   AV  L N   D        +   A+  L  LL   D       
Sbjct  118  PTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ-----V  165

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  +VR + +  D E    T   +  L+    
Sbjct  166  VVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHR-  224

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L    +L
Sbjct  225  EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVAL  284

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV------------------  385
            L           T  +  +  G Q+    ++  G    LV++                  
Sbjct  285  LNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLK  344

Query  386  ------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
                                    L+    +  +  +W + N +   T ++ +     G+
Sbjct  345  VLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGME----GL  400

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--LQNH  479
            +  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L+  
Sbjct  401  LGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVLRAG  454

Query  480  ENESVYKASLSLIEKYFSVEEEEDQ  504
            + E + + ++  +    S  ++ + 
Sbjct  455  DREDITEPAICALRHLTSRHQDAEM  479


 Score = 44.6 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 43/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  542  AHQDTQRRTSMGGTQQQFVEGVRMEEIVEGC--TGALHILARDIHNRIV--IRGLNTIPL  597

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L  +A           +G   P    LL S +  ++  A 
Sbjct  598  FVQLL-YSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  655

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  656  AVLFRMSEDKPQ  667


> sp|P26233|CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 
GN=ctnnb1 PE=1 SV=1
Length=781

 Score =  167 bits (423),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 87/394 (22%), Positives = 152/394 (39%), Gaps = 49/394 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK + S        A      LL  ++   +  +  AG + K V+ L +T+   + 
Sbjct  237  IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKM-AVRLAGGLQKMVALLNKTNVKFLA  295

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A ++++ +      E+ +W    +    SV  
Sbjct  296  ITTD-CLQILAYGNQESKLIILASGGPQALVNIMRTYS---YEKLLWTTSRVLKVLSVCS  351

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++  +   ++N  WTL NL    + A   + +E +L 
Sbjct  352  SNKPAIVEAGGMQAL-----GLHLTDSSQRLVQNCLWTLRNL---SDAATKQEGMEGLLG  403

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
            TLV+LL  DD  V+      +S LT    +   MV + G +  LV+  L       I  P
Sbjct  404  TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP  463

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
            A+ A+ ++ +   E    Q  V +  G L V   LL  P       + W +   T G   
Sbjct  464  AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIR  515

Query  369  QIQQ-------VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH---  418
             +         +   G +P LV +L +A   TQ+         + GGT +Q V  V    
Sbjct  516  NLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT-------SIGGTQQQFVEGVRMEE  568

Query  419  --CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               G    L  L      +I++  L+ I    Q 
Sbjct  569  IVEGCTGALHILARDIHNRIVIRGLNTIPLFVQL  602


 Score =  128 bits (321),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 82/402 (20%), Positives = 147/402 (37%), Gaps = 21/402 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     +A     +L  +E      
Sbjct  129  SQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASR--H  186

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+R+  ++   V  +  T+       +A  L N+ S   E   A+   G IPA + +L 
Sbjct  187  AIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLG  245

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA       T  
Sbjct  246  SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT-----TDC  300

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LV ++  +   ++L  T   +  L+         +V+
Sbjct  301  LQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCS-SNKPAIVE  359

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G +  L   L  S   +V   L  + N+   +D  T+     G L     LL +   N+
Sbjct  360  AGGMQALGLHLTDSSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINV  416

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---  406
               A   +SN+T         V   G +  LV  VL   D     + A+ A+ + TS   
Sbjct  417  VTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQ  476

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAK-DTKIILVILDAISNI  447
               + Q    +H G +  ++ LL       +I   +  I N+
Sbjct  477  EAEMAQNAVRLHYG-LPVVVKLLHPPSHWPLIKATVGLIRNL  517


 Score =  102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 65/385 (17%), Positives = 134/385 (35%), Gaps = 68/385 (18%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  LA P   +   AV  L N   D        +   A+  L  LL   D       
Sbjct  119  PTNVQRLAEPSQMLK-HAVVNLINYQDDAE------LATRAIPELTKLLNDEDQ-----V  166

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  +VR + +  D E    T   +  L+    
Sbjct  167  VVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHR-  225

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            E +  + K+G +P LVK+LG+    ++  A+  + N++   +     V  AG L    +L
Sbjct  226  EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVAL  285

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSV------------------  385
            L           T  +  +  G Q+    ++  G    LV++                  
Sbjct  286  LNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLK  345

Query  386  ------------------------LSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
                                    L+ +  +  +  +W + N +   T ++ +     G+
Sbjct  346  VLSVCSSNKPAIVEAGGMQALGLHLTDSSQRLVQNCLWTLRNLSDAATKQEGME----GL  401

Query  422  IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--LQNH  479
            +  L+ LL + D  ++      +SN+           K  +M+ + GG++ +    L+  
Sbjct  402  LGTLVQLLGSDDINVVTCAAGILSNL------TCNNYKNKMMVCQVGGIEALVRTVLRAG  455

Query  480  ENESVYKASLSLIEKYFSVEEEEDQ  504
            + E + + ++  +    S  +E + 
Sbjct  456  DREDITEPAICALRHLTSRHQEAEM  480


 Score = 44.2 bits (103),  Expect = 0.003, Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 44/132 (33%), Gaps = 6/132 (5%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
              ++   + ++  +    V+G+    +      T A   L        +  I     IP 
Sbjct  543  AHQDTQRRTSIGGTQQQFVEGVRMEEIVEGC--TGALHILARDIHNRIV--IRGLNTIPL  598

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            FV  L  +    IQ  +A  L ++A           +G   P    LL S +  ++  A 
Sbjct  599  FVQLL-YSPIENIQRVAAGVLCDVAQDKEAAEAIEAEGATAP-LTELLHSRNEGVATYAA  656

Query  184  WALGNIAGDGSV  195
              L  ++ D   
Sbjct  657  AVLFRMSEDKPQ  668


> sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens 
OX=9606 GN=SPAG6 PE=2 SV=1
Length=509

 Score =  160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/369 (20%), Positives = 138/369 (37%), Gaps = 19/369 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            ++  F  +  +     +Q  +  A         +  + + + G +    +LL      I 
Sbjct  6    VLQVFEQY-QKARTQFVQMVAELATR------PQNIETLQNAGVMSLLRTLLLDVVPTIQ  58

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            + A  ALG +A       + V+K   +  L+  LA  +             + L  + ++
Sbjct  59   QTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKA-----AAFVLRAVGKH  113

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
                         L TLV  L   DP V     WA+ Y+     E    VV  G VP LV
Sbjct  114  SPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLV  173

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
              +   E+ +   A  A+ +I   + E  Q V+DAGA+A    ++ NP   ++ +    +
Sbjct  174  LCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSAL  233

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            S ++    D  + VV   + P +++ L   D   +K A   +       T E    +V+ 
Sbjct  234  SQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKH-TPELSQLVVNA  292

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNH  479
            G +  +++ + +            +  I         +E L++ +    G+ ++    + 
Sbjct  293  GGVAAVIDCIGSCKGNTR------LPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSE  346

Query  480  ENESVYKAS  488
            E E   KA+
Sbjct  347  EPEDHIKAA  355


 Score =  149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 72/401 (18%), Positives = 146/401 (36%), Gaps = 14/401 (3%)

Query  82   VKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESA  141
            V  +     + + Q  Q   +L +R +   I+ +  AG++    + L       IQ  +A
Sbjct  6    VLQVFEQYQKARTQFVQMVAELATRPQN--IETLQNAGVMSLLRTLL-LDVVPTIQQTAA  62

Query  142  WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVI  201
             AL  +A+   +  +AVV    +P  +  LA  +    + A + L  +          ++
Sbjct  63   LALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIV  122

Query  202  KYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH  261
              GA+D L+  L   D      G      W L  + R+             +P LV  + 
Sbjct  123  DCGALDTLVICLEDFD-----PGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQ  177

Query  262  HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
              +  +      A+S +     E    VV  G V  L +++   +  +    L A+  + 
Sbjct  178  EPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVS  237

Query  322  TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPF  381
              + +  ++V++A    V  + L +    ++K A+  +  I     +  Q VVN G V  
Sbjct  238  KHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAA  297

Query  382  LVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVIL  441
            ++  +      T+   +  +    +      +  ++  G +  L   L+ +    I    
Sbjct  298  VIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKG-VPQLSVCLSEEPEDHIKAAA  356

Query  442  D-AISNIFQ----AAEKLGETEKLSIMIEECGGLDKIEALQ  477
              A+  I +     A  +  T  L +++      +  E LQ
Sbjct  357  AWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQ  397


 Score = 68.1 bits (165),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 46/301 (15%), Positives = 97/301 (32%), Gaps = 42/301 (14%)

Query  45   DQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL  104
            +  LKR   S+  D A    +           +V  + + I + + + + Q   A  ++ 
Sbjct  180  EIALKRIAASALSDIAKHSPE--LAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQV-  236

Query  105  SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAI  164
            S+      + ++ A + P  ++ L +     ++  ++  +  IA  T E ++ VV+ G +
Sbjct  237  SKHSVDLAEMVVEAEIFPVVLTCL-KDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGV  295

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
             A I  + S   +     +  LG +A         VI    V  L   L+      +   
Sbjct  296  AAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAA  355

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDD--------------------  264
                  W L  + R+        AV   LP L+ L    +                    
Sbjct  356  ----AAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKC  411

Query  265  --------------PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
                          P +L       S +    ++   + V +G + ++ ++       + 
Sbjct  412  TYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQ  471

Query  311  T  311
             
Sbjct  472  E  472


> sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis 
thaliana OX=3702 GN=PUB13 PE=1 SV=1
Length=660

 Score =  160 bits (404),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 79/330 (24%), Positives = 131/330 (40%), Gaps = 28/330 (8%)

Query  48   LKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSRE  107
            L+ R VSSF    +SP + N+         ++D++  +   N E+Q  A    R L  R 
Sbjct  337  LRPRKVSSF----SSPAEANK---------IEDLMWRLAYGNPEDQRSAAGEIRLLAKRN  383

Query  108  KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK-AVVDGGAIPA  166
                +  I  AG IP  V  L   D S IQ  S  AL N++    E  K A+V  GAIP 
Sbjct  384  ADNRV-AIAEAGAIPLLVGLLSTPD-SRIQEHSVTALLNLS--ICENNKGAIVSAGAIPG  439

Query  167  FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYL  226
             + +L        E A   L +++      +  +   GA+ PL+ LL             
Sbjct  440  IVQVLKKGSMEARENAAATLFSLSVIDEN-KVTIGALGAIPPLVVLLNEGTQRG-----K  493

Query  227  RNLTWTLSNLC-RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER  285
            ++    L NLC    N    I A   ++PTL RLL      ++ +    ++ L+  P E 
Sbjct  494  KDAATALFNLCIYQGNKGKAIRA--GVIPTLTRLLTEPGSGMVDEALAILAILSSHP-EG  550

Query  286  IGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT  345
              ++  +  VP LV+ +          A   + ++ +G  +        G +     L  
Sbjct  551  KAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAG  610

Query  346  NPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
            N     +++A   +  I+   + Q +  V+
Sbjct  611  NGTDRGKRKAAQLLERISRLAEQQKETAVS  640


 Score =  127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/266 (20%), Positives = 108/266 (41%), Gaps = 9/266 (3%)

Query  133  CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD  192
                Q  +A  +  +A   ++   A+ + GAIP  + LL++P + I E +V AL N++  
Sbjct  365  NPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRIQEHSVTALLNLSI-  423

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
                +  ++  GA+  ++ +L    M +       N   TL +L    +           
Sbjct  424  CENNKGAIVSAGAIPGIVQVLKKGSMEARE-----NAAATLFSLSV-IDENKVTIGALGA  477

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            +P LV LL+        D   A+  L      +   + + GV+P L +LL      +V  
Sbjct  478  IPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGKAI-RAGVIPTLTRLLTEPGSGMVDE  536

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            AL AI  I++   E   ++  + A+      +       ++ A   + ++ +G    + +
Sbjct  537  AL-AILAILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVE  595

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAV  398
                GL+  L+ +      + +++A 
Sbjct  596  AQKLGLMGPLIDLAGNGTDRGKRKAA  621


 Score =  111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 59/298 (20%), Positives = 112/298 (38%), Gaps = 10/298 (3%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
            +   I   +  LA  +      A   +  +A   +  R  + + GA+  L+ LL+ PD  
Sbjct  350  EANKIEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSR  409

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                         LS +C N   A         +P +V++L     E   +    +  L+
Sbjct  410  IQEHSV--TALLNLS-ICENNKGA---IVSAGAIPGIVQVLKKGSMEARENAAATLFSLS  463

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
               +E    +   G +P LV LL          A  A+ N+      + +  I AG +  
Sbjct  464  V-IDENKVTIGALGAIPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGK-AIRAGVIPT  521

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVW  399
               LLT P + +  EA   ++ +++  +     + +   VP LV  +     + ++ A  
Sbjct  522  LTRLLTEPGSGMVDEALAILAILSSHPEG-KAIIGSSDAVPSLVEFIRTGSPRNRENAAA  580

Query  400  AVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET  457
             + +  S G  + +V     G++ PL++L      +        +  I + AE+  ET
Sbjct  581  VLVHLCS-GDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERISRLAEQQKET  637


 Score =  103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 40/216 (19%), Positives = 89/216 (41%), Gaps = 7/216 (3%)

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            +  L+  L + +PE        I  L     +    + + G +P LV LL   +  I   
Sbjct  354  IEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRIQEH  413

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            ++ A+ N+    +     ++ AGA+     +L       ++ A  T+ +++    +    
Sbjct  414  SVTALLNLSI-CENNKGAIVSAGAIPGIVQVLKKGSMEARENAAATLFSLSV-IDENKVT  471

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
            +   G +P LV +L++   + +K+A  A+ N       +     +  G+I  L  LLT  
Sbjct  472  IGALGAIPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGKA--IRAGVIPTLTRLLTEP  529

Query  433  DTKIILVILDAISNIFQAAEK---LGETEKLSIMIE  465
             + ++   L  ++ +    E    +G ++ +  ++E
Sbjct  530  GSGMVDEALAILAILSSHPEGKAIIGSSDAVPSLVE  565


> sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing 
protein OS=Mus musculus OX=10090 GN=Ankar PE=2 SV=1
Length=1465

 Score =  162 bits (410),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 56/340 (16%), Positives = 124/340 (36%), Gaps = 14/340 (4%)

Query  120   LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
             +    V  L           +  +L  I        + ++D G IPA ++LL SP   + 
Sbjct  714   VWETLVEMLQCESSKRRMM-AVMSLEVICLANDRYWQCILDAGTIPALVNLLKSPQIKLQ  772

Query  180   EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLC  237
              + V  L NI+   S+    +++ G +  ++ LL    P++ S     L ++       C
Sbjct  773   YKTVGLLSNISTHVSIVH-AIVEAGGIPAVINLLTSDEPELHSRCAIILYDVA-----KC  826

Query  238   RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              NK+       +    P L+ LL  +   VL +    I  L  G       +     +  
Sbjct  827   ENKDVIAKYSGI----PALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQY  882

Query  298   LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
             L++ L +    +   +   I  +     E    +   GA+    +L    + ++Q +   
Sbjct  883   LIQFLSSDSDVLKALSSATIAEVARDNKEVQDAIAKEGAIPPLVTLFKGKQLSVQVKGAM  942

Query  358   TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
              + ++        ++ +   L   L+ +L       +++   A+     G T++Q  Y+ 
Sbjct  943   AVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALA-GQTLKQQKYMA  1001

Query  418   HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGET  457
                    ++++L +   K+  V  +A+  + + +      
Sbjct  1002  EQIGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQ  1041


 Score =  107 bits (266),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 75/423 (18%), Positives = 155/423 (37%), Gaps = 48/423 (11%)

Query  79    DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
             + +V+ +   + + ++ A  +  +++          I+ AG IP  V+ L ++    +Q+
Sbjct  716   ETLVEMLQCESSKRRMMAVMSL-EVICLANDRYWQCILDAGTIPALVNLL-KSPQIKLQY  773

Query  139   ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD  198
             ++   L+NI++  S    A+V+ G IPA I+LL S    +  +    L ++A      +D
Sbjct  774   KTVGLLSNISTHVS-IVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAK--CENKD  830

Query  199   LVIKYGAVDPLLALLAVPDMS------------------------------------SLA  222
             ++ KY  +  L+ LL++   S                                    S  
Sbjct  831   VIAKYSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSD  890

Query  223   CGYLRNLTW-TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG  281
                L+ L+  T++ + R+        A E  +P LV L       V      A+  L + 
Sbjct  891   SDVLKALSSATIAEVARDNKEVQDAIAKEGAIPPLVTLFKGKQLSVQVKGAMAVESLANC  950

Query  282   PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP  341
                     ++  +   L+KLL A ++ +      A+  +   T +Q + + +     +  
Sbjct  951   NPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALAGQTLKQQKYMAEQIGYNLII  1010

Query  342   SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVL--SKADFKTQKEAVW  399
             S+L +P   +Q      +  ++   +    Q+     +  LV +L  +K    T    + 
Sbjct  1011  SMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIR  1070

Query  400   AVTNYTSG----GTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLG  455
             AV +   G           ++V    +  L+ LL    +  I V +              
Sbjct  1071  AVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSL  1130

Query  456   ETE  458
             + E
Sbjct  1131  KKE  1133


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 83/220 (38%), Gaps = 10/220 (5%)

Query  251  QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
             +  TLV +L  +  +       ++  +    +     ++  G +P LV LL + ++ + 
Sbjct  713  PVWETLVEMLQCESSKRRMMAVMSLEVICLANDRYWQCILDAGTIPALVNLLKSPQIKLQ  772

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
               +  + NI T        +++AG +    +LLT+ +  +       + ++     +  
Sbjct  773  YKTVGLLSNISTHV-SIVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAK--CENK  829

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
              +  +  +P L+++LS          +  +     G    Q   +     I+ L+  L 
Sbjct  830  DVIAKYSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQ-QSMKDNNGIQYLIQFL-  887

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
            + D+ ++  +  A   I + A    E +     I + G +
Sbjct  888  SSDSDVLKALSSA--TIAEVARDNKEVQD---AIAKEGAI  922


 Score = 58.1 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/244 (16%), Positives = 81/244 (33%), Gaps = 6/244 (2%)

Query  94    LQATQAARKLLSREKQPPIDN-IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTS  152
             ++A  +    ++    P     ++    +P  +  L       I+ E A++L  I  G +
Sbjct  1069  IRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNN  1128

Query  153   EQTKAVVDGGAIPA--FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLL  210
                K + +         + LL S    +  +A +AL   A +    + L+++ G +    
Sbjct  1129  SLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLIT---  1185

Query  211   ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD  270
               +  P + S          + +  L +       +    + +  L   L+      +A 
Sbjct  1186  VSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIAL  1245

Query  271   TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV  330
             T   I+ L           V  G V +L   L A    + T    A+G +         +
Sbjct  1246  TGNIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLL  1305

Query  331   VIDA  334
             + + 
Sbjct  1306  LTEC  1309


> sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo OX=6431 PE=2 
SV=1
Length=818

 Score =  157 bits (398),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 94/454 (21%), Positives = 177/454 (39%), Gaps = 47/454 (10%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK ++S        A      LL  ++   +  +  AG + K V  L R +   + 
Sbjct  260  IPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKM-AVRLAGGLQKMVLLLQRNNLKFLA  318

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G     + ++ S   +  E+ +W    +    SV  
Sbjct  319  ITTD-CLQILAYGNQESKLIILASGGPGELVRIMRS---YTYEKLLWTTSRVLKVLSVCA  374

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G+  P + L         +   ++N  WTL NL    + A     +E +L 
Sbjct  375  SNKPAIVEAGSAGPSMHL------GHQSQRLVQNCLWTLRNL---SDAATKSSDIEGLLQ  425

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
             LV+LL  +D  ++      +S LT         V + G +  LV+  L       I  P
Sbjct  426  MLVQLLASNDINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTILQAGDREDITEP  485

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQ  367
            A+ A+ ++ +   E    Q  V +  G L V   LL  P    + K     + N+     
Sbjct  486  AVCALRHLTSRHGEAEMAQNAVRLHYG-LPVLVKLLHPPSRWPLIKAVVGLIRNLALCPA  544

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN  427
            +    +  HG +P +V +L +A   TQ+ A     N ++     ++  +V  G +  L  
Sbjct  545  NH-APLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVE-GTVGALHI  602

Query  428  LLTAKDTKIILVILDAIS-----------NIFQAA-----EKLGETEKLSIMIEECGGLD  471
            +      + ++  L+ IS           NI + A     E   + E  + MIE+ G   
Sbjct  603  MAREAHNRAVIRGLNCISLFAQLLYSPIDNIQRVAAGVLCELAADKEG-AEMIEQEGTTA  661

Query  472  KIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
             +  L +  NE V   + +++   F + E++ Q+
Sbjct  662  PLTELLHSRNEGVATYAAAVL---FRMSEDKPQD  692


 Score =  131 bits (329),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 88/444 (20%), Positives = 157/444 (35%), Gaps = 29/444 (7%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +     QA     +L  +E      
Sbjct  152  SQMLKHAVVNLINYQDDADLATRAIPELTKLLNDEDQVVVSQAAMMVHQLSKKEASR--H  209

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  +  T+       +A  L N+ S   +    +   G IPA + LL+
Sbjct  210  AIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNL-SHHRQGLLTIFKSGGIPALVKLLS  268

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ LL   ++  LA       T  
Sbjct  269  SPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAIT-----TDC  323

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHH-DDPEVLADTCWAISYLTDGPNERIGMVVK  291
            L  L      +  I         LVR++      ++L  T   +  L+         +V+
Sbjct  324  LQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSV-CASNKPAIVE  382

Query  292  TGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             G     + L G     +V   L  + N+   +D  T+     G L +   LL +   NI
Sbjct  383  AGSAGPSMHL-GHQSQRLVQNCLWTLRNL---SDAATKSSDIEGLLQMLVQLLASNDINI  438

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS-GG  408
               A   +SN+T   Q     V   G +  LV  +L   D     + AV A+ + TS  G
Sbjct  439  VTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTILQAGDREDITEPAVCALRHLTSRHG  498

Query  409  TVEQIVYLVH-CGIIEPLMNLLTAKDT-KIILVILDAISNIFQAAEKLGETEKLSIMIEE  466
              E     V     +  L+ LL       +I  ++  I N+                + E
Sbjct  499  EAEMAQNAVRLHYGLPVLVKLLHPPSRWPLIKAVVGLIRNLALCPANHAP-------LRE  551

Query  467  CGGLDKIEAL--QNHENESVYKAS  488
             G + +I  L  + H++      +
Sbjct  552  HGAIPRIVQLLIRAHQDTQRRATA  575


 Score =  101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 62/384 (16%), Positives = 126/384 (33%), Gaps = 67/384 (17%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  L+ P   +   AV  L N         D  +   A+  L  LL   D       
Sbjct  142  PTAVQRLSEPSQMLK-HAVVNLIN------YQDDADLATRAIPELTKLLNDEDQ-----V  189

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR + +  D E        +  L+    
Sbjct  190  VVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHR-  248

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            + +  + K+G +P LVKLL +    ++  A+  + N++   +     V  AG L     L
Sbjct  249  QGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLL  308

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK---------------  388
            L           T  +  +  G Q+    ++  G    LV ++                 
Sbjct  309  LQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLK  368

Query  389  --------------------------ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
                                         +  +  +W + N +   T    +     G++
Sbjct  369  VLSVCASNKPAIVEAGSAGPSMHLGHQSQRLVQNCLWTLRNLSDAATKSSDIE----GLL  424

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA--LQNHE  480
            + L+ LL + D  I+      +SN+          ++  + + + GG++ +    LQ  +
Sbjct  425  QMLVQLLASNDINIVTCAAGILSNL------TCNNQRNKVTVCQVGGIEALVRTILQAGD  478

Query  481  NESVYKASLSLIEKYFSVEEEEDQ  504
             E + + ++  +    S   E + 
Sbjct  479  REDITEPAVCALRHLTSRHGEAEM  502


> sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla OX=7673 
PE=2 SV=1
Length=820

 Score =  154 bits (388),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 91/448 (20%), Positives = 166/448 (37%), Gaps = 55/448 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  ++K ++S        A      LL  ++   +  +  AG + K V+ L R +   + 
Sbjct  253  IPALIKLLSSPVESVLFYAITTLHNLLLHQEGSKM-AVRLAGGLQKMVALLSRNNPKFLA  311

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G   A + ++ +      E+ +W    +    SV  
Sbjct  312  ITTD-CLQILAYGNQESKLIILASGGPAALVHIMRTYD---YEKLLWTTSRVLKVLSVCH  367

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        +   +   ++N  WTL NL    +     D +E +L 
Sbjct  368  NNKPAIVEAGGMSAL-----GLHLGHHSNRLVQNCLWTLRNL---SDCHRGTDDIEPLLQ  419

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG--ASELPIVTP  312
             LV+LL  +D  V+   C  +S LT   +    +V +   V  LV+ L        I  P
Sbjct  420  MLVQLLASNDINVVTCACGILSNLTCNNSRNKMIVSQMAGVEALVQTLMKAGDREEITEP  479

Query  313  ALRAIGNIVTGTD----EQTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQ  367
            A+ A+ ++ +        Q  V ++ G + V   LL  P    + K     + N+     
Sbjct  480  AVCALRHVTSRHPGAEMGQNTVRLNYG-IPVIVKLLHPPSRWPLIKATVGLIRNLALCSA  538

Query  368  DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVT-----NYTSGGTVEQIVY-------  415
            +    +   G +  LV +L +A   TQ+ +    T     NY  G  +E IV        
Sbjct  539  NH-APLREQGALHRLVQLLMRAHQDTQRRSSMGSTGSQGGNYADGVRMEDIVEGTTGALH  597

Query  416  -----------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                       +     I   + LL      I  V    +S +    EK G     + MI
Sbjct  598  ILARDSHNRALIQGLNCIPLFVQLLYNNIENIQRVAAGVLSELSL--EKQG-----AEMI  650

Query  465  EECGGLDKIEALQNHENESVYKASLSLI  492
            E+ G    +  L +  NE V   + +++
Sbjct  651  EQEGATAPLTELLHSRNEGVATYAAAVL  678


 Score =  130 bits (327),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 85/444 (19%), Positives = 157/444 (35%), Gaps = 30/444 (7%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  ++    QA     +L  +E      
Sbjct  145  SQMLKHAVVNLINYQDDADLATRAIPELTKLLNDDDLVVVNQAAMMVHQLSKKEASR--H  202

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  +  ++ +     +A  L N++   +   + +   G IPA I LL+
Sbjct  203  AIMNSPQMVAALVRAMSNSNDAETTRCAAGTLHNLSHHRAGLLQ-IFKSGGIPALIKLLS  261

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL+  +   LA       T  
Sbjct  262  SPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLSRNNPKFLAIT-----TDC  316

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  L      +  I         LV ++   D E L  T   +  +    +     +V+ 
Sbjct  317  LQILAYGNQESKLIILASGGPAALVHIMRTYDYEKLLWTTSRVLKVLSVCHNNKPAIVEA  376

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIV---TGTDEQTQVVIDAGALAVFPSLLTNPKT  349
            G +  L   LG     +V   L  + N+     GTD+          L +   LL +   
Sbjct  377  GGMSALGLHLGHHSNRLVQNCLWTLRNLSDCHRGTDDI------EPLLQMLVQLLASNDI  430

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS-  406
            N+   A   +SN+T         V     V  LV  ++   D  +  + AV A+ + TS 
Sbjct  431  NVVTCACGILSNLTCNNSRNKMIVSQMAGVEALVQTLMKAGDREEITEPAVCALRHVTSR  490

Query  407  GGTVEQIVYLVHCG-IIEPLMNLLTAKDT-KIILVILDAISNIFQAAEKLGETEKLSIMI  464
                E     V     I  ++ LL       +I   +  I N+   +            +
Sbjct  491  HPGAEMGQNTVRLNYGIPVIVKLLHPPSRWPLIKATVGLIRNLALCSANHAP-------L  543

Query  465  EECGGLDKIEALQNHENESVYKAS  488
             E G L ++  L    ++   + S
Sbjct  544  REQGALHRLVQLLMRAHQDTQRRS  567


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 54/303 (18%), Positives = 107/303 (35%), Gaps = 19/303 (6%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  L+ P   +   AV  L N         D  +   A+  L  LL   D       
Sbjct  135  PTAVQRLSEPSQMLK-HAVVNLIN------YQDDADLATRAIPELTKLLNDDD-----LV  182

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR + + +D E        +  L+    
Sbjct  183  VVNQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMSNSNDAETTRCAAGTLHNLSHHR-  241

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
              +  + K+G +P L+KLL +    ++  A+  + N++   +     V  AG L    +L
Sbjct  242  AGLLQIFKSGGIPALIKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVAL  301

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            L+          T  +  +  G Q+    ++  G    LV ++   D++   + +W  + 
Sbjct  302  LSRNNPKFLAITTDCLQILAYGNQESKLIILASGGPAALVHIMRTYDYE---KLLWTTSR  358

Query  404  YTSGGT--VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS  461
                 +        +V  G +  L   L     +++   L  + N+        + E L 
Sbjct  359  VLKVLSVCHNNKPAIVEAGGMSALGLHLGHHSNRLVQNCLWTLRNLSDCHRGTDDIEPLL  418

Query  462  IMI  464
             M+
Sbjct  419  QML  421


 Score = 43.8 bits (102),  Expect = 0.004, Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 42/119 (35%), Gaps = 15/119 (13%)

Query  77   SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI  136
             ++DIV+G            T A   L        +   +    IP FV  L   +   I
Sbjct  584  RMEDIVEG-----------TTGALHILARDSHNRALIQGLNC--IPLFVQLL-YNNIENI  629

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
            Q  +A  L+ ++    +  + +   GA      LL S +  ++  A   L  ++ D   
Sbjct  630  QRVAAGVLSELSLEK-QGAEMIEQEGATAPLTELLHSRNEGVATYAAAVLYRMSDDKPQ  687


> sp|Q8IUR7|ARMC8_HUMAN Armadillo repeat-containing protein 8 OS=Homo 
sapiens OX=9606 GN=ARMC8 PE=1 SV=2
Length=673

 Score =  152 bits (383),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 63/313 (20%), Positives = 128/313 (41%), Gaps = 25/313 (8%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            ++ R         +D IV G++ S+V+ +L A +    L SR  Q    +     +    
Sbjct  373  EDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPL  431

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            +  L       I   ++  L N+    S   + +++ GA+     L  S +  +    +W
Sbjct  432  MKVLQNAPD-EILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW  490

Query  185  ALGNIAGDGSVF-RDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKN  241
            AL N+A       +  +++  + + L  LL+  D++ L    G LRNL  T         
Sbjct  491  ALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST---------  541

Query  242  PAPPIDAV-----EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
              P ID +     +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++
Sbjct  542  -RPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDIL  600

Query  296  PQLVKLLGASELPIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             ++   +G S + +   A+  I N++     G+ E+   + D G + +   L  +P +N+
Sbjct  601  QKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNL  660

Query  352  QKEATWTMSNITA  364
              +A   +    A
Sbjct  661  CDKAKMALQQYLA  673


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 73/464 (16%), Positives = 151/464 (33%), Gaps = 54/464 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI---IRAGLIPK-FVSFLGRTDC  133
            V +I   + S + + ++QA +    L     Q  +  +   +   L+P+ FV  L R   
Sbjct  190  VQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKP  249

Query  134  SPIQFESAWALTNIASG----TSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALG-  187
              +Q  SA  LT +       T +    +     +P  + + +         +    L  
Sbjct  250  IEMQLTSAKCLTYMCRAGAIRTDDNCIVL---KTLPCLVRMCSKERLLEERVEGAETLAY  306

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY------------LRNLTWTL--  233
             I  D  + R   I    +  L      P   S                 LR   + L  
Sbjct  307  LIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYA  366

Query  234  SNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG  293
            S    +++    I   E ++  +V  L     +V       +  L+    +         
Sbjct  367  SLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQDHA  426

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            V   L+K+L  +   I+  A   + N++       + ++++GA+ +   L  +    ++ 
Sbjct  427  VWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRV  486

Query  354  EATWTMSNITAGRQDQIQQ-VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ  412
               W + N+    + +I+  ++       L  +LS +D     + +  + N  S      
Sbjct  487  NGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST-----  541

Query  413  IVYLVHCGIIEPLMNLLTAKDTKIILVILDAI-----------SNIFQAAEKLGETEKLS  461
                       P ++ + +   K I+  +  I             +   A     T    
Sbjct  542  ----------RPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKD  591

Query  462  IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            +++     L KI+    H +  +  A++  I      EEE  Q 
Sbjct  592  LIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQE  635


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 94/243 (39%), Gaps = 10/243 (4%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL  +    E+  +    +  L  G    +  ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L + +L  +   LR +  I T      +++  DA  +    +LL +   
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALL-SRSR  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA--VWAVTNYTSG  407
              Q+      S+   G   Q   + NHG V  +  +L+   +K + +A   ++V  + + 
Sbjct  162  YTQEYICQIFSHCCKGPDHQT-ILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENP  220

Query  408  GTVEQIVYLVHCGIIEP--LMNLL-TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                 +V ++  G + P   + +L   K  ++ L     ++ + +A     +   + +  
Sbjct  221  QVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT  280

Query  465  EEC  467
              C
Sbjct  281  LPC  283


 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 69/420 (16%), Positives = 150/420 (36%), Gaps = 43/420 (10%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG-R  130
              V  S    V  +   + +  LQ     +            N+I  G +P+ +  L   
Sbjct  15   SEVTASSRHYVDRLFDPDPQKVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQE  73

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            T  + ++ E A  L ++A GT    K+++D   IPA +  L SP     E  +  L  I 
Sbjct  74   TSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIF  133

Query  191  GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
                   +L+      +  L+ALL+    S     Y+  +    S+ C+  +    I   
Sbjct  134  TSPVTPEELLYTDATVIPHLMALLSR---SRYTQEYICQI---FSHCCKGPDHQT-ILFN  186

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE----RIGMVVKTGVVPQL-VKLLGA  304
               +  +  LL     +V        S L     +     + ++V   ++PQ+ VK+L  
Sbjct  187  HGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQR  246

Query  305  SEL-PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT----NIQKEATWTM  359
             +   +   + + +  +      +T    +   L   P L+           + E   T+
Sbjct  247  DKPIEMQLTSAKCLTYMCRAGAIRTDD--NCIVLKTLPCLVRMCSKERLLEERVEGAETL  304

Query  360  S----------NITAGRQDQIQQVVNHGLVPFLVSV---LSKADFKTQ-----KEAVWAV  401
            +           I +     I  + ++   P  VS    + + D   +     ++A + +
Sbjct  305  AYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL  364

Query  402  TNYTSGGTVEQIVY--LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK  459
               + G   E I    +    +++ ++  L+    K+ L  +  + ++ ++ ++L  + +
Sbjct  365  Y-ASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQ  423


> sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles 
gambiae OX=7165 GN=arm PE=3 SV=5
Length=850

 Score =  152 bits (385),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 95/461 (21%), Positives = 170/461 (37%), Gaps = 55/461 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK ++S        A      LL  +    +  +  AG + K V+ L R +   + 
Sbjct  242  IPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKM-AVRLAGGLQKMVALLQRNNVKFLA  300

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++        + ++ S      E+ +W    +    SV  
Sbjct  301  IVTD-CLQILAYGNQESKLIILASTGPSELVRIMRSYD---YEKLLWTTSRVLKVLSVCS  356

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L   L  P     +   ++N  WTL NL    + A  +D +E +L 
Sbjct  357  SNKPAIVEAGGMQALAMHLGNP-----SQRLVQNCLWTLRNL---SDAATKVDGLETLLS  408

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL--GASELPIVTP  312
             LV +L   D  V+      +S LT         V + G V  LV  +        I  P
Sbjct  409  GLVTVLGSSDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEP  468

Query  313  ALRAIGNIVTGTD--EQTQVVIDAG-ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ  369
            A+ A+ ++ +     E  Q V+  G  L V   LL  P      +A   +    A     
Sbjct  469  AVCALRHLTSRHPESESAQNVVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNLALCPAN  528

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN-------YTSGGTVEQIVY-------  415
               +  HG +  LV +L KA   TQ++     +N       Y  G  +E+IV        
Sbjct  529  AAPLREHGAIHLLVRLLFKAFQDTQRQRSSVASNGSQPPGAYADGVRMEEIVEGTVGALH  588

Query  416  -----------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                       +    +I   + LL   D + I  +   +  + + A      ++++ MI
Sbjct  589  ILAKEEYNRQVIRSQNVIPIFVQLLFYNDIENIQRVAAGV--LCELAVD----KEVAEMI  642

Query  465  EECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            E  G    +  L N  NE V   + +++   F + E++  +
Sbjct  643  EAEGATAPLTELLNSANEGVATYAAAVL---FKMSEDKSMD  680


 Score =  128 bits (323),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 83/400 (21%), Positives = 154/400 (39%), Gaps = 17/400 (4%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ +++K +N  +     QA     +L  +E      
Sbjct  134  SQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASR--H  191

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  L  ++       +   L N+ S   +   A+   G IPA + LL+
Sbjct  192  AIMNSPQMVAALVRALSNSNDLETTKGAVGTLHNL-SHHRQGLLAIFKSGGIPALVKLLS  250

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA      +T  
Sbjct  251  SPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAI-----VTDC  305

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  L      +  I         LVR++   D E L  T   +  +    +     +V+ 
Sbjct  306  LQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEA  365

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ  352
            G +  L   LG     +V   L  + N+   +D  T+V      L+   ++L +   N+ 
Sbjct  366  GGMQALAMHLGNPSQRLVQNCLWTLRNL---SDAATKVDGLETLLSGLVTVLGSSDVNVV  422

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLV-SVLSKAD-FKTQKEAVWAVTNYTS-GGT  409
              A   +SN+T   Q     V   G V  LV ++++  D  +  + AV A+ + TS    
Sbjct  423  TCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEPAVCALRHLTSRHPE  482

Query  410  VEQIVYLVHCG-IIEPLMNLLTAKDT-KIILVILDAISNI  447
             E    +V  G  +  ++ LL       +I  ++  I N+
Sbjct  483  SESAQNVVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNL  522


 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 61/300 (20%), Positives = 108/300 (36%), Gaps = 21/300 (7%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  LA P   +   AV  L N         D  +   A+  L+ LL   D       
Sbjct  124  PTAVQRLAEPSQMLK-HAVVNLIN------YQDDADLATRAIPELIKLLNDEDQ-----V  171

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR-LLHHDDPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR L + +D E        +  L+    
Sbjct  172  VVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSNSNDLETTKGAVGTLHNLSHHR-  230

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            + +  + K+G +P LVKLL +    ++  A+  + N++   D     V  AG L    +L
Sbjct  231  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVAL  290

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ---KEAVWA  400
            L           T  +  +  G Q+    ++       LV ++   D++        V  
Sbjct  291  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLK  350

Query  401  VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKL  460
            V +  S         +V  G ++ L   L     +++   L  + N+  AA K+   E L
Sbjct  351  VLSVCSSNKP----AIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLETL  406


> sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes 
aegypti OX=7159 GN=arm PE=3 SV=1
Length=832

 Score =  152 bits (384),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 95/461 (21%), Positives = 170/461 (37%), Gaps = 55/461 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK ++S        A      LL  +    +  +  AG + K V+ L R +   + 
Sbjct  242  IPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKM-AVRLAGGLQKMVALLQRNNVKFLA  300

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++        + ++ S      E+ +W    +    SV  
Sbjct  301  IVTD-CLQILAYGNQESKLIILASTGPSELVRIMRSYD---YEKLLWTTSRVLKVLSVCS  356

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L   L  P     +   ++N  WTL NL    + A  +D +E +L 
Sbjct  357  SNKPAIVEAGGMQALAMHLGNP-----SQRLVQNCLWTLRNL---SDAATKVDGLETLLS  408

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL--GASELPIVTP  312
             LV +L   D  V+      +S LT         V + G V  LV  +        I  P
Sbjct  409  GLVTVLGSSDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEP  468

Query  313  ALRAIGNIVTGTD--EQTQVVIDAG-ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ  369
            A+ A+ ++ +     E  Q ++  G  L V   LL  P      +A   +    A     
Sbjct  469  AVCALRHLTSRHPESESAQNIVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNLALCPSN  528

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN-------YTSGGTVEQIVY-------  415
               +  HG +  LV +L KA   TQ++     TN       Y  G  +E+IV        
Sbjct  529  AAPLREHGAIHLLVRLLFKAFQDTQRQRSSVATNGSQPPGAYADGVRMEEIVEGTVGALH  588

Query  416  -----------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                       +    +I   + LL   D + I  +   +  + + A      ++++ MI
Sbjct  589  ILSKEELNRQLIRQQNVISIFVQLLFYNDIENIQRVAAGV--LCELAVD----KEVAEMI  642

Query  465  EECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            E  G    +  L N  NE V   + +++   F + E++  +
Sbjct  643  EAEGATAPLTELLNSANEGVATYAAAVL---FKMSEDKSMD  680


 Score =  129 bits (324),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 83/400 (21%), Positives = 155/400 (39%), Gaps = 17/400 (4%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ +++K +N  +     QA     +L  +E      
Sbjct  134  SQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASR--H  191

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  L +++       +   L N+ S   +   A+   G IPA + LL+
Sbjct  192  AIMNSPQMVAALVRALSQSNDLETTKGAVGTLHNL-SHHRQGLLAIFKSGGIPALVKLLS  250

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ALL   ++  LA      +T  
Sbjct  251  SPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAI-----VTDC  305

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  L      +  I         LVR++   D E L  T   +  +    +     +V+ 
Sbjct  306  LQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEA  365

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ  352
            G +  L   LG     +V   L  + N+   +D  T+V      L+   ++L +   N+ 
Sbjct  366  GGMQALAMHLGNPSQRLVQNCLWTLRNL---SDAATKVDGLETLLSGLVTVLGSSDVNVV  422

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLV-SVLSKAD-FKTQKEAVWAVTNYTS-GGT  409
              A   +SN+T   Q     V   G V  LV ++++  D  +  + AV A+ + TS    
Sbjct  423  TCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEPAVCALRHLTSRHPE  482

Query  410  VEQIVYLVHCG-IIEPLMNLLTAKDT-KIILVILDAISNI  447
             E    +V  G  +  ++ LL       +I  ++  I N+
Sbjct  483  SESAQNIVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNL  522


 Score =  100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 60/300 (20%), Positives = 107/300 (36%), Gaps = 21/300 (7%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  L+ P   +   AV  L N         D  +   A+  L+ LL   D       
Sbjct  124  PTAVQRLSEPSQMLK-HAVVNLIN------YQDDADLATRAIPELIKLLNDEDQ-----V  171

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR-LLHHDDPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR L   +D E        +  L+    
Sbjct  172  VVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSQSNDLETTKGAVGTLHNLSHHR-  230

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            + +  + K+G +P LVKLL +    ++  A+  + N++   D     V  AG L    +L
Sbjct  231  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVAL  290

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ---KEAVWA  400
            L           T  +  +  G Q+    ++       LV ++   D++        V  
Sbjct  291  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLK  350

Query  401  VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKL  460
            V +  S         +V  G ++ L   L     +++   L  + N+  AA K+   E L
Sbjct  351  VLSVCSSNKP----AIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLETL  406


> sp|Q2KI54|ARMC8_BOVIN Armadillo repeat-containing protein 8 OS=Bos 
taurus OX=9913 GN=ARMC8 PE=2 SV=1
Length=673

 Score =  150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 63/300 (21%), Positives = 125/300 (42%), Gaps = 25/300 (8%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +D IV G++ S+V+ +L A +    L SR  Q    +     +    +  L       I 
Sbjct  386  MDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPLMKVLQNAPD-EIL  443

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              ++  L N+    S   + +++ GA+     L  S +  +    +WAL N+A       
Sbjct  444  VVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKI  503

Query  197  RDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKNPAPPIDAV-----  249
            +  +++  + + L  LL+  D++ L    G LRNL  T           P ID +     
Sbjct  504  KADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST----------RPHIDKIMSTHG  553

Query  250  EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP  308
            +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++ ++   +G S + 
Sbjct  554  KQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKELIMTNDDILQKIKYYMGHSHVK  613

Query  309  IVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            +   A+  I N+V     G+ E+   + D G + +   L  +P +N+  +A   +    A
Sbjct  614  LQLAAMFCISNLVWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKTALQQYLA  673


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 78/455 (17%), Positives = 155/455 (34%), Gaps = 36/455 (8%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI---IRAGLIPK-FVSFLGRTDC  133
            V +I   + S + + ++QA +    L     Q  +  +   +   L+P+ FV  L R   
Sbjct  190  VQNIAHLLTSVSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKP  249

Query  134  SPIQFESAWALTNIASG----TSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALG-  187
              +Q  SA  LT +       T +    +     +P  + + +         +    L  
Sbjct  250  IEMQLTSAKCLTYMCRAGAIRTDDNCIVL---KTLPCLVRMCSKERLLEERVEGAETLAY  306

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY------------LRNLTWTL--  233
             I  D  + R   I    +  L      P   S                 LR   + L  
Sbjct  307  LIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYA  366

Query  234  SNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG  293
            S    +++    I   E ++  +V  L     +V       +  L+    +         
Sbjct  367  SLGANDEDIRKKIIDTENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQDHA  426

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            V   L+K+L  +   I+  A   + N++       + ++++GA+ +   L  +    ++ 
Sbjct  427  VWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRV  486

Query  354  EATWTMSNITAGRQDQIQQ-VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ  412
               W + N+    + +I+  ++       L  +LS +D     + +  + N  S      
Sbjct  487  NGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHID  546

Query  413  IVYLVHCGIIEPLMNLLTAK--DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
             +   H   I   + L+     + ++    L  ++NI       G T K  IM  +   L
Sbjct  547  KIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIA-----DGTTAKELIMTND-DIL  600

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
             KI+    H +  +  A++  I      EEE  Q 
Sbjct  601  QKIKYYMGHSHVKLQLAAMFCISNLVWNEEEGSQE  635


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 94/243 (39%), Gaps = 10/243 (4%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL  +    E+  +    +  L  G    +  ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L + +L  +   LR +  I T      +++  DA  +    +LL +   
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALL-SRSR  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA--VWAVTNYTSG  407
              Q+      S+   G   Q   + NHG V  +  +L+   +K + +A   ++V  + + 
Sbjct  162  YTQEYICQIFSHCCKGPDHQT-ILFNHGAVQNIAHLLTSVSYKVRMQALKCFSVLAFENP  220

Query  408  GTVEQIVYLVHCGIIEP--LMNLL-TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                 +V ++  G + P   + +L   K  ++ L     ++ + +A     +   + +  
Sbjct  221  QVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT  280

Query  465  EEC  467
              C
Sbjct  281  LPC  283


 Score = 68.5 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 53/287 (18%), Positives = 101/287 (35%), Gaps = 18/287 (6%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG-R  130
              V  S    V  +   + +  LQ     +            N+I  G +P+ +  L   
Sbjct  15   SEVTASSRHYVDRLFDPDPQKVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQE  73

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            T  + ++ E A  L ++A GT    K+++D   IPA +  L SP     E  +  L  I 
Sbjct  74   TSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIF  133

Query  191  GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
                   +L+      +  L+ALL+    S     Y+  +    S+ C+  +    I   
Sbjct  134  TSPVTPEELLYTDATVIPHLMALLSR---SRYTQEYICQI---FSHCCKGPDHQT-ILFN  186

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE----RIGMVVKTGVVPQL-VKLLGA  304
               +  +  LL     +V        S L     +     + ++V   ++PQ+ VK+L  
Sbjct  187  HGAVQNIAHLLTSVSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQR  246

Query  305  SEL-PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
             +   +   + + +  +      +T    +   L   P L+      
Sbjct  247  DKPIEMQLTSAKCLTYMCRAGAIRTDD--NCIVLKTLPCLVRMCSKE  291


 Score = 42.7 bits (99),  Expect = 0.008, Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 63/163 (39%), Gaps = 9/163 (6%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA---GL  120
             ++        + S + + + ++ S++   ++     R LLS   +P ID I+      +
Sbjct  499  AEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLS--TRPHIDKIMSTHGKQI  556

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +      L       ++ ++   L NIA GT+ +   + +   +      +   H  +  
Sbjct  557  MQAVTLILEGEHNIEVKEQTLCILANIADGTTAKELIMTNDDILQKIKYYMGHSHVKLQL  616

Query  181  QAVWALGNIAGDGS----VFRDLVIKYGAVDPLLALLAVPDMS  219
             A++ + N+  +        +D +   G VD L  L   PD +
Sbjct  617  AAMFCISNLVWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSN  659


> sp|Q5R6S3|ARMC8_PONAB Armadillo repeat-containing protein 8 OS=Pongo 
abelii OX=9601 GN=ARMC8 PE=2 SV=1
Length=673

 Score =  150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 63/313 (20%), Positives = 127/313 (41%), Gaps = 25/313 (8%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            ++ R         +D IV G++ S+V+ +L A +    L SR  Q    +     +    
Sbjct  373  EDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPL  431

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            +  L       I   ++  L N+    S   + +++ GA+     L  S +  +    +W
Sbjct  432  MKVLQNAPD-EILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW  490

Query  185  ALGNIAGDGSVF-RDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKN  241
            AL N A       +  +++  + + L  LL+  D++ L    G LRNL  T         
Sbjct  491  ALMNTAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST---------  541

Query  242  PAPPIDAV-----EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
              P ID +     +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++
Sbjct  542  -RPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDIL  600

Query  296  PQLVKLLGASELPIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             ++   +G S + +   A+  I N++     G+ E+   + D G + +   L  +P +N+
Sbjct  601  QKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNL  660

Query  352  QKEATWTMSNITA  364
              +A   +    A
Sbjct  661  CDKAKMALQQYLA  673


 Score = 86.6 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 73/464 (16%), Positives = 150/464 (32%), Gaps = 54/464 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI---IRAGLIPK-FVSFLGRTDC  133
            V +I   + S + + ++QA +    L     Q  +  +   +   L+P+ FV  L R   
Sbjct  190  VQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKP  249

Query  134  SPIQFESAWALTNIASG----TSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALG-  187
              +Q  SA  LT +       T +    +     +P  + + +         +    L  
Sbjct  250  IEMQLTSAKCLTYMCRAGAIRTDDNCIVL---KTLPCLVRMCSKERLLEERVEGAETLAY  306

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY------------LRNLTWTL--  233
             I  D  + R   I    +  L      P   S                 LR   + L  
Sbjct  307  LIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYA  366

Query  234  SNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG  293
            S    +++    I   E ++  +V  L     +V       +  L+    +         
Sbjct  367  SLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQDHA  426

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            V   L+K+L  +   I+  A   + N++       + ++++GA+ +   L  +    ++ 
Sbjct  427  VWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRV  486

Query  354  EATWTMSNITAGRQDQIQQ-VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ  412
               W + N     + +I+  ++       L  +LS +D     + +  + N  S      
Sbjct  487  NGIWALMNTAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLST-----  541

Query  413  IVYLVHCGIIEPLMNLLTAKDTKIILVILDAI-----------SNIFQAAEKLGETEKLS  461
                       P ++ + +   K I+  +  I             +   A     T    
Sbjct  542  ----------RPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKD  591

Query  462  IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            +++     L KI+    H +  +  A++  I      EEE  Q 
Sbjct  592  LIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQE  635


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 93/243 (38%), Gaps = 10/243 (4%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL  +    E+  +    +  L  G    +  ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L + +L  +   LR    I T      +++  DA  +    +LL +   
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCPRTIFTSPVTPEELLYTDATVIPHLMALL-SRSR  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA--VWAVTNYTSG  407
              Q+      S+   G   Q   + NHG V  +  +L+   +K + +A   ++V  + + 
Sbjct  162  YTQEYICQIFSHCCKGPDHQT-ILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENP  220

Query  408  GTVEQIVYLVHCGIIEP--LMNLL-TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
                 +V ++  G + P   + +L   K  ++ L     ++ + +A     +   + +  
Sbjct  221  QVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT  280

Query  465  EEC  467
              C
Sbjct  281  LPC  283


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 68/420 (16%), Positives = 149/420 (35%), Gaps = 43/420 (10%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG-R  130
              V  S    V  +   + +  LQ     +            N+I  G +P+ +  L   
Sbjct  15   SEVTASSRHYVDRLFDPDPQKVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQE  73

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            T  + ++ E A  L ++A GT    K+++D   IPA +  L SP     E  +     I 
Sbjct  74   TSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCPRTIF  133

Query  191  GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
                   +L+      +  L+ALL+    S     Y+  +    S+ C+  +    I   
Sbjct  134  TSPVTPEELLYTDATVIPHLMALLSR---SRYTQEYICQI---FSHCCKGPDHQT-ILFN  186

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE----RIGMVVKTGVVPQL-VKLLGA  304
               +  +  LL     +V        S L     +     + ++V   ++PQ+ VK+L  
Sbjct  187  HGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQR  246

Query  305  SEL-PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT----NIQKEATWTM  359
             +   +   + + +  +      +T    +   L   P L+           + E   T+
Sbjct  247  DKPIEMQLTSAKCLTYMCRAGAIRTDD--NCIVLKTLPCLVRMCSKERLLEERVEGAETL  304

Query  360  S----------NITAGRQDQIQQVVNHGLVPFLVSV---LSKADFKTQ-----KEAVWAV  401
            +           I +     I  + ++   P  VS    + + D   +     ++A + +
Sbjct  305  AYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL  364

Query  402  TNYTSGGTVEQIVY--LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK  459
               + G   E I    +    +++ ++  L+    K+ L  +  + ++ ++ ++L  + +
Sbjct  365  Y-ASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQ  423


> sp|Q9DBR3|ARMC8_MOUSE Armadillo repeat-containing protein 8 OS=Mus 
musculus OX=10090 GN=Armc8 PE=1 SV=2
Length=673

 Score =  146 bits (368),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 63/313 (20%), Positives = 124/313 (40%), Gaps = 25/313 (8%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            ++ R         +D IV G + S+V+ +L A +    L SR  Q    +     +    
Sbjct  373  EDIRKKIIETETMMDRIVTGSSESSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPL  431

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            +  L       I   ++  L N+    S   + +++ GA+     L  S +  +    +W
Sbjct  432  MKVLQNAPD-EILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW  490

Query  185  ALGNIAGDGSVF-RDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKN  241
            AL N+A       +  +++  + + L  LL+  DM+ L    G LRNL  T         
Sbjct  491  ALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDMNVLMKTLGLLRNLLST---------  541

Query  242  PAPPIDAV-----EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
              P ID +     +QI+  +  +L      EV   T   ++ + DG   +  ++    ++
Sbjct  542  -RPHIDKIMSTHGKQIMQAVTLILEGEHSIEVKEQTLCILANIADGTTAKELIMTNDDIL  600

Query  296  PQLVKLLGASELPIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             ++   +G S + +   A+  I N+      G+ E+   + D G + +   L  +  +N+
Sbjct  601  QKIKYYMGHSHVKLQLAAMFCISNLTWNEEEGSQERQDKLRDMGIVDILHKLSQSADSNL  660

Query  352  QKEATWTMSNITA  364
              +A   +    A
Sbjct  661  CDKAKTALQQYLA  673


 Score = 86.6 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 72/461 (16%), Positives = 150/461 (33%), Gaps = 48/461 (10%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI---IRAGLIPK-FVSFLGRTDC  133
            V +I   + S + + ++QA +    L     Q  +  +   +   L+P+ FV  L R   
Sbjct  190  VQNIAHLLTSPSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKP  249

Query  134  SPIQFESAWALTNIAS-GTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALG-NIA  190
              +Q  SA  LT +   G      + +    +P  + + +         +    L   I 
Sbjct  250  IEMQLTSAKCLTYMCRAGAIRTDDSCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIE  309

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY------------LRNLTWTL--SNL  236
             D  + R   I    +  L      P   S                 LR   + L  S  
Sbjct  310  PDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLG  369

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
              +++    I   E ++  +V        +V       +  L+    +         V  
Sbjct  370  ANDEDIRKKIIETETMMDRIVTGSSESSVKVRLAAVRCLHSLSRSVQQLRTSFQDHAVWK  429

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEAT  356
             L+K+L  +   I+  A   + N++       + ++++GA+ +   L  +    ++    
Sbjct  430  PLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGI  489

Query  357  WTMSNITAGRQDQIQQ-VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
            W + N+    + +I+  ++       L  +LS +D     + +  + N  S         
Sbjct  490  WALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDMNVLMKTLGLLRNLLST--------  541

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAI-----------SNIFQAAEKLGETEKLSIMI  464
                    P ++ + +   K I+  +  I             +   A     T    +++
Sbjct  542  -------RPHIDKIMSTHGKQIMQAVTLILEGEHSIEVKEQTLCILANIADGTTAKELIM  594

Query  465  EECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
                 L KI+    H +  +  A++  I      EEE  Q 
Sbjct  595  TNDDILQKIKYYMGHSHVKLQLAAMFCISNLTWNEEEGSQE  635


 Score = 75.8 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 90/227 (40%), Gaps = 10/227 (4%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL  +    E+  +    +  L  G    +  ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLL  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L + +L  +   LR +  I T      +++  DA  +    +LL +   
Sbjct  103  DCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALL-SRSR  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA--VWAVTNYTSG  407
              Q+      S+   G   Q   + NHG V  +  +L+   +K + +A   ++V  + + 
Sbjct  162  YTQEYICQIFSHCCKGPDHQT-ILFNHGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENP  220

Query  408  GTVEQIVYLVHCGIIEP--LMNLL-TAKDTKIILVILDAISNIFQAA  451
                 +V ++  G + P   + +L   K  ++ L     ++ + +A 
Sbjct  221  QVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAG  267


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 53/287 (18%), Positives = 100/287 (35%), Gaps = 18/287 (6%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG-R  130
              V  S    V  +   + +  LQ     +            N+I  G +P+ +  L   
Sbjct  15   SEVTASSRHYVDRLFDPDPQKVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQE  73

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            T  + ++ E A  L ++A GT    K+++D   IPA +  L SP     E  +  L  I 
Sbjct  74   TSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIF  133

Query  191  GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
                   +L+      +  L+ALL+    S     Y+  +    S+ C+  +    I   
Sbjct  134  TSPVTPEELLYTDATVIPHLMALLSR---SRYTQEYICQI---FSHCCKGPDHQT-ILFN  186

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE----RIGMVVKTGVVPQL-VKLLGA  304
               +  +  LL     +V        S L     +     + ++V   ++PQ+ VK+L  
Sbjct  187  HGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQR  246

Query  305  SEL-PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
             +   +   + + +  +      +T        L   P L+      
Sbjct  247  DKPIEMQLTSAKCLTYMCRAGAIRTDD--SCIVLKTLPCLVRMCSKE  291


> sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabidopsis 
thaliana OX=3702 GN=PUB6 PE=2 SV=2
Length=771

 Score =  143 bits (361),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 49/252 (19%), Positives = 103/252 (41%), Gaps = 15/252 (6%)

Query  147  IASGTSEQTKAVVDG-GAIPAFISLLASP----HAHISEQAVWALGNIAGDGSVFRDLVI  201
            I    +E+ + ++   G + AF+  L S     +A   E    AL N+A + +  ++L++
Sbjct  450  ILLKDNEEARILMGANGFVEAFLQFLESAVHDNNAAAQETGAMALFNLAVNNNRNKELML  509

Query  202  KYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL-  260
              G +  L  +++       A     NL+      C  K  A P+    Q +   V LL 
Sbjct  510  TSGVIPLLEKMISCSQSQGPATALYLNLS------CLEK--AKPVIGSSQAVSFFVNLLL  561

Query  261  HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI  320
                 +   D   A+  L+      I  ++ + ++  L  L        +  +L  + N+
Sbjct  562  QDTKTQCKLDALHALYNLSTYSP-NIPTLLSSNIIKSLQVLASTGNHLWIEKSLAVLLNL  620

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP  380
             +  + + +++   G ++   ++L    T  Q++A   +  +  G +  IQ V+  G++P
Sbjct  621  ASSREGKEEMITTQGMISTLATVLDTGDTVEQEQAVSCLVILCTGSESCIQMVLQEGVIP  680

Query  381  FLVSVLSKADFK  392
             LVS+      +
Sbjct  681  SLVSISVNGSPR  692


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 54/317 (17%), Positives = 106/317 (33%), Gaps = 28/317 (9%)

Query  3    TNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVE-----LRKAKKDDQMLKRRNVSSFP  57
              E++   + R  + KN   D  +         +E     L    K++ + K+  V    
Sbjct  393  LEESSTIESERQQKEKNNAPDEVDS----EINVLEGYQDILAIVDKEEDLAKKCKVVENV  448

Query  58   DDATSPLQEN---RNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDN  114
                   +E        G V   +  +   ++ +N   Q     A   L         + 
Sbjct  449  RILLKDNEEARILMGANGFVEAFLQFLESAVHDNNAAAQETGAMALFNLA-VNNNRNKEL  507

Query  115  IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLAS  173
            ++ +G+IP     +    CS  Q  +     N++    E+ K V+    A+  F++LL  
Sbjct  508  MLTSGVIPLLEKMIS---CSQSQGPATALYLNLSC--LEKAKPVIGSSQAVSFFVNLLL-  561

Query  174  PHAHISEQ--AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
                   +  A+ AL N++         ++    +  L  L +  +   +          
Sbjct  562  QDTKTQCKLDALHALYNLSTYSPNI-PTLLSSNIIKSLQVLASTGNHLWIEKSLA-----  615

Query  232  TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK  291
             L NL  ++     +   + ++ TL  +L   D          +  L  G    I MV++
Sbjct  616  VLLNLASSREGKEEMITTQGMISTLATVLDTGDTVEQEQAVSCLVILCTGSESCIQMVLQ  675

Query  292  TGVVPQLVKLLGASELP  308
             GV+P LV +       
Sbjct  676  EGVIPSLVSISVNGSPR  692


> sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis 
thaliana OX=3702 GN=UPL3 PE=1 SV=1
Length=1888

 Score =  143 bits (362),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 95/472 (20%), Positives = 182/472 (39%), Gaps = 67/472 (14%)

Query  51   RNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVEN-QLQATQAARKLLSREKQ  109
            R + +  DD          +   +N  +  I+ G+ +   E  Q++A     ++LS   +
Sbjct  168  RKLGAGLDDLLPSSGIGSASSSHLNGRMKKILSGLRAEGEEGKQVEALTQLCEMLSIGTE  227

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI-  168
              +        +P  V  L       I   +A ALT++         AVV  GA+   + 
Sbjct  228  DSLSTFSVDSFVPVLVGLLNHESNPDIMLLAARALTHLCDVLPSSCAAVVHYGAVSCLVA  287

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
             LL   +  ++EQ++ AL  I+ +        ++ GA   L+A+L+  D    + G  R 
Sbjct  288  RLLTIEYMDLAEQSLQALKKISQEHPT---ACLRAGA---LMAVLSYLDF--FSTGVQRV  339

Query  229  LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG---PNER  285
               T +N+C+ K P+   D V + +P L  LL + D +VL      ++ + +      E+
Sbjct  340  ALSTAANMCK-KLPSDASDYVMEAVPLLTNLLQYHDSKVLEYASICLTRIAEAFAPYPEK  398

Query  286  IGMVVKTGVVPQLVKLLGASE-------LPIVTPA--LRAIGNIVTGTDEQTQVVIDAGA  336
            +  +   G+V Q   L+  S        L + T    +R +    +G+    + ++  G 
Sbjct  399  LDELCNHGLVTQAASLISTSNSGGGQASLSVSTYTGLIRLLSTCASGSPLGFRTLLLLGI  458

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH--GLVPFL----VSVLSKAD  390
             ++   +L     +    A  ++S   +   DQI ++VN    L+P L    +S+ +  +
Sbjct  459  SSILKDILLGSGVS----ANASVSPALSRPADQIYEIVNLANELLPPLPEGVISLPTSTN  514

Query  391  FKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
               +  +    ++ ++ G  E I+       I P   LL  +   +    LD +  + Q 
Sbjct  515  ALVKG-SCQKKSSPSTSGKQEDILK------ISPREKLLGDQPELLQQFGLDLLPVLVQI  567

Query  451  AEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK--YFSVEE  500
                                       +  N ++    LS+I K  YFS  E
Sbjct  568  Y-------------------------GSSVNGTIRHKCLSVIGKLMYFSSSE  594


> sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila 
melanogaster OX=7227 GN=arm PE=1 SV=1
Length=843

 Score =  142 bits (359),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 92/463 (20%), Positives = 180/463 (39%), Gaps = 60/463 (13%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK ++S        A      LL  +    +  +  AG + K V+ L R +   + 
Sbjct  245  IPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKM-AVRLAGGLQKMVTLLQRNNVKFLA  303

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G     + ++ S      E+ +W    +    SV  
Sbjct  304  IVTD-CLQILAYGNQESKLIILASGGPNELVRIMRSYD---YEKLLWTTSRVLKVLSVCS  359

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  ++  G +  L        + +++   ++N  WTL NL    + A  ++ +E +L 
Sbjct  360  SNKPAIVDAGGMQALAM-----HLGNMSPRLVQNCLWTLRNL---SDAATKVEGLEALLQ  411

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL--GASELPIVTP  312
            +LV++L   D  V+      +S LT         V + G V  LV+ +        I  P
Sbjct  412  SLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEP  471

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQ  367
            A+ A+ ++ +   +    Q  V ++ G L+V   LL  P    + K     + N+     
Sbjct  472  AVCALRHLTSRHVDSELAQNAVRLNYG-LSVIVKLLHPPSRWPLIKAVIGLIRNLALCPA  530

Query  368  DQIQQVVNHGLVPFLVSVLSKA--DFKTQKEAVWAV-----TNYTSGGTVEQIVY-----  415
            +    +  HG +  LV +L +A  D + Q+ ++        + Y  G  +E+IV      
Sbjct  531  NH-APLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGA  589

Query  416  -------------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
                         +    +I   + LL  +   I  V    +  +  AA+K G     + 
Sbjct  590  LHILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCEL--AADKEG-----AE  642

Query  463  MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            +IE+ G    +  L +  NE V   + +++   F + E++ Q+
Sbjct  643  IIEQEGATGPLTDLLHSRNEGVATYAAAVL---FRMSEDKPQD  682


 Score =  122 bits (305),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 80/400 (20%), Positives = 147/400 (37%), Gaps = 17/400 (4%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ +++K +N  +     QA     +L  +E      
Sbjct  137  SQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASR--H  194

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  +  ++       +   L N+ S   +   A+   G IPA + LL+
Sbjct  195  AIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNL-SHHRQGLLAIFKSGGIPALVKLLS  253

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ LL   ++  LA      +T  
Sbjct  254  SPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAI-----VTDC  308

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  L      +  I         LVR++   D E L  T   +  +    +     +V  
Sbjct  309  LQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDA  368

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ  352
            G +  L   LG     +V   L  + N+   +D  T+V      L     +L +   N+ 
Sbjct  369  GGMQALAMHLGNMSPRLVQNCLWTLRNL---SDAATKVEGLEALLQSLVQVLGSTDVNVV  425

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS-GGT  409
              A   +SN+T   Q     V   G V  LV  +++  D  +  + AV A+ + TS    
Sbjct  426  TCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLTSRHVD  485

Query  410  VEQIVYLVHCG-IIEPLMNLLTAKDT-KIILVILDAISNI  447
             E     V     +  ++ LL       +I  ++  I N+
Sbjct  486  SELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNL  525


 Score =  101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 58/293 (20%), Positives = 106/293 (36%), Gaps = 21/293 (7%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  L+ P   +   AV  L N   D        +   A+  L+ LL   D       
Sbjct  127  PTAVQRLSEPSQMLK-HAVVNLINYQDDAE------LATRAIPELIKLLNDEDQ-----V  174

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR + + +D E        +  L+    
Sbjct  175  VVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHR-  233

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            + +  + K+G +P LVKLL +    ++  A+  + N++   D     V  AG L    +L
Sbjct  234  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ---KEAVWA  400
            L           T  +  +  G Q+    ++  G    LV ++   D++        V  
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  401  VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            V +  S         +V  G ++ L   L     +++   L  + N+  AA K
Sbjct  354  VLSVCSSNKP----AIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATK  402


> sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila 
pseudoobscura pseudoobscura OX=46245 GN=arm PE=3 SV=2
Length=832

 Score =  141 bits (356),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 92/463 (20%), Positives = 180/463 (39%), Gaps = 60/463 (13%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +VK ++S        A      LL  +    +  +  AG + K V+ L R +   + 
Sbjct  245  IPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKM-AVRLAGGLQKMVTLLQRNNVKFLA  303

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G     + ++ S      E+ +W    +    SV  
Sbjct  304  IVTD-CLQILAYGNQESKLIILASGGPNELVRIMRSYD---YEKLLWTTSRVLKVLSVCS  359

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  ++  G +  L        + +++   ++N  WTL NL    + A  ++ +E +L 
Sbjct  360  SNKPAIVDAGGMQALAM-----HLGNMSPRLVQNCLWTLRNL---SDAATKVEGLEALLQ  411

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL--GASELPIVTP  312
            +LV++L   D  V+      +S LT         V + G V  LV+ +        I  P
Sbjct  412  SLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEP  471

Query  313  ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQ  367
            A+ A+ ++ +   +    Q  V ++ G L+V   LL  P    + K     + N+     
Sbjct  472  AVCALRHLTSRHVDSELAQNAVRLNYG-LSVIVKLLHPPSRWPLIKAVIGLIRNLALCPA  530

Query  368  DQIQQVVNHGLVPFLVSVLSKA--DFKTQKEAVWAV-----TNYTSGGTVEQIVY-----  415
            +    +  HG +  LV +L +A  D + Q+ ++        + Y  G  +E+IV      
Sbjct  531  NH-APLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGA  589

Query  416  -------------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
                         +    +I   + LL  +   I  V    +  +  AA+K G     + 
Sbjct  590  LHILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCEL--AADKEG-----AE  642

Query  463  MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            +IE+ G    +  L +  NE V   + +++   F + E++ Q+
Sbjct  643  IIEQEGATGPLTDLLHSRNEGVATYAAAVL---FRMSEDKPQD  682


 Score =  121 bits (304),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 80/401 (20%), Positives = 150/401 (37%), Gaps = 19/401 (5%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ +++K +N  +     QA     +L  +E      
Sbjct  137  SQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASR--H  194

Query  114  NIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  172
             I+ +  ++   V  +  ++       +   L N+ S   +   A+   G IPA + LL+
Sbjct  195  AIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNL-SHHRQGLLAIFKSGGIPALVKLLS  253

Query  173  SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
            SP   +   A+  L N+       +  V   G +  ++ LL   ++  LA      +T  
Sbjct  254  SPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAI-----VTDC  308

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  L      +  I         LVR++   D E L  T   +  +    +     +V  
Sbjct  309  LQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDA  368

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ  352
            G +  L   LG     +V   L  + N+   +D  T+V      L     +L +   N+ 
Sbjct  369  GGMQALAMHLGNMSPRLVQNCLWTLRNL---SDAATKVEGLEALLQSLVQVLGSTDVNVV  425

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVS-VLSKAD-FKTQKEAVWAVTNYTS---G  407
              A   +SN+T   Q     V   G V  LV  +++  D  +  + AV A+ + TS    
Sbjct  426  TCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLTSRHVD  485

Query  408  GTVEQIVYLVHCGIIEPLMNLLTAKDT-KIILVILDAISNI  447
              + Q    ++ G +  ++ LL       +I  ++  I N+
Sbjct  486  SELAQNAVRLNYG-LSVIVKLLHPPSRWPLIKAVIGLIRNL  525


 Score =  100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 58/293 (20%), Positives = 106/293 (36%), Gaps = 21/293 (7%)

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
            P  +  L+ P   +   AV  L N   D        +   A+  L+ LL   D       
Sbjct  127  PTAVQRLSEPSQMLK-HAVVNLINYQDDAE------LATRAIPELIKLLNDEDQ-----V  174

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPN  283
             +      +  L + +     I    Q++  LVR + + +D E        +  L+    
Sbjct  175  VVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHR-  233

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
            + +  + K+G +P LVKLL +    ++  A+  + N++   D     V  AG L    +L
Sbjct  234  QGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTL  293

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ---KEAVWA  400
            L           T  +  +  G Q+    ++  G    LV ++   D++        V  
Sbjct  294  LQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLK  353

Query  401  VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            V +  S         +V  G ++ L   L     +++   L  + N+  AA K
Sbjct  354  VLSVCSSNKP----AIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATK  402


> sp|Q68FK4|ARMC8_XENLA Armadillo repeat-containing protein 8 OS=Xenopus 
laevis OX=8355 GN=armc8 PE=2 SV=1
Length=720

 Score =  137 bits (346),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/313 (20%), Positives = 126/313 (40%), Gaps = 25/313 (8%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
            ++ R         +D IV G++ ++V+ +L A +    L SR  Q    +     +    
Sbjct  420  EDIRKKIIEAEHMMDRIVNGLSETSVKVRLAAVRCLHSL-SRSVQQLRTSFQDHAVWKPL  478

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
            +  L       I   ++  L N+    S   + +++ GA+    SL  S +  +    +W
Sbjct  479  MKVLQNAPD-DILVVASSTLCNLLLEFSPSKEPILESGAVELLCSLTLSENPALRVNGIW  537

Query  185  ALGNIA-GDGSVFRDLVIKYGAVDPLLALLAVPDMSSL--ACGYLRNLTWTLSNLCRNKN  241
            AL N+A       +  +++  + + L  LL+  D++ L    G LRNL  T         
Sbjct  538  ALMNMAFQADQKIKSDILRGLSTEQLFQLLSDSDVNVLMKTLGLLRNLLST---------  588

Query  242  PAPPIDAV-----EQILPTLVRLLH-HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV  295
              P ID +     +QI+  +  +L    + EV   T   ++ + DG   +  ++    ++
Sbjct  589  -RPHIDQIMSTHGKQIMQAVTFILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDIL  647

Query  296  PQLVKLLGASELPIVTPALRAIGNIV----TGTDEQTQVVIDAGALAVFPSLLTNPKTNI  351
             ++   +G S L +   A+  I N+      G+ E+   + + G + +   L  +   N+
Sbjct  648  QKIKYYVGHSNLKLQLAAMFCIANLTWNEEEGSQERQDKLREIGIVDILHKLSQSTDPNL  707

Query  352  QKEATWTMSNITA  364
              +A   +    A
Sbjct  708  CDKAKTALQQYFA  720


 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 84/500 (17%), Positives = 159/500 (32%), Gaps = 64/500 (13%)

Query  46   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSN--VENQLQATQAARKL  103
            Q LK  +V +F +   S    N    G +   +  I   +   +  +E QL A +    +
Sbjct  207  QALKCFSVLAFDNPQVSMTLANVLVDGEL---LPQIFAKMLQRDKPIEMQLTAAKCLTYM  263

Query  104  LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSE-QTKAVVDGG  162
                     DN I    +P  V    +     ++ E A  L  +     E Q  A +   
Sbjct  264  CRAGSIRTDDNCIVLKTLPCLVRMCSKERLLEVRVEGAETLAYLIEPDVELQRIASITDH  323

Query  163  AIPAFISLLASPHAHISEQAVWALGNI--------------------AGDGSVFRDLVIK  202
             I         P       +V A+ +I                      D S    L I 
Sbjct  324  LISMLADYFKYPS------SVSAITDIKRHQETGQPCIDPEEAEPRGTRDESQCTALSIS  377

Query  203  YGA--VDPLLALLAVPDMSSLACGY-LRNLTWTL--SNLCRNKNPAPPIDAVEQILPTLV  257
            +    +     L +      L   + LR   + L  S    +++    I   E ++  +V
Sbjct  378  HPVSQIQHDCLLTSEELDHDLKHAHELRQAAFKLYASLGANDEDIRKKIIEAEHMMDRIV  437

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
              L     +V       +  L+    +         V   L+K+L  +   I+  A   +
Sbjct  438  NGLSETSVKVRLAAVRCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDDILVVASSTL  497

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHG  377
             N++       + ++++GA+ +  SL  +    ++    W + N+      +I+  +  G
Sbjct  498  CNLLLEFSPSKEPILESGAVELLCSLTLSENPALRVNGIWALMNMAFQADQKIKSDILRG  557

Query  378  L-VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI  436
            L    L  +LS +D     + +  + N  S                 P ++ + +   K 
Sbjct  558  LSTEQLFQLLSDSDVNVLMKTLGLLRNLLST---------------RPHIDQIMSTHGKQ  602

Query  437  ILVILDAI-----------SNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVY  485
            I+  +  I             +   A     T    +++     L KI+    H N  + 
Sbjct  603  IMQAVTFILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYVGHSNLKLQ  662

Query  486  KASLSLIEKYFSVEEEEDQN  505
             A++  I      EEE  Q 
Sbjct  663  LAAMFCIANLTWNEEEGSQE  682


 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 43/245 (18%), Positives = 93/245 (38%), Gaps = 14/245 (6%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL  +    E+  +    +  L+ G    +  ++
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLSMGTENNVKSLL  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L +S+L  +   LR +  + T      +++  DA  +     LL +   
Sbjct  103  DCNIIPALLQGLLSSDLQFIEACLRCLRTVFTSPVTPVELLYTDASVIPHLM-LLLSRSI  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA-----VWAVTNY  404
              Q+      ++   G   Q   + NHG+V  +  +L+   +K + +A     V A  N 
Sbjct  162  YAQEYICQIYAHCCKGPDHQT-ILFNHGVVQNIAHLLTSVSYKVRMQALKCFSVLAFDNP  220

Query  405  TSGGTVEQIVYLVHCGIIEP-LMNLL-TAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
                T+  +  LV   ++      +L   K  ++ L     ++ + +A     +   + +
Sbjct  221  QVSMTLANV--LVDGELLPQIFAKMLQRDKPIEMQLTAAKCLTYMCRAGSIRTDDNCIVL  278

Query  463  MIEEC  467
                C
Sbjct  279  KTLPC  283


 Score = 70.0 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 73/439 (17%), Positives = 150/439 (34%), Gaps = 52/439 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +++G+ SS+++      +  R + +    P       A +IP  +  L R+     Q
Sbjct  107  IPALLQGLLSSDLQFIEACLRCLRTVFTSPVTPVELLYTDASVIPHLMLLLSRS--IYAQ  164

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
                    +   G   QT  + + G +     LL S    +  QA+     +A D     
Sbjct  165  EYICQIYAHCCKGPDHQT-ILFNHGVVQNIAHLLTSVSYKVRMQALKCFSVLAFDNPQVS  223

Query  198  DLVIKYGAVDPLLALLAVPDMSS-LACGYLRNLTWTLSNLCRNKNPAPPID-AVEQILPT  255
              +        LL  +    +               L+ +CR  +     +  V + LP 
Sbjct  224  MTLANVLVDGELLPQIFAKMLQRDKPIEMQLTAAKCLTYMCRAGSIRTDDNCIVLKTLPC  283

Query  256  LVRLLHHDD-PEVLADTCWAISYLTDGPNE--RIGMVVKTGVVPQLVKLLGASELPIVTP  312
            LVR+   +   EV  +    ++YL +   E  RI  +    ++  L              
Sbjct  284  LVRMCSKERLLEVRVEGAETLAYLIEPDVELQRIASITDH-LISMLADYFKYPS------  336

Query  313  ALRAIGNI-------------------VTGTDEQ-TQVVIDAGALAVFPSLLTN------  346
            ++ AI +I                    T  + Q T + I      +    L        
Sbjct  337  SVSAITDIKRHQETGQPCIDPEEAEPRGTRDESQCTALSISHPVSQIQHDCLLTSEELDH  396

Query  347  --PKTNIQKEATWTM-SNITAGRQDQIQQVVNHG-LVPFLVSVLSKADFKTQKEAVWAVT  402
                 +  ++A + + +++ A  +D  ++++    ++  +V+ LS+   K +  AV  + 
Sbjct  397  DLKHAHELRQAAFKLYASLGANDEDIRKKIIEAEHMMDRIVNGLSETSVKVRLAAVRCLH  456

Query  403  NYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
            +  S    +         + +PLM +L      I++V    + N+        E      
Sbjct  457  SL-SRSVQQLRTSFQDHAVWKPLMKVLQNAPDDILVVASSTLCNLLLEFSPSKEP-----  510

Query  463  MIEECGGLDKIEALQNHEN  481
             I E G ++ + +L   EN
Sbjct  511  -ILESGAVELLCSLTLSEN  528


 Score = 63.1 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 75/189 (40%), Gaps = 6/189 (3%)

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG--ASELPIVTPALRAI  317
            L   DP+ +      +     G N++   ++  G VP+L+ LL    S   + T     +
Sbjct  28   LFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVL  87

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH  376
            G++  GT+   + ++D   +      L +      +     +  +       ++ +  + 
Sbjct  88   GSLSMGTENNVKSLLDCNIIPALLQGLLSSDLQFIEACLRCLRTVFTSPVTPVELLYTDA  147

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI  436
             ++P L+ +L       Q+       +   G   + I++  + G+++ + +LLT+   K+
Sbjct  148  SVIPHLM-LLLSRSIYAQEYICQIYAHCCKGPDHQTILF--NHGVVQNIAHLLTSVSYKV  204

Query  437  ILVILDAIS  445
             +  L   S
Sbjct  205  RMQALKCFS  213


 Score = 62.7 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 59/353 (17%), Positives = 123/353 (35%), Gaps = 27/353 (8%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL-GR  130
              V  S    V  +   + +  LQ     +            N+I  G +P+ +  L   
Sbjct  15   SEVTASSRHYVDRLFDPDPQKVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQE  73

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIA  190
            T  + ++ E A  L +++ GT    K+++D   IPA +  L S      E  +  L  + 
Sbjct  74   TSSTELKTECAVVLGSLSMGTENNVKSLLDCNIIPALLQGLLSSDLQFIEACLRCLRTVF  133

Query  191  GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
                   +L+      +  L+ LL+       A  Y+  +    ++ C+  +    I   
Sbjct  134  TSPVTPVELLYTDASVIPHLMLLLSRSI---YAQEYICQI---YAHCCKGPDHQT-ILFN  186

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG----MVVKTGVVPQL-VKLLGA  304
              ++  +  LL     +V        S L     +       ++V   ++PQ+  K+L  
Sbjct  187  HGVVQNIAHLLTSVSYKVRMQALKCFSVLAFDNPQVSMTLANVLVDGELLPQIFAKMLQR  246

Query  305  SEL-PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT----NIQKEATWTM  359
             +   +   A + +  +      +T    +   L   P L+          ++ E   T+
Sbjct  247  DKPIEMQLTAAKCLTYMCRAGSIRTDD--NCIVLKTLPCLVRMCSKERLLEVRVEGAETL  304

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ  412
            + +     +  +      +   L+S+L  AD+     +V A+T+        Q
Sbjct  305  AYLIEPDVELQRI---ASITDHLISML--ADYFKYPSSVSAITDIKRHQETGQ  352


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 47/284 (17%), Positives = 99/284 (35%), Gaps = 23/284 (8%)

Query  189  IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
            + G+     +L++  GAV  LL LL      + +          L +L            
Sbjct  47   VIGNNKQKANLIV-LGAVPRLLYLLQ---QETSSTELKTECAVVLGSLSMGTENNVKSLL  102

Query  249  VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMV-VKTGVVPQLVKLLG----  303
               I+P L++ L   D + +      +  +   P   + ++     V+P L+ LL     
Sbjct  103  DCNIIPALLQGLLSSDLQFIEACLRCLRTVFTSPVTPVELLYTDASVIPHLMLLLSRSIY  162

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
            A E      A         G D QT ++ + G +     LLT+    ++ +A    S + 
Sbjct  163  AQEYICQIYAHCC-----KGPDHQT-ILFNHGVVQNIAHLLTSVSYKVRMQALKCFSVLA  216

Query  364  AGRQD----QIQQVVNHGLVPFL-VSVLS-KADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
                         +V+  L+P +   +L      + Q  A   +T     G++      +
Sbjct  217  FDNPQVSMTLANVLVDGELLPQIFAKMLQRDKPIEMQLTAAKCLTYMCRAGSIRTDDNCI  276

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS  461
                +  L+ +      +++ V ++    +    E   E ++++
Sbjct  277  VLKTLPCLVRM--CSKERLLEVRVEGAETLAYLIEPDVELQRIA  318


> sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis 
thaliana OX=3702 GN=PUB12 PE=2 SV=1
Length=654

 Score =  136 bits (342),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 50/295 (17%), Positives = 113/295 (38%), Gaps = 9/295 (3%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +++++  + S   E++  A    R L  +     +  I  +G IP  V+ L  ++ S  Q
Sbjct  357  IEELLLKLTSQQPEDRRSAAGEIRLLAKQNNHNRV-AIAASGAIPLLVNLLTISNDSRTQ  415

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +  ++ N++     + K V   GA+P  + +L        E A   L +++      +
Sbjct  416  EHAVTSILNLSICQENKGKIVYSSGAVPGIVHVLQKGSMEARENAAATLFSLSVIDEN-K  474

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +   GA+ PL+ LL+            ++    L NLC  +           ++P L+
Sbjct  475  VTIGAAGAIPPLVTLLSEGSQRG-----KKDAATALFNLCIFQGNKGKAVR-AGLVPVLM  528

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
            RLL   +  ++ ++   ++ L+  P+     V     VP LV  + +        +   +
Sbjct  529  RLLTEPESGMVDESLSILAILSSHPD-GKSEVGAADAVPVLVDFIRSGSPRNKENSAAVL  587

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
             ++ +   +        G + +   +  N     +++A   ++  +     Q Q 
Sbjct  588  VHLCSWNQQHLIEAQKLGIMDLLIEMAENGTDRGKRKAAQLLNRFSRFNDQQKQH  642


 Score =  108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/277 (18%), Positives = 107/277 (39%), Gaps = 11/277 (4%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQ  181
              +    +         +A  +  +A   +    A+   GAIP  ++LL  S  +   E 
Sbjct  360  LLLKLTSQQPEDR--RSAAGEIRLLAKQNNHNRVAIAASGAIPLLVNLLTISNDSRTQEH  417

Query  182  AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN  241
            AV ++ N++        +V   GAV  ++ +L    M +       N   TL +L    +
Sbjct  418  AVTSILNLSICQENKGKIVYSSGAVPGIVHVLQKGSMEARE-----NAAATLFSLSV-ID  471

Query  242  PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL  301
                       +P LV LL         D   A+  L      +   V + G+VP L++L
Sbjct  472  ENKVTIGAAGAIPPLVTLLSEGSQRGKKDAATALFNLCIFQGNKGKAV-RAGLVPVLMRL  530

Query  302  LGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN  361
            L   E  +V  +L  +  + +  D +++ V  A A+ V    + +     ++ +   + +
Sbjct  531  LTEPESGMVDESLSILAILSSHPDGKSE-VGAADAVPVLVDFIRSGSPRNKENSAAVLVH  589

Query  362  ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            + +  Q  + +    G++  L+ +      + +++A 
Sbjct  590  LCSWNQQHLIEAQKLGIMDLLIEMAENGTDRGKRKAA  626


 Score =  104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/269 (19%), Positives = 102/269 (38%), Gaps = 8/269 (3%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
            +   I   +  L S        A   +  +A   +  R  +   GA+  L+ LL + + S
Sbjct  353  EHNKIEELLLKLTSQQPEDRRSAAGEIRLLAKQNNHNRVAIAASGAIPLLVNLLTISNDS  412

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                  + ++   LS    NK     I      +P +V +L     E   +    +  L+
Sbjct  413  RTQEHAVTSIL-NLSICQENKG---KIVYSSGAVPGIVHVLQKGSMEARENAAATLFSLS  468

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
               +E    +   G +P LV LL          A  A+ N+      + + V  AG + V
Sbjct  469  V-IDENKVTIGAAGAIPPLVTLLSEGSQRGKKDAATALFNLCIFQGNKGKAV-RAGLVPV  526

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVW  399
               LLT P++ +  E+   ++ +++   D   +V     VP LV  +     + ++ +  
Sbjct  527  LMRLLTEPESGMVDESLSILAILSSHP-DGKSEVGAADAVPVLVDFIRSGSPRNKENSAA  585

Query  400  AVTNYTSGGTVEQIVYLVHCGIIEPLMNL  428
             + +  S    + ++     GI++ L+ +
Sbjct  586  VLVHLCSW-NQQHLIEAQKLGIMDLLIEM  613


 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 74/173 (43%), Gaps = 3/173 (2%)

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKT  349
            +   + +L+  L + +      A   I  +    +     +  +GA+ +  +LLT +  +
Sbjct  353  EHNKIEELLLKLTSQQPEDRRSAAGEIRLLAKQNNHNRVAIAASGAIPLLVNLLTISNDS  412

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
              Q+ A  ++ N++  ++++ + V + G VP +V VL K   + ++ A   + + +    
Sbjct  413  RTQEHAVTSILNLSICQENKGKIVYSSGAVPGIVHVLQKGSMEARENAAATLFSLSV--I  470

Query  410  VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
             E  V +   G I PL+ LL+    +       A+ N+       G+  +  +
Sbjct  471  DENKVTIGAAGAIPPLVTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGL  523


> sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis 
thaliana OX=3702 GN=PUB4 PE=1 SV=3
Length=826

 Score =  137 bits (344),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 53/282 (19%), Positives = 108/282 (38%), Gaps = 11/282 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + K V  L  +     Q ++   L  +A    +    + + GAI   + LL S  +   E
Sbjct  543  VKKLVEELKSSSLDT-QRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDSATQE  601

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             AV AL N++ +    +  +   GA++PL+ +L      +             S     +
Sbjct  602  NAVTALLNLSIND-NNKKAIADAGAIEPLIHVLENGSSEAKENS----AATLFSLSVIEE  656

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            N           +  LV LL +  P    D   A+  L+    E   M+V++G V  L+ 
Sbjct  657  NKIK--IGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIH-QENKAMIVQSGAVRYLID  713

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            L+      +V  A+  + N+ T  + +   +   G + +   ++       ++ A   + 
Sbjct  714  LMD-PAAGMVDKAVAVLANLATIPEGRN-AIGQEGGIPLLVEVVELGSARGKENAAAALL  771

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVT  402
             ++         V+  G VP LV++      + +++A   ++
Sbjct  772  QLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLS  813


 Score =  131 bits (330),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 65/300 (22%), Positives = 120/300 (40%), Gaps = 12/300 (4%)

Query  61   TSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL  120
            ++P  E R +   V   V  +V+ + SS+++ Q QAT   R L        I  I  +G 
Sbjct  526  SAPSNETRRDLSEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRI-VIGNSGA  584

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            I   V  L  TD +  Q  +  AL N+ S      KA+ D GAI   I +L +  +   E
Sbjct  585  IVLLVELLYSTDSAT-QENAVTALLNL-SINDNNKKAIADAGAIEPLIHVLENGSSEAKE  642

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             +   L +++      +  + + GA+ PL+ LL             ++    L NL  ++
Sbjct  643  NSAATLFSLSVIEEN-KIKIGQSGAIGPLVDLLGNG-----TPRGKKDAATALFNLSIHQ  696

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
                 I      +  L+ L+      ++      ++ L   P E    + + G +P LV+
Sbjct  697  ENKAMIVQ-SGAVRYLIDLM-DPAAGMVDKAVAVLANLATIP-EGRNAIGQEGGIPLLVE  753

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            ++          A  A+  + T +     +V+  GA+    +L  +     +++A   +S
Sbjct  754  VVELGSARGKENAAAALLQLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLS  813


 Score =  113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 55/283 (19%), Positives = 104/283 (37%), Gaps = 11/283 (4%)

Query  167  FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYL  226
             +  L S       QA   L  +A      R ++   GA+  L+ LL   D         
Sbjct  546  LVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDS-----ATQ  600

Query  227  RNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERI  286
             N    L NL  N N    I A    +  L+ +L +   E   ++   +  L+     +I
Sbjct  601  ENAVTALLNLSINDNNKKAI-ADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEENKI  659

Query  287  GMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
              + ++G +  LV LLG         A  A+ N+     E   +++ +GA+     L+  
Sbjct  660  K-IGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIH-QENKAMIVQSGAVRYLIDLMD-  716

Query  347  PKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
            P   +  +A   ++N+ A   +    +   G +P LV V+     + ++ A  A+   ++
Sbjct  717  PAAGMVDKAVAVLANL-ATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLST  775

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQ  449
                     ++  G + PL+ L  +   +        +S    
Sbjct  776  NSG-RFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRN  817


 Score =  112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 40/226 (18%), Positives = 97/226 (43%), Gaps = 8/226 (4%)

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               +  VE  +  LV  L     +        +  L     +   ++  +G +  LV+LL
Sbjct  533  RRDLSEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELL  592

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
             +++      A+ A+ N+    D   + + DAGA+     +L N  +  ++ +  T+ ++
Sbjct  593  YSTDSATQENAVTALLNLSI-NDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSL  651

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
            +   +++I+ +   G +  LV +L     + +K+A  A+ N +     E    +V  G +
Sbjct  652  SVIEENKIK-IGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIH--QENKAMIVQSGAV  708

Query  423  EPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSIMIE  465
              L++L+      ++   +  ++N+    E    +G+   + +++E
Sbjct  709  RYLIDLMD-PAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVE  753


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/208 (20%), Positives = 78/208 (38%), Gaps = 11/208 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ ++  + + + E +  +      L   E+      I ++G I   V  LG       +
Sbjct  626  IEPLIHVLENGSSEAKENSAATLFSLSVIEENKI--KIGQSGAIGPLVDLLGNG-TPRGK  682

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
             ++A AL N++    E    +V  GA+   I L+  P A + ++AV  L N+A      R
Sbjct  683  KDAATALFNLSIH-QENKAMIVQSGAVRYLIDLMD-PAAGMVDKAVAVLANLATI-PEGR  739

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
            + + + G +  L+ ++ +            N    L  L  N      +   E  +P LV
Sbjct  740  NAIGQEGGIPLLVEVVELGSARG-----KENAAAALLQLSTNSGRFCNMVLQEGAVPPLV  794

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNER  285
             L     P         +SY  +  +  
Sbjct  795  ALSQSGTPRAREKAQALLSYFRNQRHGN  822


> sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca 
domestica OX=7370 GN=arm PE=2 SV=1
Length=813

 Score =  135 bits (341),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 105/522 (20%), Positives = 189/522 (36%), Gaps = 102/522 (20%)

Query  61   TSPLQENRNNQGTVNWSVDDIVKGI-NSSNVENQLQATQAARKLLSREKQPPIDNIIRAG  119
             S  + +R+        V  +V+ I NS+++E+   A      L S  +Q  +  I ++G
Sbjct  176  LSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNL-SHHRQGLL-AIFKSG  233

Query  120  LIPKFVSFLGRTD----------------------------------CSPIQFE------  139
             IP  V  L                                       + +Q        
Sbjct  234  GIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLA  293

Query  140  -SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF--  196
                 L  +A G  E    ++  G     + ++ S      E+ +W    +    SV   
Sbjct  294  IVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYD---YEKLLWTTSRVLKVLSVCSS  350

Query  197  -RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
             +  ++  G +  L   L+ P     +   ++N  WTL NL    + A  +D +E +L +
Sbjct  351  NKPAIVDAGGMQALAMHLSNP-----SPRLVQNCLWTLRNL---SDAATKVDGLEPLLQS  402

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL--GASELPIVTPA  313
            LV++L   D  V+      +S LT         V + G V  LV+ +        I  PA
Sbjct  403  LVQVLASTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPA  462

Query  314  LRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQD  368
            + A+ ++ T   +    Q  V ++ G L+V   LL  P    + K A   + N+      
Sbjct  463  VCALRHLTTRHADSEMAQNAVRLNYG-LSVIVKLLHPPSRWPLIKAAIGLVRNLAL-CPA  520

Query  369  QIQQVVNHGLVPFLVSVLSKA--DFKTQKEAVWAVT-----NYTSGGTVEQIVY------  415
                +  HG +  LV +L +A  D + Q+ +V          Y  G  +E+IV       
Sbjct  521  NAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGAL  580

Query  416  ------------LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM  463
                        +    +I   + LL  +   I  V    +  +  AA+K G     + +
Sbjct  581  HILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCEL--AADKEG-----AEI  633

Query  464  IEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQN  505
            IE+ G    +  L +  NE V   + +++   F + E++ Q+
Sbjct  634  IEQEGATGPLTDLLHSRNEGVATYAAAVL---FRMSEDKPQD  672


 Score =  104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 138/361 (38%), Gaps = 19/361 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHI  178
             IP+ +  L   D   +  ++A  +  ++   + +         + A +  ++ S     
Sbjct  150  AIPELIKLLNDEDQVVVS-QAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLES  208

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
            ++ AV  L N++         + K G +  L+ LL+ P         L     TL NL  
Sbjct  209  TKAAVGTLHNLSHHRQGL-LAIFKSGGIPALVKLLSSPVE-----SVLFYAITTLHNLLL  262

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
            +++ +     +   L  +V LL  ++ + LA     +  L  G  E   +++ +G   +L
Sbjct  263  HQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNEL  322

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT  358
            V+++ + +   +      +  +++        ++DAG +      L+NP   + +   WT
Sbjct  323  VRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLSNPSPRLVQNCLWT  382

Query  359  MSNI--TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL  416
            + N+   A + D ++ ++       LV VL+  D      A   ++N T          +
Sbjct  383  LRNLSDAATKVDGLEPLLQS-----LVQVLASTDVNVVTCAAGILSNLTCN-NQRNKATV  436

Query  417  VHCGIIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
               G ++ L+  ++ A D + I         +     +  ++E     +    GL  I  
Sbjct  437  CQVGGVDALVRTIINAGDREEITEPAVC--ALRHLTTRHADSEMAQNAVRLNYGLSVIVK  494

Query  476  L  476
            L
Sbjct  495  L  495


> sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabidopsis 
thaliana OX=3702 GN=PUB7 PE=2 SV=1
Length=782

 Score =  135 bits (339),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 48/242 (20%), Positives = 107/242 (44%), Gaps = 15/242 (6%)

Query  162  GAIPAFISLLASP----HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            G + A +  L S     +A   +    AL N+A + +  ++L++  G +  L  +++  +
Sbjct  466  GFVEALLRFLGSAVDDNNAAAQDSGAMALFNLAVNNNRNKELMLTSGVIRLLEKMISSAE  525

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHD-DPEVLADTCWAIS  276
                A     NL+          + A  +    Q +P LV+LL  + + +   D   A+ 
Sbjct  526  SHGSATALYLNLSCL--------DEAKSVIGSSQAVPFLVQLLQKEIETQCKLDALHALY  577

Query  277  YLTDGPNERIGMVVKTGVVPQLVKLLGAS-ELPIVTPALRAIGNIVTGTDEQTQVVIDAG  335
             L+      I  ++ + ++  L  LL ++ E   +  +L  + N+ +  + + + V   G
Sbjct  578  NLSTYSP-NIPALLSSNIIKSLQGLLASTGENLWIEKSLAVLLNLASSQEGKDEAVSSQG  636

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK  395
             ++   ++L    T  Q++A   +  +  GR+  IQ V+  G++P LVS+      + ++
Sbjct  637  MISSLATVLDMGDTTEQEQAVSCLLILCNGRESCIQMVLQEGVIPSLVSISVNGTPRGRE  696

Query  396  EA  397
            ++
Sbjct  697  KS  698


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 50/288 (17%), Positives = 107/288 (37%), Gaps = 16/288 (6%)

Query  74   VNWSVDDIVKGINSSN-VENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR--  130
            V     D++  +N    +E + +  +  R LL ++ +     +   G +   + FLG   
Sbjct  421  VLERYQDLLAVLNEEEGLEKKCKVVEKIRLLL-KDDEEARIFMGANGFVEALLRFLGSAV  479

Query  131  -TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG-N  188
              + +  Q   A AL N+A   +   + ++  G I     +++S  +H    +  AL  N
Sbjct  480  DDNNAAAQDSGAMALFNLAVNNNRNKELMLTSGVIRLLEKMISSAESH---GSATALYLN  536

Query  189  IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA  248
            ++      + ++    AV  L+ LL     +      L      L NL       P + +
Sbjct  537  LSCLDEA-KSVIGSSQAVPFLVQLLQKEIETQCKLDALH----ALYNLSTYSPNIPALLS  591

Query  249  VEQILPTLVRLLHHDDPEV-LADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASEL  307
               I+ +L  LL      + +  +   +  L      +   V   G++  L  +L   + 
Sbjct  592  -SNIIKSLQGLLASTGENLWIEKSLAVLLNLASSQEGKDEAVSSQGMISSLATVLDMGDT  650

Query  308  PIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
                 A+  +  +  G +   Q+V+  G +    S+  N     ++++
Sbjct  651  TEQEQAVSCLLILCNGRESCIQMVLQEGVIPSLVSISVNGTPRGREKS  698


> sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza 
sativa subsp. japonica OX=39947 GN=PUB12 PE=2 SV=1
Length=611

 Score =  130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 63/340 (19%), Positives = 122/340 (36%), Gaps = 28/340 (8%)

Query  32   IEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVE  91
                +EL K K++ +  K    S +                     +  ++  + S N +
Sbjct  296  EANGIELPKNKQNSRDKKAAKSSDYDHAG-----------------LVSLMNRLRSGNQD  338

Query  92   NQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGT  151
             Q  A    R L  R     I  I  AG IP  V+ L  +D    Q  +  AL N++   
Sbjct  339  EQRAAAGEIRLLAKRNVNNRI-CIAEAGAIPLLVNLLSSSD-PRTQEHAVTALLNLSIH-  395

Query  152  SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLA  211
                 ++VD  AIP  + +L +      E A   L +++      +  +   GA+ PL+ 
Sbjct  396  ENNKASIVDSHAIPKIVEVLKTGSMETRENAAATLFSLSVVDEN-KVTIGAAGAIPPLIN  454

Query  212  LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT  271
            LL        +    ++    + NLC  +           I+  L+  L      ++ + 
Sbjct  455  LLCDG-----SPRGKKDAATAIFNLCIYQGNKVRAVK-AGIVIHLMNFLVDPTGGMIDEA  508

Query  272  CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV  331
               +S L   P  +I ++ ++  +P LV+++          A   +  + +   EQT   
Sbjct  509  LSLLSILAGNPEGKI-VIARSEPIPPLVEVIKTGSPRNRENAAAILWLLCSADTEQTLAA  567

Query  332  IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
              AG       L        +++A+  +  +    +D ++
Sbjct  568  KAAGVEDALKELSETGTDRAKRKASSILELMHQANEDSLK  607


 Score =  121 bits (303),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/281 (19%), Positives = 104/281 (37%), Gaps = 11/281 (4%)

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA  176
             AGL+        R+     Q  +A  +  +A         + + GAIP  ++LL+S   
Sbjct  322  HAGLVSLMNRL--RSGNQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPLLVNLLSSSDP  379

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
               E AV AL N++      +  ++   A+  ++ +L    M +       N   TL +L
Sbjct  380  RTQEHAVTALLNLSIH-ENNKASIVDSHAIPKIVEVLKTGSMETRE-----NAAATLFSL  433

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
                +           +P L+ LL    P    D   AI  L      ++  V K G+V 
Sbjct  434  SV-VDENKVTIGAAGAIPPLINLLCDGSPRGKKDAATAIFNLCIYQGNKVRAV-KAGIVI  491

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEAT  356
             L+  L      ++  AL ++ +I+ G  E   V+  +  +     ++       ++ A 
Sbjct  492  HLMNFLVDPTGGMIDEAL-SLLSILAGNPEGKIVIARSEPIPPLVEVIKTGSPRNRENAA  550

Query  357  WTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
              +  + +   +Q       G+   L  +      + +++A
Sbjct  551  AILWLLCSADTEQTLAAKAAGVEDALKELSETGTDRAKRKA  591


 Score =  113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/231 (20%), Positives = 91/231 (39%), Gaps = 7/231 (3%)

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
            R+K  A   D     L +L+  L   + +        I  L          + + G +P 
Sbjct  310  RDKKAAKSSDYDHAGLVSLMNRLRSGNQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPL  369

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV LL +S+      A+ A+ N+    +     ++D+ A+     +L       ++ A  
Sbjct  370  LVNLLSSSDPRTQEHAVTALLNLSIH-ENNKASIVDSHAIPKIVEVLKTGSMETRENAAA  428

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ +++    +    +   G +P L+++L     + +K+A  A+ N       +  V  V
Sbjct  429  TLFSLSV-VDENKVTIGAAGAIPPLINLLCDGSPRGKKDAATAIFNLCIYQGNK--VRAV  485

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE---KLGETEKLSIMIE  465
              GI+  LMN L      +I   L  +S +    E    +  +E +  ++E
Sbjct  486  KAGIVIHLMNFLVDPTGGMIDEALSLLSILAGNPEGKIVIARSEPIPPLVE  536


 Score =  101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 57/300 (19%), Positives = 104/300 (35%), Gaps = 11/300 (4%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
              G +   ++ L S +      A   +  +A      R  + + GA+  L+ LL+  D  
Sbjct  322  HAGLVS-LMNRLRSGNQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPLLVNLLSSSD--  378

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                    +    L NL  ++N    I      +P +V +L     E   +    +  L+
Sbjct  379  ---PRTQEHAVTALLNLSIHENNKASIVD-SHAIPKIVEVLKTGSMETRENAAATLFSLS  434

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
               +E    +   G +P L+ LL          A  AI N+      + + V  AG +  
Sbjct  435  V-VDENKVTIGAAGAIPPLINLLCDGSPRGKKDAATAIFNLCIYQGNKVRAV-KAGIVIH  492

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVW  399
              + L +P   +  EA   +S I AG  +    +     +P LV V+     + ++ A  
Sbjct  493  LMNFLVDPTGGMIDEALSLLS-ILAGNPEGKIVIARSEPIPPLVEVIKTGSPRNRENAA-  550

Query  400  AVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK  459
            A+         EQ +     G+ + L  L      +        +  + QA E   +   
Sbjct  551  AILWLLCSADTEQTLAAKAAGVEDALKELSETGTDRAKRKASSILELMHQANEDSLKGNG  610


 Score = 90.8 bits (224),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 61/291 (21%), Positives = 100/291 (34%), Gaps = 24/291 (8%)

Query  27   MRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGIN  86
            M R R     E R A  + ++L +RNV++    A +              ++  +V  ++
Sbjct  329  MNRLRSGNQDEQRAAAGEIRLLAKRNVNNRICIAEA-------------GAIPLLVNLLS  375

Query  87   SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTN  146
            SS+   Q  A  A   L   E      +I+ +  IPK V  L        +  +A  L +
Sbjct  376  SSDPRTQEHAVTALLNLSIHENNKA--SIVDSHAIPKIVEVLKTGSMET-RENAAATLFS  432

Query  147  IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV  206
            + S   E    +   GAIP  I+LL        + A  A+ N+       +   +K G V
Sbjct  433  L-SVVDENKVTIGAAGAIPPLINLLCDGSPRGKKDAATAIFNL-CIYQGNKVRAVKAGIV  490

Query  207  DPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPE  266
              L+  L  P       G +      LS L         + A  + +P LV ++    P 
Sbjct  491  IHLMNFLVDP-----TGGMIDEALSLLSILA-GNPEGKIVIARSEPIPPLVEVIKTGSPR  544

Query  267  VLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
               +    +  L     E+       GV   L +L           A   +
Sbjct  545  NRENAAAILWLLCSADTEQTLAAKAAGVEDALKELSETGTDRAKRKASSIL  595


> sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis 
thaliana OX=3702 GN=PUB2 PE=2 SV=1
Length=707

 Score =  130 bits (327),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 112/277 (40%), Gaps = 10/277 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            + K +  L  +     Q E+   +  +A  +++    +    AIP+ +SLL S    I  
Sbjct  423  VKKLIDDLKSSSLDT-QREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQA  481

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             AV  L N++ +    + L+ + GA+ PL+ +L    +         N   TL +L   +
Sbjct  482  DAVTCLLNLSIND-NNKSLIAESGAIVPLIHVLKTGYLEEAKA----NSAATLFSLSVIE  536

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
                 I      +  LV LL         D   A+  L+   +E    V++ G V  LV+
Sbjct  537  EYKTEI-GEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIH-HENKTKVIEAGAVRYLVE  594

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            L+      +V  A+  + N+ T  + +   + + G + V   ++       ++ AT  + 
Sbjct  595  LMD-PAFGMVEKAVVVLANLATVREGKI-AIGEEGGIPVLVEVVELGSARGKENATAALL  652

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
             +          V+  G++P LV++      + +++A
Sbjct  653  QLCTHSPKFCNNVIREGVIPPLVALTKSGTARGKEKA  689


 Score =  115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 71/373 (19%), Positives = 142/373 (38%), Gaps = 35/373 (9%)

Query  19   NKGKDSTEMRR--RRIEVNVELR-----KAKKDDQMLKRRNVSSFPDDATSPLQEN----  67
            ++  D+ E+R+   R      +      K K+++     R+++        P + +    
Sbjct  344  SESLDAEELRQVFSRSASAPGIVSEVVCKTKRNNNAAADRSLTRSNTPWKFPEERHWRHP  403

Query  68   ---------RNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA  118
                       +  ++   V  ++  + SS+++ Q +AT   R L  R        I R 
Sbjct  404  GIIPATVRETGSSSSIETEVKKLIDDLKSSSLDTQREATARIRILA-RNSTDNRIVIARC  462

Query  119  GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH-AH  177
              IP  VS L  TD   IQ ++   L N+ S        + + GAI   I +L + +   
Sbjct  463  EAIPSLVSLLYSTD-ERIQADAVTCLLNL-SINDNNKSLIAESGAIVPLIHVLKTGYLEE  520

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL-  236
                +   L +++     ++  + + GA++PL+ LL      S +    ++    L NL 
Sbjct  521  AKANSAATLFSLSVI-EEYKTEIGEAGAIEPLVDLL-----GSGSLSGKKDAATALFNLS  574

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
              ++N    I+A    +  LV L+      V       ++ L      +I  + + G +P
Sbjct  575  IHHENKTKVIEA--GAVRYLVELMDPAFGMVEKAVV-VLANLATVREGKI-AIGEEGGIP  630

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEAT  356
             LV+++          A  A+  + T + +    VI  G +    +L  +     +++A 
Sbjct  631  VLVEVVELGSARGKENATAALLQLCTHSPKFCNNVIREGVIPPLVALTKSGTARGKEKAQ  690

Query  357  WTMSNITAGRQDQ  369
              +    A RQ  
Sbjct  691  NLLKYFKAHRQSN  703


 Score =  110 bits (274),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 57/265 (22%), Positives = 111/265 (42%), Gaps = 10/265 (4%)

Query  167  FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYL  226
             I  L S       +A   +  +A + +  R ++ +  A+  L++LL   D         
Sbjct  426  LIDDLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDE-----RIQ  480

Query  227  RNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERI  286
             +    L NL  N N    I     I+P +  L      E  A++   +  L+     + 
Sbjct  481  ADAVTCLLNLSINDNNKSLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKT  540

Query  287  GMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
              + + G +  LV LLG+  L     A  A+ N+    + +T+ VI+AGA+     L+  
Sbjct  541  E-IGEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTK-VIEAGAVRYLVELMD-  597

Query  347  PKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
            P   + ++A   ++N+   R+ +I  +   G +P LV V+     + ++ A  A+    +
Sbjct  598  PAFGMVEKAVVVLANLATVREGKI-AIGEEGGIPVLVEVVELGSARGKENATAALLQLCT  656

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTA  431
              + +    ++  G+I PL+ L  +
Sbjct  657  H-SPKFCNNVIREGVIPPLVALTKS  680


 Score =  105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/238 (19%), Positives = 100/238 (42%), Gaps = 7/238 (3%)

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
            D+ S +    R  T  +  L RN      + A  + +P+LV LL+  D  + AD    + 
Sbjct  429  DLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQADAVTCLL  488

Query  277  YLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRAIGNIVTGTDEQTQVVIDAG  335
             L+   +    ++ ++G +  L+ +L           +   + ++    + +T+ + +AG
Sbjct  489  NLSI-NDNNKSLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKTE-IGEAG  546

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK  395
            A+     LL +   + +K+A   + N++    +   +V+  G V +LV ++  A F   +
Sbjct  547  AIEPLVDLLGSGSLSGKKDAATALFNLSIHH-ENKTKVIEAGAVRYLVELMDPA-FGMVE  604

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            +AV  + N  +    E  + +   G I  L+ ++     +       A+  +   + K
Sbjct  605  KAVVVLANLAT--VREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPK  660


 Score = 64.6 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/162 (19%), Positives = 61/162 (38%), Gaps = 15/162 (9%)

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
              +    + +  +T+       +      L +   + Q+EAT  +  +     D    + 
Sbjct  408  ATVRETGSSSSIETE-------VKKLIDDLKSSSLDTQREATARIRILARNSTDNRIVIA  460

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
                +P LVS+L   D + Q +AV  + N +     + +  +   G I PL+++L     
Sbjct  461  RCEAIPSLVSLLYSTDERIQADAVTCLLNLSINDNNKSL--IAESGAIVPLIHVLKTGYL  518

Query  435  KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
            +      +A +N       L   E+    I E G ++ +  L
Sbjct  519  E------EAKANSAATLFSLSVIEEYKTEIGEAGAIEPLVDL  554


> sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis OX=8355 
GN=jup PE=2 SV=1
Length=738

 Score =  125 bits (314),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 69/459 (15%), Positives = 147/459 (32%), Gaps = 90/459 (20%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +V+ ++S        A      LL  ++   +  +  A  + K V  L + +   + 
Sbjct  224  IPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKM-AVRLADGLQKMVPLLNKNNPKFLA  282

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF-  196
              +   L  +A G  E    ++  G     + ++ + +    E+ +W    +    SV  
Sbjct  283  ITTD-CLQLLAYGNQESKLIILGNGGPQGLVQIMRNYN---YEKLLWTTSRVLKVLSVCP  338

Query  197  --RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              +  +++ G +  L        ++S +   ++N  WTL NL    + A   + ++ +L 
Sbjct  339  SNKPAIVEAGGMQAL-----GKHLTSNSPRLVQNCLWTLRNL---SDVATKQEGLDNVLK  390

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP  312
             LV  L  DD  VL      +S LT        +V ++  V  L+   L  + +  I  P
Sbjct  391  ILVNQLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESLIHTILRASDKDDIAEP  450

Query  313  ALRAIGNIVTGTDE---------------------------------------------Q  327
            A+ A+ ++ +   +                                              
Sbjct  451  AVCAMRHLTSRHQDAEVAQNSVRLHYGIPAIVKLLNPPYQWPLVKATIGLIRNLALCPAN  510

Query  328  TQVVIDAGALAVFPSLLTNPKTNIQKEATW---------------------TMSNITAGR  366
               + DAG +     LL     + Q+ A                        +  +    
Sbjct  511  HAPLYDAGVIPRLVQLLVKSHQDAQRHAASGTQQPYTDGVKMEEIVEGCTGALHILARDP  570

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLM  426
             +++  +     +P  V +L       Q+ +   +         E    +   G   PLM
Sbjct  571  VNRMD-IYKLNTIPLFVQLLYSPVENIQRVSSGVLCELAQD--KEAADTIDAEGASAPLM  627

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIE  465
             LL +++  I       +   F+ +E      +  + +E
Sbjct  628  ELLHSRNEGIATYAAAVL---FRISEDKNADYRKRVSVE  663


 Score =  113 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 75/459 (16%), Positives = 152/459 (33%), Gaps = 56/459 (12%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            S     A   L   +++      ++ ++ K +N  +    +         LS+++     
Sbjct  116  SQMLKSAIMHLINYQDDAELATRAIPELTKLLNDEDPMV-VNKASMIVNQLSKKEASRKA  174

Query  114  NIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS  173
             +    ++   V  +  T        +   L N+ S   E   ++   G IPA + +L+S
Sbjct  175  LMQSPQIVAAIVRTMQHTSDMDTARCTTSILHNL-SHHREGLLSIFKSGGIPALVRMLSS  233

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD----------------  217
            P   +   A+  L N+       +  V     +  ++ LL   +                
Sbjct  234  PVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAY  293

Query  218  -MSSLACGYLRN-----------------LTWTLSNLCRNKNPAP---PIDAVEQILPTL  256
                     L N                 L WT S + +  +  P   P       +  L
Sbjct  294  GNQESKLIILGNGGPQGLVQIMRNYNYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL  353

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             + L  + P ++ +  W +  L+D   ++ G+     V+  LV  L + ++ ++T A   
Sbjct  354  GKHLTSNSPRLVQNCLWTLRNLSDVATKQEGL---DNVLKILVNQLSSDDVNVLTCATGT  410

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPS--LLTNPKTNIQKEATWTMSNITAGRQDQIQQ--  372
            + N+         +V  +  +       L  + K +I + A   M ++T+  QD      
Sbjct  411  LSNLTCNNGRNKTLVTQSNGVESLIHTILRASDKDDIAEPAVCAMRHLTSRHQDAEVAQN  470

Query  373  -VVNHGLVPFLVSVLSKA-DFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
             V  H  +P +V +L+    +   K  +  + N          +Y    G+I  L+ LL 
Sbjct  471  SVRLHYGIPAIVKLLNPPYQWPLVKATIGLIRNLALCPANHAPLY--DAGVIPRLVQLLV  528

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG  469
                             +    K+ E      ++E C G
Sbjct  529  KSHQDAQRHAASGTQQPYTDGVKMEE------IVEGCTG  561


 Score =  100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 68/365 (19%), Positives = 134/365 (37%), Gaps = 26/365 (7%)

Query  85   INSSNVENQLQATQAARKLLSREKQPPIDNIIR--------AGLIPKFVSFLGRTDCSPI  136
            + S+ +E Q    Q   +  S+  +  I ++I            IP+    L   D   +
Sbjct  97   LFSTQIEGQQTNVQKLAE-PSQMLKSAIMHLINYQDDAELATRAIPELTKLLNDEDPMVV  155

Query  137  QFESAWALTNIASGTSEQTKAVVDG-GAIPAFISLLAS-PHAHISEQAVWALGNIAGDGS  194
                A  + N  S      KA++     + A +  +        +      L N++    
Sbjct  156  --NKASMIVNQLSKKEASRKALMQSPQIVAAIVRTMQHTSDMDTARCTTSILHNLSHHRE  213

Query  195  VFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
                 + K G +  L+ +L+ P         L     TL NL   +  A     +   L 
Sbjct  214  GL-LSIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLLLYQEGAKMAVRLADGLQ  267

Query  255  TLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPAL  314
             +V LL+ ++P+ LA T   +  L  G  E   +++  G    LV+++       +    
Sbjct  268  KMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILGNGGPQGLVQIMRNYNYEKLLWTT  327

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
              +  +++        +++AG +      LT+    + +   WT+ N+        Q+ +
Sbjct  328  SRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNL--SDVATKQEGL  385

Query  375  NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS-GGTVEQIVYLVHCGIIEPLMN-LLTAK  432
            +  ++  LV+ LS  D      A   ++N T   G  + +V       +E L++ +L A 
Sbjct  386  D-NVLKILVNQLSSDDVNVLTCATGTLSNLTCNNGRNKTLVT--QSNGVESLIHTILRAS  442

Query  433  DTKII  437
            D   I
Sbjct  443  DKDDI  447


 Score = 68.1 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 54/302 (18%), Positives = 99/302 (33%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  ++  +  +V  ++S +V     AT     L     +         G+   
Sbjct  375  LSDVATKQEGLDNVLKILVNQLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESL  434

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L  +D   I   +  A+ ++ S   +    Q    +  G IPA + LL  P+   +
Sbjct  435  IHTILRASDKDDIAEPAVCAMRHLTSRHQDAEVAQNSVRLHYG-IPAIVKLLNPPYQWPL  493

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         +   G +  L+ LL             R+          
Sbjct  494  VKATIGLIRNLAL-CPANHAPLYDAGVIPRLVQLLVKSHQD-----AQRHAAS-------  540

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V+               E++     A+  L   P  R+  + K   +P  
Sbjct  541  -GTQQPYTDGVKM-------------EEIVEGCTGALHILARDPVNRMD-IYKLNTIPLF  585

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +    I   +   +  +    D++    IDA GA A    LL +    I   A  
Sbjct  586  VQLLYSPVENIQRVSSGVLCELAQ--DKEAADTIDAEGASAPLMELLHSRNEGIATYAAA  643

Query  358  TM  359
             +
Sbjct  644  VL  645


 Score = 60.0 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 65/180 (36%), Gaps = 9/180 (5%)

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK-ADFKTQ  394
            A+     LL +    +  +A+  ++ ++     +   + +  +V  +V  +   +D  T 
Sbjct  139  AIPELTKLLNDEDPMVVNKASMIVNQLSKKEASRKALMQSPQIVAAIVRTMQHTSDMDTA  198

Query  395  KEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKL  454
            +     + N +     E ++ +   G I  L+ +L++    ++   +  + N+       
Sbjct  199  RCTTSILHNLSHH--REGLLSIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLL-----  251

Query  455  GETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEG  514
               E   + +    GL K+  L N  N      +   ++      +E    ++     +G
Sbjct  252  -YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILGNGGPQG  310


> sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza 
sativa subsp. japonica OX=39947 GN=SPL11 PE=1 SV=2
Length=694

 Score =  121 bits (304),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 59/311 (19%), Positives = 119/311 (38%), Gaps = 15/311 (5%)

Query  52   NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPP  111
            N    P  +T P +       +   ++D ++  + S + E Q  A    R L  R     
Sbjct  343  NGMEPPKRSTQPNKPTPACSSSERANIDALLSKLCSPDTEEQRSAAAELRLLAKRNANNR  402

Query  112  IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL  171
            I  I  AG IP  +S    +     Q  +  AL N++    +   +++  GA+P+ + +L
Sbjct  403  I-CIAEAGAIPLLLSL-LSSSDLRTQEHAVTALLNLSIH-EDNKASIISSGAVPSIVHVL  459

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             +      E A   L +++     ++  +   GA+  L+ LL             ++   
Sbjct  460  KNGSMEARENAAATLFSLSVIDE-YKVTIGGMGAIPALVVLLGEGSQRG-----KKDAAA  513

Query  232  TLSNLC-RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVV  290
             L NLC    N    I A   ++P ++ L+ +    ++ +    +S L+  P E    + 
Sbjct  514  ALFNLCIYQGNKGRAIRA--GLVPLIMGLVTNPTGALMDEAMAILSILSSHP-EGKAAIG  570

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV--VIDAGALAVFPSLLTNPK  348
                VP LV+++G+        A   + ++ +G      +    + G +     L  N  
Sbjct  571  AAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNGT  630

Query  349  TNIQKEATWTM  359
               +++A   +
Sbjct  631  DRGKRKAVQLL  641


 Score =  103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 58/280 (21%), Positives = 110/280 (39%), Gaps = 12/280 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            I   +S L   D    Q  +A  L  +A   +     + + GAIP  +SLL+S      E
Sbjct  369  IDALLSKLCSPDTEE-QRSAAAELRLLAKRNANNRICIAEAGAIPLLLSLLSSSDLRTQE  427

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             AV AL N++      +  +I  GAV  ++ +L    M +       N   TL +L    
Sbjct  428  HAVTALLNLSIH-EDNKASIISSGAVPSIVHVLKNGSMEARE-----NAAATLFSLSV-I  480

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +           +P LV LL         D   A+  L      +   + + G+VP ++ 
Sbjct  481  DEYKVTIGGMGAIPALVVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAI-RAGLVPLIMG  539

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            L+      ++  A+ AI +I++   E    +  A  + V   ++ +     ++ A   M 
Sbjct  540  LVTNPTGALMDEAM-AILSILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVML  598

Query  361  NITAGRQD--QIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            ++ +G      + +    G++  L  +      + +++AV
Sbjct  599  HLCSGEHHLVHLARAQECGIMVPLRELALNGTDRGKRKAV  638


 Score = 95.8 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/288 (19%), Positives = 108/288 (38%), Gaps = 10/288 (3%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            I A +S L SP       A   L  +A   +  R  + + GA+        +  +SS   
Sbjct  369  IDALLSKLCSPDTEEQRSAAAELRLLAKRNANNRICIAEAGAIPL-----LLSLLSSSDL  423

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
                +    L NL  +++    I +    +P++V +L +   E   +    +  L+    
Sbjct  424  RTQEHAVTALLNLSIHEDNKASIIS-SGAVPSIVHVLKNGSMEARENAAATLFSLSVIDE  482

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
             ++  +   G +P LV LLG         A  A+ N+      + +  I AG + +   L
Sbjct  483  YKV-TIGGMGAIPALVVLLGEGSQRGKKDAAAALFNLCIYQGNKGR-AIRAGLVPLIMGL  540

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            +TNP   +  EA   + +I +   +    +     VP LV ++     + ++ A   + +
Sbjct  541  VTNPTGALMDEA-MAILSILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLH  599

Query  404  YTSGGTV-EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
              SG      +     CGI+ PL  L      +     +  +  + + 
Sbjct  600  LCSGEHHLVHLARAQECGIMVPLRELALNGTDRGKRKAVQLLERMSRF  647


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/116 (19%), Positives = 49/116 (42%), Gaps = 2/116 (2%)

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE  396
            +    S L +P T  Q+ A   +  +     +    +   G +P L+S+LS +D +TQ+ 
Sbjct  369  IDALLSKLCSPDTEEQRSAAAELRLLAKRNANNRICIAEAGAIPLLLSLLSSSDLRTQEH  428

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE  452
            AV A+ N +     +    ++  G +  ++++L     +        + ++    E
Sbjct  429  AVTALLNLSIHE--DNKASIISSGAVPSIVHVLKNGSMEARENAAATLFSLSVIDE  482


> sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa 
subsp. indica OX=39946 GN=SPL11 PE=1 SV=2
Length=694

 Score =  121 bits (304),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 59/311 (19%), Positives = 119/311 (38%), Gaps = 15/311 (5%)

Query  52   NVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPP  111
            N    P  +T P +       +   ++D ++  + S + E Q  A    R L  R     
Sbjct  343  NGMEPPKRSTQPNKPTPACSSSERANIDALLSKLCSPDTEEQRSAAAELRLLAKRNANNR  402

Query  112  IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL  171
            I  I  AG IP  +S    +     Q  +  AL N++    +   +++  GA+P+ + +L
Sbjct  403  I-CIAEAGAIPLLLSL-LSSSDLRTQEHAVTALLNLSIH-EDNKASIISSGAVPSIVHVL  459

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             +      E A   L +++     ++  +   GA+  L+ LL             ++   
Sbjct  460  KNGSMEARENAAATLFSLSVIDE-YKVTIGGMGAIPALVVLLGEGSQRG-----KKDAAA  513

Query  232  TLSNLC-RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVV  290
             L NLC    N    I A   ++P ++ L+ +    ++ +    +S L+  P E    + 
Sbjct  514  ALFNLCIYQGNKGRAIRA--GLVPLIMGLVTNPTGALMDEAMAILSILSSHP-EGKAAIG  570

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV--VIDAGALAVFPSLLTNPK  348
                VP LV+++G+        A   + ++ +G      +    + G +     L  N  
Sbjct  571  AAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNGT  630

Query  349  TNIQKEATWTM  359
               +++A   +
Sbjct  631  DRGKRKAVQLL  641


 Score =  103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 58/280 (21%), Positives = 110/280 (39%), Gaps = 12/280 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            I   +S L   D    Q  +A  L  +A   +     + + GAIP  +SLL+S      E
Sbjct  369  IDALLSKLCSPDTEE-QRSAAAELRLLAKRNANNRICIAEAGAIPLLLSLLSSSDLRTQE  427

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             AV AL N++      +  +I  GAV  ++ +L    M +       N   TL +L    
Sbjct  428  HAVTALLNLSIH-EDNKASIISSGAVPSIVHVLKNGSMEARE-----NAAATLFSLSV-I  480

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
            +           +P LV LL         D   A+  L      +   + + G+VP ++ 
Sbjct  481  DEYKVTIGGMGAIPALVVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAI-RAGLVPLIMG  539

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            L+      ++  A+ AI +I++   E    +  A  + V   ++ +     ++ A   M 
Sbjct  540  LVTNPTGALMDEAM-AILSILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVML  598

Query  361  NITAGRQD--QIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            ++ +G      + +    G++  L  +      + +++AV
Sbjct  599  HLCSGEHHLVHLARAQECGIMVPLRELALNGTDRGKRKAV  638


 Score = 95.8 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/288 (19%), Positives = 108/288 (38%), Gaps = 10/288 (3%)

Query  164  IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLAC  223
            I A +S L SP       A   L  +A   +  R  + + GA+        +  +SS   
Sbjct  369  IDALLSKLCSPDTEEQRSAAAELRLLAKRNANNRICIAEAGAIPL-----LLSLLSSSDL  423

Query  224  GYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
                +    L NL  +++    I +    +P++V +L +   E   +    +  L+    
Sbjct  424  RTQEHAVTALLNLSIHEDNKASIIS-SGAVPSIVHVLKNGSMEARENAAATLFSLSVIDE  482

Query  284  ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
             ++  +   G +P LV LLG         A  A+ N+      + +  I AG + +   L
Sbjct  483  YKV-TIGGMGAIPALVVLLGEGSQRGKKDAAAALFNLCIYQGNKGR-AIRAGLVPLIMGL  540

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
            +TNP   +  EA   + +I +   +    +     VP LV ++     + ++ A   + +
Sbjct  541  VTNPTGALMDEA-MAILSILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLH  599

Query  404  YTSGGTV-EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
              SG      +     CGI+ PL  L      +     +  +  + + 
Sbjct  600  LCSGEHHLVHLARAQECGIMVPLRELALNGTDRGKRKAVQLLERMSRF  647


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/116 (19%), Positives = 49/116 (42%), Gaps = 2/116 (2%)

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE  396
            +    S L +P T  Q+ A   +  +     +    +   G +P L+S+LS +D +TQ+ 
Sbjct  369  IDALLSKLCSPDTEEQRSAAAELRLLAKRNANNRICIAEAGAIPLLLSLLSSSDLRTQEH  428

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE  452
            AV A+ N +     +    ++  G +  ++++L     +        + ++    E
Sbjct  429  AVTALLNLSIHE--DNKASIISSGAVPSIVHVLKNGSMEARENAAATLFSLSVIDE  482


> sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis 
thaliana OX=3702 GN=PUB3 PE=2 SV=2
Length=760

 Score =  120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/282 (19%), Positives = 113/282 (40%), Gaps = 10/282 (4%)

Query  123  KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQA  182
            K V  L       ++  +A  + ++   + E    +   GAI   +SLL S      E A
Sbjct  476  KLVEDLKSGSN-KVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHA  534

Query  183  VWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNP  242
            V AL N++    + + ++++ GA++PL+ +L              N   +L +L   +  
Sbjct  535  VTALLNLSI-SELNKAMIVEVGAIEPLVHVLNTG-----NDRAKENSAASLFSLSVLQVN  588

Query  243  APPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
               I      +  LV LL         D   A+  L+   ++    +V+   V  LV+LL
Sbjct  589  RERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSI-THDNKARIVQAKAVKYLVELL  647

Query  303  GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
               +L +V  A+  + N+ +   E  Q ++  G + +    +       ++ A   +  +
Sbjct  648  D-PDLEMVDKAVALLANL-SAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQL  705

Query  363  TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY  404
                      V+  G +P LV++      + +++A   ++++
Sbjct  706  CLNSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHF  747


 Score =  102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 88/197 (45%), Gaps = 4/197 (2%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            LV  L     +V       I +LT    E    + + G +  L+ LL + E      A+ 
Sbjct  477  LVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAVT  536

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
            A+ N+   ++    ++++ GA+     +L       ++ +  ++ +++  + ++ +   +
Sbjct  537  ALLNLSI-SELNKAMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQS  595

Query  376  HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK  435
            +  +  LV++L K  F+ +K+A  A+ N +   T +    +V    ++ L+ LL   D +
Sbjct  596  NAAIQALVNLLGKGTFRGKKDAASALFNLSI--THDNKARIVQAKAVKYLVELLD-PDLE  652

Query  436  IILVILDAISNIFQAAE  452
            ++   +  ++N+    E
Sbjct  653  MVDKAVALLANLSAVGE  669


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/283 (18%), Positives = 105/283 (37%), Gaps = 10/283 (4%)

Query  167  FISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYL  226
             +  L S    +   A   + ++  +    R  + + GA+ PLL+LL   +  +      
Sbjct  477  LVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV-  535

Query  227  RNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERI  286
                  LS    NK     +      +  LV +L+  +     ++  ++  L+     R 
Sbjct  536  -TALLNLSISELNK----AMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRE  590

Query  287  GMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
             +      +  LV LLG         A  A+ N+    D + + ++ A A+     LL  
Sbjct  591  RIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKAR-IVQAKAVKYLVELLD-  648

Query  347  PKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
            P   +  +A   ++N++A  + + Q +V  G +P LV  +     + ++ A   +     
Sbjct  649  PDLEMVDKAVALLANLSAVGEGR-QAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCL  707

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQ  449
              + +    ++  G I PL+ L  +   +        +S+   
Sbjct  708  N-SPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRN  749


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/127 (17%), Positives = 50/127 (39%), Gaps = 2/127 (2%)

Query  339  VFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
                 L +    ++  A   + ++T    +    +   G +  L+S+L   +  TQ+ AV
Sbjct  476  KLVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  535

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+ N +     +    +V  G IEPL+++L   + +       ++ ++           
Sbjct  536  TALLNLSISELNK--AMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIG  593

Query  459  KLSIMIE  465
            + +  I+
Sbjct  594  QSNAAIQ  600


> sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum 
OX=44689 GN=aarA PE=2 SV=1
Length=757

 Score =  120 bits (302),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 69/391 (18%), Positives = 138/391 (35%), Gaps = 28/391 (7%)

Query  86   NSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT-DCSPIQFESAWAL  144
             S+    Q +        L  +     D    +G I K +  +        I  E+ + L
Sbjct  374  WSNPTSFQSKMILCYIDRLPTDNYKNFDKSDESGQIKKIIGVMNENLHNPMILRETCYIL  433

Query  145  TNIA---SGTSEQTKAVVDGGAIPAFIS-LLASP-HAHISEQAVWALGNIAGDGSVFRDL  199
              ++       E    +   G I   +  +   P  A + E A  ALGN+  D      L
Sbjct  434  KRLSYRQRKEDEHESLIARYGGISLILQAMKNHPYDAGVQEDACGALGNLTCDSPNNMGL  493

Query  200  --------VIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ  251
                    V++ G +  +L  +    M+    G   N ++ L NL RN + +    A+E 
Sbjct  494  YSNDNYLSVVEQGGIQLILQAMKNHMMN---PGVQYNTSFVLRNLARN-DVSESRVAIEG  549

Query  252  ILPTLVRLL--HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG-ASELP  308
             + ++   +  H +   +    C A+  L    + ++    + G+   L  +   +S   
Sbjct  550  GIQSIATAMKNHPNHIGIQTQGCGALRNLGCNDSNKVLSAKEGGIGLILRAMRSFSSHPD  609

Query  309  IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPK-TNIQKEATWTMSNITAGRQ  367
            +      A+ N+    D +  +    G   V  ++  +P   ++Q E    + N+    +
Sbjct  610  LQLNGCGALRNLARNEDNKNMISRQNGIQLVLGAMSNHPDDPDVQDEGCAALINLAYQDE  669

Query  368  DQIQQVVNHGLVPFLVSVLSKADFK--TQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPL  425
               + +   G +  ++  +    F    Q +   A+ N +     +  + +   G IE L
Sbjct  670  ANEETIAREGGINLILKAMRNHPFHSGVQMQGRGALKNLSCNPKNK--LTIARSGGIE-L  726

Query  426  MNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
            MN+            L+ +S I Q A + G 
Sbjct  727  MNIAMQNHPNFANRFLE-LSRILQVALEDGN  756


 Score =  110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/286 (17%), Positives = 101/286 (35%), Gaps = 26/286 (9%)

Query  81   IVKGINSSNVE---NQLQATQAARKLLSREKQ-------PPIDNIIRAGLIPKFVSFLGR  130
            ++     ++      Q  A  A   L                 +++  G I   +  +  
Sbjct  458  LILQAMKNHPYDAGVQEDACGALGNLTCDSPNNMGLYSNDNYLSVVEQGGIQLILQAMKN  517

Query  131  TD-CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP-HAHISEQAVWALGN  188
                  +Q+ +++ L N+A     +++  ++GG      ++   P H  I  Q   AL N
Sbjct  518  HMMNPGVQYNTSFVLRNLARNDVSESRVAIEGGIQSIATAMKNHPNHIGIQTQGCGALRN  577

Query  189  IAGDGSVFRDLVIKYGAVDPLLALL----AVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
            +  + S  + L  K G +  +L  +    + PD+    CG LRNL     N    KN   
Sbjct  578  LGCNDSN-KVLSAKEGGIGLILRAMRSFSSHPDLQLNGCGALRNLARNEDN----KNMIS  632

Query  245  PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ-LVKLLG  303
              + ++ +L  +    H DDP+V  + C A+  L          + + G +   L  +  
Sbjct  633  RQNGIQLVLGAMSN--HPDDPDVQDEGCAALINLAYQDEANEETIAREGGINLILKAMRN  690

Query  304  AS-ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPK  348
                  +      A+ N+     +    +  +G + +    + N  
Sbjct  691  HPFHSGVQMQGRGALKNLSC-NPKNKLTIARSGGIELMNIAMQNHP  735


> sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa OX=9823 
GN=Jup PE=2 SV=1
Length=745

 Score =  120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 87/495 (18%), Positives = 170/495 (34%), Gaps = 94/495 (19%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT---------  131
            +V+ + +++  +  + T +    LS  ++  +  I ++G IP  V  L            
Sbjct  189  VVRTMQNTSDLDTARCTTSILHNLSHHREGLL-AIFKSGGIPALVRMLSSPVESVLFYAI  247

Query  132  --------------------------------DCSPIQFESAWALTNIASGTSEQTKAVV  159
                                            +       +   L  +A G  E    ++
Sbjct  248  TTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIIL  307

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVP  216
              G   A + ++ +      E+ +W    +    SV    +  +++ G +  L       
Sbjct  308  ANGGPQALVQIMRNYS---YEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GK  359

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             ++S +   ++N  WTL NL    + A   + +E +L  LV  L  DD  VL      +S
Sbjct  360  HLTSNSPRLVQNCLWTLRNL---SDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLS  416

Query  277  YLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQV  330
             LT   ++   +V +   V  L+   L    +  I  PA+ A+ ++ +   E    Q  V
Sbjct  417  NLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSV  476

Query  331  VIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA  389
             ++ G +     LL  P    + K     + N+     +    +    ++P LV +L KA
Sbjct  477  RLNYG-IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEASVIPRLVQLLVKA  534

Query  390  DFKTQKE-AVWAVTNYTSGGTVEQIV------------------YLVHCGIIEPLMNLLT  430
                Q+  A      YT G  +E+IV                   +     I   + LL 
Sbjct  535  HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY  594

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            +    I  V    +  + Q  E           I+  G    +  L +  NE     + +
Sbjct  595  SSVENIQRVAAGVLCELAQDKEAAD-------AIDAEGASSPLMELLHSRNEGTATYAAA  647

Query  491  LIEKYFSVEEEEDQN  505
            ++   F + E+++ +
Sbjct  648  VL---FRISEDKNPD  659


 Score = 93.5 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 62/362 (17%), Positives = 128/362 (35%), Gaps = 44/362 (12%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSR-EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
              +V+ + + + E  L  T    K+LS      P   I+ AG +      L       +Q
Sbjct  313  QALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKP--AIVEAGGMQALGKHLTSNSPRLVQ  370

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
                W L N++   +   +  ++   +   ++ L+    ++   A   L N+  + S  +
Sbjct  371  -NCLWTLRNLSDVAT--KQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNK  426

Query  198  DLVIKYGAVDPLLALLAVP----DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ--  251
             LV +   V+ L+  +       D++  A   LR+LT       R+       ++V    
Sbjct  427  TLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTS------RHPEAEMAQNSVRLNY  480

Query  252  ILPTLVRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
             +P +V+LL+  +   ++  T   I  L   P      + +  V+P+LV+LL  +     
Sbjct  481  GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEASVIPRLVQLLVKAHQDAQ  539

Query  311  TP---------------------ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT  349
                                      A+ +I+         +     + +F  LL +   
Sbjct  540  RHVAAGTQQPYTDGVRMEEIVEGCTGAL-HILARDPMNRMEIFRLNTIPLFVQLLYSSVE  598

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
            NIQ+ A   +  + A  ++    +   G    L+ +L   +  T   A   +   +    
Sbjct  599  NIQRVAAGVLCEL-AQDKEAADAIDAEGASSPLMELLHSRNEGTATYAAAVLFRISEDKN  657

Query  410  VE  411
             +
Sbjct  658  PD  659


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 69/381 (18%), Positives = 137/381 (36%), Gaps = 20/381 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLA-SPHAH  177
             +P+    L   D   +   +   + N  S      +A++     + A +  +  +    
Sbjct  143  ALPELTKLLNDEDPVVVTKAA--MIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD  200

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
             +      L N++         + K G +  L+ +L+ P         L     TL NL 
Sbjct  201  TARCTTSILHNLSHHREGL-LAIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLL  254

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              +  A     +   L  +V LL+ ++P+ LA T   +  L  G  E   +++  G    
Sbjct  255  LYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQA  314

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV+++       +      +  +++        +++AG +      LT+    + +   W
Sbjct  315  LVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLW  374

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ N+        Q+ +   ++  LV+ LS  D      A   ++N T   +      LV
Sbjct  375  TLRNL--SDVATKQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKN--KTLV  429

Query  418  HCG-IIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 +E L++ +L A D   I         +     +  E E     +    G+  I  
Sbjct  430  TQNSGVEALIHAILRAGDKDDITEPAVC--ALRHLTSRHPEAEMAQNSVRLNYGIPAIVK  487

Query  476  LQNHENE-SVYKASLSLIEKY  495
            L N  N+  + KA++ LI   
Sbjct  488  LLNQPNQWPLVKATIGLIRNL  508


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 52/302 (17%), Positives = 96/302 (32%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  +   +  +V  ++  +V     AT     L     +        +G+   
Sbjct  379  LSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEAL  438

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L   D   I   +  AL ++ S   E    Q    ++ G IPA + LL  P+   +
Sbjct  439  IHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG-IPAIVKLLNQPNQWPL  497

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         + +   +  L+ LL      +                  
Sbjct  498  VKATIGLIRNLAL-CPANHAPLQEASVIPRLVQLLVKAHQDAQRHVAAGT----------  546

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V                E++     A+  L   P  R+  + +   +P  
Sbjct  547  ---QQPYTDGVRM-------------EEIVEGCTGALHILARDPMNRME-IFRLNTIPLF  589

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +S   I   A   +  +    D++    IDA GA +    LL +        A  
Sbjct  590  VQLLYSSVENIQRVAAGVLCELAQ--DKEAADAIDAEGASSPLMELLHSRNEGTATYAAA  647

Query  358  TM  359
             +
Sbjct  648  VL  649


 Score = 65.0 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 49/225 (22%), Positives = 73/225 (32%), Gaps = 36/225 (16%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT-QAARKLLSREKQPPIDNIIRAGLI  121
            P  E   N   +N+ +  IVK +N  N    ++AT    R L           +  A +I
Sbjct  467  PEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAP--LQEASVI  524

Query  122  PKFVSFLGRTDCSPIQFE---------------------SAWALTNIASGTSEQTKAVVD  160
            P+ V  L +      Q                          AL  +A         +  
Sbjct  525  PRLVQLLVKA-HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR-DPMNRMEIFR  582

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
               IP F+ LL S   +I   A   L  +A D     D +   GA  PL+ LL   +  +
Sbjct  583  LNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEA-ADAIDAEGASSPLMELLHSRNEGT  641

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
                        L  +  +KNP    D  +++   L   L   DP
Sbjct  642  ATY-----AAAVLFRISEDKNP----DYRKRVSVELTNSLFKHDP  677


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 68/196 (35%), Gaps = 9/196 (5%)

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            IV   + Q    +   AL     LL +    +  +A   ++ ++     +   + +  LV
Sbjct  127  IVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLV  186

Query  380  PFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
              +V  +   +D  T +     + N +     E ++ +   G I  L+ +L++    ++ 
Sbjct  187  AAVVRTMQNTSDLDTARCTTSILHNLSHH--REGLLAIFKSGGIPALVRMLSSPVESVLF  244

Query  439  VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
              +  + N+          E   + +    GL K+  L N  N      +   ++     
Sbjct  245  YAITTLHNLLL------YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYG  298

Query  499  EEEEDQNVVPETTSEG  514
             +E    ++     + 
Sbjct  299  NQESKLIILANGGPQA  314


> sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 
GN=JUP PE=1 SV=3
Length=745

 Score =  120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 87/495 (18%), Positives = 170/495 (34%), Gaps = 94/495 (19%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT---------  131
            +V+ + +++  +  + T +    LS  ++  +  I ++G IP  V  L            
Sbjct  189  VVRTMQNTSDLDTARCTTSILHNLSHHREGLL-AIFKSGGIPALVRMLSSPVESVLFYAI  247

Query  132  --------------------------------DCSPIQFESAWALTNIASGTSEQTKAVV  159
                                            +       +   L  +A G  E    ++
Sbjct  248  TTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIIL  307

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVP  216
              G   A + ++ +      E+ +W    +    SV    +  +++ G +  L       
Sbjct  308  ANGGPQALVQIMRNYS---YEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GK  359

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             ++S +   ++N  WTL NL    + A   + +E +L  LV  L  DD  VL      +S
Sbjct  360  HLTSNSPRLVQNCLWTLRNL---SDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLS  416

Query  277  YLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQV  330
             LT   ++   +V +   V  L+   L    +  I  PA+ A+ ++ +   E    Q  V
Sbjct  417  NLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSV  476

Query  331  VIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA  389
             ++ G +     LL  P    + K     + N+     +    +    ++P LV +L KA
Sbjct  477  RLNYG-IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKA  534

Query  390  DFKTQKE-AVWAVTNYTSGGTVEQIV------------------YLVHCGIIEPLMNLLT  430
                Q+  A      YT G  +E+IV                   +     I   + LL 
Sbjct  535  HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY  594

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            +    I  V    +  + Q  E           I+  G    +  L +  NE     + +
Sbjct  595  SSVENIQRVAAGVLCELAQDKEAAD-------AIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  491  LIEKYFSVEEEEDQN  505
            ++   F + E+++ +
Sbjct  648  VL---FRISEDKNPD  659


 Score = 93.5 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 62/362 (17%), Positives = 128/362 (35%), Gaps = 44/362 (12%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSR-EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
              +V+ + + + E  L  T    K+LS      P   I+ AG +      L       +Q
Sbjct  313  QALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKP--AIVEAGGMQALGKHLTSNSPRLVQ  370

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
                W L N++   +   +  ++   +   ++ L+    ++   A   L N+  + S  +
Sbjct  371  -NCLWTLRNLSDVAT--KQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNK  426

Query  198  DLVIKYGAVDPLLALLAVP----DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ--  251
             LV +   V+ L+  +       D++  A   LR+LT       R+       ++V    
Sbjct  427  TLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTS------RHPEAEMAQNSVRLNY  480

Query  252  ILPTLVRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
             +P +V+LL+  +   ++  T   I  L   P      + +  V+P+LV+LL  +     
Sbjct  481  GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKAHQDAQ  539

Query  311  TP---------------------ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT  349
                                      A+ +I+         +     + +F  LL +   
Sbjct  540  RHVAAGTQQPYTDGVRMEEIVEGCTGAL-HILARDPMNRMEIFRLNTIPLFVQLLYSSVE  598

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
            NIQ+ A   +  + A  ++    +   G    L+ +L   +  T   A   +   +    
Sbjct  599  NIQRVAAGVLCEL-AQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKN  657

Query  410  VE  411
             +
Sbjct  658  PD  659


 Score = 90.8 bits (224),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 69/381 (18%), Positives = 137/381 (36%), Gaps = 20/381 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLA-SPHAH  177
             +P+    L   D   +   +   + N  S      +A++     + A +  +  +    
Sbjct  143  ALPELTKLLNDEDPVVVTKAA--MIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD  200

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
             +      L N++         + K G +  L+ +L+ P         L     TL NL 
Sbjct  201  TARCTTSILHNLSHHREGL-LAIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLL  254

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              +  A     +   L  +V LL+ ++P+ LA T   +  L  G  E   +++  G    
Sbjct  255  LYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQA  314

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV+++       +      +  +++        +++AG +      LT+    + +   W
Sbjct  315  LVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLW  374

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ N+        Q+ +   ++  LV+ LS  D      A   ++N T   +      LV
Sbjct  375  TLRNL--SDVATKQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKN--KTLV  429

Query  418  HCG-IIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 +E L++ +L A D   I         +     +  E E     +    G+  I  
Sbjct  430  TQNSGVEALIHAILRAGDKDDITEPAVC--ALRHLTSRHPEAEMAQNSVRLNYGIPAIVK  487

Query  476  LQNHENE-SVYKASLSLIEKY  495
            L N  N+  + KA++ LI   
Sbjct  488  LLNQPNQWPLVKATIGLIRNL  508


 Score = 65.0 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 53/302 (18%), Positives = 96/302 (32%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  +   +  +V  ++  +V     AT     L     +        +G+   
Sbjct  379  LSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEAL  438

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L   D   I   +  AL ++ S   E    Q    ++ G IPA + LL  P+   +
Sbjct  439  IHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG-IPAIVKLLNQPNQWPL  497

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         + +   +  L+ LL      +                  
Sbjct  498  VKATIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGT----------  546

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V                E++     A+  L   P  R+  + +   +P  
Sbjct  547  ---QQPYTDGVRM-------------EEIVEGCTGALHILARDPMNRME-IFRLNTIPLF  589

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +S   I   A   +  +    D++    IDA GA A    LL +        A  
Sbjct  590  VQLLYSSVENIQRVAAGVLCELAQ--DKEAADAIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  358  TM  359
             +
Sbjct  648  VL  649


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 49/225 (22%), Positives = 73/225 (32%), Gaps = 36/225 (16%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT-QAARKLLSREKQPPIDNIIRAGLI  121
            P  E   N   +N+ +  IVK +N  N    ++AT    R L           +  A +I
Sbjct  467  PEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAP--LQEAAVI  524

Query  122  PKFVSFLGRTDCSPIQFE---------------------SAWALTNIASGTSEQTKAVVD  160
            P+ V  L +      Q                          AL  +A         +  
Sbjct  525  PRLVQLLVKA-HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR-DPMNRMEIFR  582

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
               IP F+ LL S   +I   A   L  +A D     D +   GA  PL+ LL   +  +
Sbjct  583  LNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEA-ADAIDAEGASAPLMELLHSRNEGT  641

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
                        L  +  +KNP    D  +++   L   L   DP
Sbjct  642  ATY-----AAAVLFRISEDKNP----DYRKRVSVELTNSLFKHDP  677


 Score = 59.6 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 68/196 (35%), Gaps = 9/196 (5%)

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            IV   + Q    +   AL     LL +    +  +A   ++ ++     +   + +  LV
Sbjct  127  IVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLV  186

Query  380  PFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
              +V  +   +D  T +     + N +     E ++ +   G I  L+ +L++    ++ 
Sbjct  187  AAVVRTMQNTSDLDTARCTTSILHNLSHH--REGLLAIFKSGGIPALVRMLSSPVESVLF  244

Query  439  VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
              +  + N+          E   + +    GL K+  L N  N      +   ++     
Sbjct  245  YAITTLHNLLL------YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYG  298

Query  499  EEEEDQNVVPETTSEG  514
             +E    ++     + 
Sbjct  299  NQESKLIILANGGPQA  314


> sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus OX=9913 
GN=JUP PE=2 SV=1
Length=745

 Score =  120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 87/495 (18%), Positives = 170/495 (34%), Gaps = 94/495 (19%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT---------  131
            +V+ + +++  +  + T +    LS  ++  +  I ++G IP  V  L            
Sbjct  189  VVRTMQNTSDLDTARCTTSILHNLSHHREGLL-AIFKSGGIPALVRMLSSPVESVLFYAI  247

Query  132  --------------------------------DCSPIQFESAWALTNIASGTSEQTKAVV  159
                                            +       +   L  +A G  E    ++
Sbjct  248  TTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIIL  307

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVP  216
              G   A + ++ +      E+ +W    +    SV    +  +++ G +  L       
Sbjct  308  ANGGPQALVQIMRNYS---YEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GK  359

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             ++S +   ++N  WTL NL    + A   + +E +L  LV  L  DD  VL      +S
Sbjct  360  HLTSNSPRLVQNCLWTLRNL---SDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLS  416

Query  277  YLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQV  330
             LT   ++   +V +   V  L+   L    +  I  PA+ A+ ++ +   E    Q  V
Sbjct  417  NLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSV  476

Query  331  VIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA  389
             ++ G +     LL  P    + K     + N+     +    +    ++P LV +L KA
Sbjct  477  RLNYG-IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKA  534

Query  390  DFKTQKE-AVWAVTNYTSGGTVEQIV------------------YLVHCGIIEPLMNLLT  430
                Q+  A      YT G  +E+IV                   +     I   + LL 
Sbjct  535  HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY  594

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            +    I  V    +  + Q  E           I+  G    +  L +  NE     + +
Sbjct  595  SSVENIQRVAAGVLCELAQDKEAAD-------AIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  491  LIEKYFSVEEEEDQN  505
            ++   F + E+++ +
Sbjct  648  VL---FRISEDKNPD  659


 Score = 93.5 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 62/362 (17%), Positives = 128/362 (35%), Gaps = 44/362 (12%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSR-EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
              +V+ + + + E  L  T    K+LS      P   I+ AG +      L       +Q
Sbjct  313  QALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKP--AIVEAGGMQALGKHLTSNSPRLVQ  370

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
                W L N++   +   +  ++   +   ++ L+    ++   A   L N+  + S  +
Sbjct  371  -NCLWTLRNLSDVAT--KQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNK  426

Query  198  DLVIKYGAVDPLLALLAVP----DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ--  251
             LV +   V+ L+  +       D++  A   LR+LT       R+       ++V    
Sbjct  427  TLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTS------RHPEAEMAQNSVRLNY  480

Query  252  ILPTLVRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV  310
             +P +V+LL+  +   ++  T   I  L   P      + +  V+P+LV+LL  +     
Sbjct  481  GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKAHQDAQ  539

Query  311  TP---------------------ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT  349
                                      A+ +I+         +     + +F  LL +   
Sbjct  540  RHVAAGTQQPYTDGVRMEEIVEGCTGAL-HILARDPMNRMEIFRLNTIPLFVQLLYSSVE  598

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
            NIQ+ A   +  + A  ++    +   G    L+ +L   +  T   A   +   +    
Sbjct  599  NIQRVAAGVLCEL-AQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKN  657

Query  410  VE  411
             +
Sbjct  658  PD  659


 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 69/381 (18%), Positives = 137/381 (36%), Gaps = 20/381 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLA-SPHAH  177
             +P+    L   D   +   +   + N  S      +A++     + A +  +  +    
Sbjct  143  ALPELTKLLNDEDPVVVTKAA--MIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD  200

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
             +      L N++         + K G +  L+ +L+ P         L     TL NL 
Sbjct  201  TARCTTSILHNLSHHREGL-LAIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLL  254

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              +  A     +   L  +V LL+ ++P+ LA T   +  L  G  E   +++  G    
Sbjct  255  LYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQA  314

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV+++       +      +  +++        +++AG +      LT+    + +   W
Sbjct  315  LVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLW  374

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ N+        Q+ +   ++  LV+ LS  D      A   ++N T   +      LV
Sbjct  375  TLRNL--SDVATKQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKN--KTLV  429

Query  418  HCG-IIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 +E L++ +L A D   I         +     +  E E     +    G+  I  
Sbjct  430  TQNSGVEALIHAILRAGDKDDITEPAVC--ALRHLTSRHPEAEMAQNSVRLNYGIPAIVK  487

Query  476  LQNHENE-SVYKASLSLIEKY  495
            L N  N+  + KA++ LI   
Sbjct  488  LLNQPNQWPLVKATIGLIRNL  508


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 53/302 (18%), Positives = 96/302 (32%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  +   +  +V  ++  +V     AT     L     +        +G+   
Sbjct  379  LSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEAL  438

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L   D   I   +  AL ++ S   E    Q    ++ G IPA + LL  P+   +
Sbjct  439  IHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG-IPAIVKLLNQPNQWPL  497

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         + +   +  L+ LL      +                  
Sbjct  498  VKATIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGT----------  546

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V                E++     A+  L   P  R+  + +   +P  
Sbjct  547  ---QQPYTDGVRM-------------EEIVEGCTGALHILARDPMNRME-IFRLNTIPLF  589

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +S   I   A   +  +    D++    IDA GA A    LL +        A  
Sbjct  590  VQLLYSSVENIQRVAAGVLCELAQ--DKEAADAIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  358  TM  359
             +
Sbjct  648  VL  649


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 49/225 (22%), Positives = 73/225 (32%), Gaps = 36/225 (16%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT-QAARKLLSREKQPPIDNIIRAGLI  121
            P  E   N   +N+ +  IVK +N  N    ++AT    R L           +  A +I
Sbjct  467  PEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAP--LQEAAVI  524

Query  122  PKFVSFLGRTDCSPIQFE---------------------SAWALTNIASGTSEQTKAVVD  160
            P+ V  L +      Q                          AL  +A         +  
Sbjct  525  PRLVQLLVKA-HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR-DPMNRMEIFR  582

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
               IP F+ LL S   +I   A   L  +A D     D +   GA  PL+ LL   +  +
Sbjct  583  LNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEA-ADAIDAEGASAPLMELLHSRNEGT  641

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
                        L  +  +KNP    D  +++   L   L   DP
Sbjct  642  ATY-----AAAVLFRISEDKNP----DYRKRVSVELTNSLFKHDP  677


 Score = 59.6 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 68/196 (35%), Gaps = 9/196 (5%)

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            IV   + Q    +   AL     LL +    +  +A   ++ ++     +   + +  LV
Sbjct  127  IVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLV  186

Query  380  PFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
              +V  +   +D  T +     + N +     E ++ +   G I  L+ +L++    ++ 
Sbjct  187  AAVVRTMQNTSDLDTARCTTSILHNLSHH--REGLLAIFKSGGIPALVRMLSSPVESVLF  244

Query  439  VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
              +  + N+          E   + +    GL K+  L N  N      +   ++     
Sbjct  245  YAITTLHNLLL------YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYG  298

Query  499  EEEEDQNVVPETTSEG  514
             +E    ++     + 
Sbjct  299  NQESKLIILANGGPQA  314


> sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10090 
GN=Jup PE=1 SV=3
Length=745

 Score =  119 bits (298),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 86/495 (17%), Positives = 169/495 (34%), Gaps = 94/495 (19%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT---------  131
            +V+ + +++  +  + T +    LS  ++  +  I ++G IP  V  L            
Sbjct  189  VVRTMQNTSDLDTARCTTSILHNLSHHREGLL-AIFKSGGIPALVRMLSSPVESVLFYAI  247

Query  132  --------------------------------DCSPIQFESAWALTNIASGTSEQTKAVV  159
                                            +       +   L  +A G  E    ++
Sbjct  248  TTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIIL  307

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVP  216
              G     + ++ +      E+ +W    +    SV    +  +++ G +  L       
Sbjct  308  ANGGPQGLVQIMRNYS---YEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GK  359

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             ++S +   ++N  WTL NL    + A   + +E +L  LV  L  DD  VL      +S
Sbjct  360  HLTSNSPRLVQNCLWTLRNL---SDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLS  416

Query  277  YLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQV  330
             LT   ++   +V +   V  L+   L    +  I  PA+ A+ ++ +   E    Q  V
Sbjct  417  NLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSV  476

Query  331  VIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA  389
             ++ G +     LL  P    + K     + N+     +    +    ++P LV +L KA
Sbjct  477  RLNYG-IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKA  534

Query  390  DFKTQKE-AVWAVTNYTSGGTVEQIV------------------YLVHCGIIEPLMNLLT  430
                Q+  A      YT G  +E+IV                   +     I   + LL 
Sbjct  535  HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY  594

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            +    I  V    +  + Q  E           I+  G    +  L +  NE     + +
Sbjct  595  SSVENIQRVAAGVLCELAQDKEAAD-------AIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  491  LIEKYFSVEEEEDQN  505
            ++   F + E+++ +
Sbjct  648  VL---FRISEDKNPD  659


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 69/381 (18%), Positives = 137/381 (36%), Gaps = 20/381 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLA-SPHAH  177
             +P+    L   D   +   +   + N  S      +A++     + A +  +  +    
Sbjct  143  ALPELTKLLNDEDPVVVTKAA--MIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD  200

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
             +      L N++         + K G +  L+ +L+ P         L     TL NL 
Sbjct  201  TARCTTSILHNLSHHREGL-LAIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLL  254

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              +  A     +   L  +V LL+ ++P+ LA T   +  L  G  E   +++  G    
Sbjct  255  LYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQG  314

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV+++       +      +  +++        +++AG +      LT+    + +   W
Sbjct  315  LVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLW  374

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ N+        Q+ +   ++  LV+ LS  D      A   ++N T   +      LV
Sbjct  375  TLRNL--SDVATKQEGLES-VLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKN--KTLV  429

Query  418  HCG-IIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 +E L++ +L A D   I         +     +  E E     +    G+  I  
Sbjct  430  TQNSGVEALIHAILRAGDKDDITEPAVC--ALRHLTSRHPEAEMAQNSVRLNYGIPAIVK  487

Query  476  LQNHENE-SVYKASLSLIEKY  495
            L N  N+  + KA++ LI   
Sbjct  488  LLNQPNQWPLVKATIGLIRNL  508


 Score = 65.4 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 53/302 (18%), Positives = 96/302 (32%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  +   +  +V  ++  +V     AT     L     +        +G+   
Sbjct  379  LSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEAL  438

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L   D   I   +  AL ++ S   E    Q    ++ G IPA + LL  P+   +
Sbjct  439  IHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG-IPAIVKLLNQPNQWPL  497

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         + +   +  L+ LL      +                  
Sbjct  498  VKATIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGT----------  546

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V                E++     A+  L   P  R+  + +   +P  
Sbjct  547  ---QQPYTDGVRM-------------EEIVEGCTGALHILARDPMNRME-IFRLNTIPLF  589

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +S   I   A   +  +    D++    IDA GA A    LL +        A  
Sbjct  590  VQLLYSSVENIQRVAAGVLCELAQ--DKEAADAIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  358  TM  359
             +
Sbjct  648  VL  649


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 49/225 (22%), Positives = 73/225 (32%), Gaps = 36/225 (16%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT-QAARKLLSREKQPPIDNIIRAGLI  121
            P  E   N   +N+ +  IVK +N  N    ++AT    R L           +  A +I
Sbjct  467  PEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAP--LQEAAVI  524

Query  122  PKFVSFLGRTDCSPIQFE---------------------SAWALTNIASGTSEQTKAVVD  160
            P+ V  L +      Q                          AL  +A         +  
Sbjct  525  PRLVQLLVKA-HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR-DPMNRMEIFR  582

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
               IP F+ LL S   +I   A   L  +A D     D +   GA  PL+ LL   +  +
Sbjct  583  LNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEA-ADAIDAEGASAPLMELLHSRNEGT  641

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
                        L  +  +KNP    D  +++   L   L   DP
Sbjct  642  ATY-----AAAVLFRISEDKNP----DYRKRVSVELTNSLFKHDP  677


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/196 (15%), Positives = 69/196 (35%), Gaps = 9/196 (5%)

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            IV   + Q    +   AL     LL +    +  +A   ++ ++     +   + +  LV
Sbjct  127  IVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLV  186

Query  380  PFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
              +V  +   +D  T +     + N +     E ++ +   G I  L+ +L++    ++ 
Sbjct  187  AAVVRTMQNTSDLDTARCTTSILHNLSHH--REGLLAIFKSGGIPALVRMLSSPVESVLF  244

Query  439  VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
              +  + N+          E   + +    GL K+  L N  N      +   ++     
Sbjct  245  YAITTLHNLLL------YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYG  298

Query  499  EEEEDQNVVPETTSEG  514
             +E    ++     +G
Sbjct  299  NQESKLIILANGGPQG  314


> sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus 
OX=10116 GN=Jup PE=1 SV=1
Length=745

 Score =  119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 86/495 (17%), Positives = 169/495 (34%), Gaps = 94/495 (19%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT---------  131
            +V+ + +++  +  + T +    LS  ++  +  I ++G IP  V  L            
Sbjct  189  VVRTMQNTSDLDTARCTTSILHNLSHHREGLL-AIFKSGGIPALVRMLSSPVESVLFYAI  247

Query  132  --------------------------------DCSPIQFESAWALTNIASGTSEQTKAVV  159
                                            +       +   L  +A G  E    ++
Sbjct  248  TTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIIL  307

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLAVP  216
              G     + ++ +      E+ +W    +    SV    +  +++ G +  L       
Sbjct  308  ANGGPQGLVQIMRNYS---YEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GK  359

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
             ++S +   ++N  WTL NL    + A   + +E +L  LV  L  DD  VL      +S
Sbjct  360  HLTSNSPRLVQNCLWTLRNL---SDVATKQEGLENVLKILVNQLSVDDVNVLTCATGTLS  416

Query  277  YLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTPALRAIGNIVTGTDE----QTQV  330
             LT   ++   +V +   V  L+   L    +  I  PA+ A+ ++ +   E    Q  V
Sbjct  417  NLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSV  476

Query  331  VIDAGALAVFPSLLTNPKT-NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA  389
             ++ G +     LL  P    + K     + N+     +    +    ++P LV +L KA
Sbjct  477  RLNYG-IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANH-APLQEAAVIPRLVQLLVKA  534

Query  390  DFKTQKE-AVWAVTNYTSGGTVEQIV------------------YLVHCGIIEPLMNLLT  430
                Q+  A      YT G  +E+IV                   +     I   + LL 
Sbjct  535  HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY  594

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS  490
            +    I  V    +  + Q  E           I+  G    +  L +  NE     + +
Sbjct  595  SSVENIQRVAAGVLCELAQDKEAAD-------AIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  491  LIEKYFSVEEEEDQN  505
            ++   F + E+++ +
Sbjct  648  VL---FRISEDKNPD  659


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 69/381 (18%), Positives = 137/381 (36%), Gaps = 20/381 (5%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLA-SPHAH  177
             +P+    L   D   +   +   + N  S      +A++     + A +  +  +    
Sbjct  143  ALPELTKLLNDEDPVVVTKAA--MIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD  200

Query  178  ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC  237
             +      L N++         + K G +  L+ +L+ P         L     TL NL 
Sbjct  201  TARCTTSILHNLSHHREGL-LAIFKSGGIPALVRMLSSPVE-----SVLFYAITTLHNLL  254

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
              +  A     +   L  +V LL+ ++P+ LA T   +  L  G  E   +++  G    
Sbjct  255  LYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQG  314

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            LV+++       +      +  +++        +++AG +      LT+    + +   W
Sbjct  315  LVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLW  374

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
            T+ N+        Q+ +   ++  LV+ LS  D      A   ++N T   +      LV
Sbjct  375  TLRNL--SDVATKQEGLE-NVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKN--KTLV  429

Query  418  HCG-IIEPLMN-LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 +E L++ +L A D   I         +     +  E E     +    G+  I  
Sbjct  430  TQNSGVEALIHAILRAGDKDDITEPAVC--ALRHLTSRHPEAEMAQNSVRLNYGIPAIVK  487

Query  476  LQNHENE-SVYKASLSLIEKY  495
            L N  N+  + KA++ LI   
Sbjct  488  LLNQPNQWPLVKATIGLIRNL  508


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 53/302 (18%), Positives = 96/302 (32%), Gaps = 37/302 (12%)

Query  64   LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
            L +    Q  +   +  +V  ++  +V     AT     L     +        +G+   
Sbjct  379  LSDVATKQEGLENVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEAL  438

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSE----QTKAVVDGGAIPAFISLLASPHA-HI  178
              + L   D   I   +  AL ++ S   E    Q    ++ G IPA + LL  P+   +
Sbjct  439  IHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG-IPAIVKLLNQPNQWPL  497

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             +  +  + N+A         + +   +  L+ LL      +                  
Sbjct  498  VKATIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGT----------  546

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
                 P  D V                E++     A+  L   P  R+  + +   +P  
Sbjct  547  ---QQPYTDGVRM-------------EEIVEGCTGALHILARDPMNRME-IFRLNTIPLF  589

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA-GALAVFPSLLTNPKTNIQKEATW  357
            V+LL +S   I   A   +  +    D++    IDA GA A    LL +        A  
Sbjct  590  VQLLYSSVENIQRVAAGVLCELAQ--DKEAADAIDAEGASAPLMELLHSRNEGTATYAAA  647

Query  358  TM  359
             +
Sbjct  648  VL  649


 Score = 65.0 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 49/225 (22%), Positives = 73/225 (32%), Gaps = 36/225 (16%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT-QAARKLLSREKQPPIDNIIRAGLI  121
            P  E   N   +N+ +  IVK +N  N    ++AT    R L           +  A +I
Sbjct  467  PEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAP--LQEAAVI  524

Query  122  PKFVSFLGRTDCSPIQFE---------------------SAWALTNIASGTSEQTKAVVD  160
            P+ V  L +      Q                          AL  +A         +  
Sbjct  525  PRLVQLLVKA-HQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR-DPMNRMEIFR  582

Query  161  GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS  220
               IP F+ LL S   +I   A   L  +A D     D +   GA  PL+ LL   +  +
Sbjct  583  LNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEA-ADAIDAEGASAPLMELLHSRNEGT  641

Query  221  LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP  265
                        L  +  +KNP    D  +++   L   L   DP
Sbjct  642  ATY-----AAAVLFRISEDKNP----DYRKRVSVELTNSLFKHDP  677


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/196 (15%), Positives = 69/196 (35%), Gaps = 9/196 (5%)

Query  320  IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            IV   + Q    +   AL     LL +    +  +A   ++ ++     +   + +  LV
Sbjct  127  IVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLV  186

Query  380  PFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
              +V  +   +D  T +     + N +     E ++ +   G I  L+ +L++    ++ 
Sbjct  187  AAVVRTMQNTSDLDTARCTTSILHNLSHH--REGLLAIFKSGGIPALVRMLSSPVESVLF  244

Query  439  VILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
              +  + N+          E   + +    GL K+  L N  N      +   ++     
Sbjct  245  YAITTLHNLLL------YQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYG  298

Query  499  EEEEDQNVVPETTSEG  514
             +E    ++     +G
Sbjct  299  NQESKLIILANGGPQG  314


> sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis 
thaliana OX=3702 GN=PUB11 PE=2 SV=2
Length=612

 Score =  117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 58/293 (20%), Positives = 120/293 (41%), Gaps = 16/293 (5%)

Query  106  REKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIP  165
            R K     ++IRA      V  L        +  +   + +++  +++    + + GAIP
Sbjct  323  RTKNSGDMSVIRA-----LVQRLSSRSTED-RRNAVSEIRSLSKRSTDNRILIAEAGAIP  376

Query  166  AFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY  225
              ++LL S      E A+  + N++      ++L++  GAV  ++ +L    M +     
Sbjct  377  VLVNLLTSEDVATQENAITCVLNLSI-YENNKELIMFAGAVTSIVQVLRAGTMEARE---  432

Query  226  LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER  285
              N   TL +L    +    I      +P LV LL +  P    D   A+  L    +  
Sbjct  433  --NAAATLFSLSLA-DENKIIIGGSGAIPALVDLLENGTPRGKKDAATALFNLCI-YHGN  488

Query  286  IGMVVKTGVVPQLVKLLG-ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL  344
             G  V+ G+V  LVK+L  ++   +V  AL  I +++    +    ++ A  L     +L
Sbjct  489  KGRAVRAGIVTALVKMLSDSTRHRMVDEAL-TILSVLANNQDAKSAIVKANTLPALIGIL  547

Query  345  TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
               +T  ++ A   + ++     +++  +   G V  L+ +      + +++A
Sbjct  548  QTDQTRNRENAAAILLSLCKRDTEKLITIGRLGAVVPLMDLSKNGTERGKRKA  600


 Score =  113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 53/284 (19%), Positives = 110/284 (39%), Gaps = 14/284 (5%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +V+ ++S + E++  A    R L  R     I  I  AG IP  V+ L   D +  Q
Sbjct  333  IRALVQRLSSRSTEDRRNAVSEIRSLSKRSTDNRI-LIAEAGAIPVLVNLLTSEDVAT-Q  390

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +   + N++       + ++  GA+ + + +L +      E A   L +++      +
Sbjct  391  ENAITCVLNLSIY-ENNKELIMFAGAVTSIVQVLRAGTMEARENAAATLFSLSLADEN-K  448

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC-RNKNPAPPIDAVEQILPTL  256
             ++   GA+  L+ LL             ++    L NLC  + N    + A   I+  L
Sbjct  449  IIIGGSGAIPALVDLLENG-----TPRGKKDAATALFNLCIYHGNKGRAVRA--GIVTAL  501

Query  257  VRLLHHDDP-EVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            V++L       ++ +    +S L     +    +VK   +P L+ +L   +      A  
Sbjct  502  VKMLSDSTRHRMVDEALTILSVLA-NNQDAKSAIVKANTLPALIGILQTDQTRNRENAAA  560

Query  316  AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
             + ++     E+   +   GA+     L  N     +++A   +
Sbjct  561  ILLSLCKRDTEKLITIGRLGAVVPLMDLSKNGTERGKRKAISLL  604


 Score =  107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/303 (19%), Positives = 120/303 (40%), Gaps = 9/303 (3%)

Query  148  ASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVD  207
            A   + +TK   D   I A +  L+S        AV  + +++   +  R L+ + GA+ 
Sbjct  317  AGYINGRTKNSGDMSVIRALVQRLSSRSTEDRRNAVSEIRSLSKRSTDNRILIAEAGAIP  376

Query  208  PLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEV  267
             L+ LL   D+         N    + NL   +N    +      + ++V++L     E 
Sbjct  377  VLVNLLTSEDV-----ATQENAITCVLNLSIYENN-KELIMFAGAVTSIVQVLRAGTMEA  430

Query  268  LADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQ  327
              +    +  L+     +I ++  +G +P LV LL          A  A+ N+      +
Sbjct  431  RENAAATLFSLSLADENKI-IIGGSGAIPALVDLLENGTPRGKKDAATALFNLCIYHGNK  489

Query  328  TQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS  387
             + V  AG +     +L++   +   +   T+ ++ A  QD    +V    +P L+ +L 
Sbjct  490  GRAV-RAGIVTALVKMLSDSTRHRMVDEALTILSVLANNQDAKSAIVKANTLPALIGILQ  548

Query  388  KADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI  447
                + ++ A   + +     T E+++ +   G + PLM+L      +     +  +  +
Sbjct  549  TDQTRNRENAAAILLSLCKRDT-EKLITIGRLGAVVPLMDLSKNGTERGKRKAISLLELL  607

Query  448  FQA  450
             +A
Sbjct  608  RKA  610


 Score = 77.7 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/172 (19%), Positives = 70/172 (41%), Gaps = 3/172 (2%)

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
               V+  LV+ L +        A+  I ++   + +   ++ +AGA+ V  +LLT+    
Sbjct  329  DMSVIRALVQRLSSRSTEDRRNAVSEIRSLSKRSTDNRILIAEAGAIPVLVNLLTSEDVA  388

Query  351  IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV  410
             Q+ A   + N++   ++  + ++  G V  +V VL     + ++ A   +  ++     
Sbjct  389  TQENAITCVLNLSI-YENNKELIMFAGAVTSIVQVLRAGTMEARENAAATL--FSLSLAD  445

Query  411  EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI  462
            E  + +   G I  L++LL     +       A+ N+       G   +  I
Sbjct  446  ENKIIIGGSGAIPALVDLLENGTPRGKKDAATALFNLCIYHGNKGRAVRAGI  497


> sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo 
sapiens OX=9606 GN=ARMC3 PE=2 SV=2
Length=872

 Score =  115 bits (289),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 72/391 (18%), Positives = 146/391 (37%), Gaps = 25/391 (6%)

Query  102  KLLSREKQPPIDNIIRAGLI----PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKA  157
            K + +E +PP  ++    +I       V  +  +    I  ++  A+   A    E    
Sbjct  3    KKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTT  62

Query  158  VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            +++ GA+     LL      +   A    G I    +  + L+ +   ++ ++A L    
Sbjct  63   LLELGAVEPLTKLLTHEDKIVRRNATMIFG-ILASNNDVKKLLRELDVMNSVIAQL----  117

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
                        +  L+N+   +  +         L  L+RLL   DP+V  ++   I  
Sbjct  118  APEEEVVIHEFASLCLANM-SAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYN  176

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L      R   + +   +P ++ LL +    I   AL+ +G I    + +T +  + G L
Sbjct  177  LVQDFQCR-AKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIANDKESRTMLRDNQG-L  234

Query  338  AVFPSLLTNPKTN-IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF-KTQK  395
                 +L   + N +  EA   ++N      D + Q+   G +  L+S    +     QK
Sbjct  235  DHLIKILETKELNDLHIEALAVIAN-CLEDMDTMVQIQQTGGLKKLLSFAENSTIPDIQK  293

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLG  455
             A  A+T         ++ +     + + L+ LL +++    +    AIS +    E  G
Sbjct  294  NAAKAITKAAYDPENRKLFH--EQEVEKCLVALLGSENDGTKIAASQAISAMC---ENSG  348

Query  456  ETEKLSIMIEECGGLDKIEALQNHENESVYK  486
              +  +       G+ ++  L   +NE V +
Sbjct  349  SKDFFN-----NQGIPQLIQLLKSDNEEVRE  374


 Score =  112 bits (281),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 73/449 (16%), Positives = 168/449 (37%), Gaps = 55/449 (12%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            V+ + K +   +   +  AT     L S      +  +    ++   ++ L   +   I 
Sbjct  69   VEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKL--LRELDVMNSVIAQLAPEEEVVIH  126

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              ++  L N+++  + + + + + G +   I LL+SP   + + ++  + N+  D    R
Sbjct  127  EFASLCLANMSAEYTSKVQ-IFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDF-QCR  184

Query  198  DLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
              + +  A+ P+L LL    P +  LA   L  +         N   +  +    Q L  
Sbjct  185  AKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIA--------NDKESRTMLRDNQGLDH  236

Query  256  LVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE-LPIVTPA  313
            L+++L   +  ++  +    I+   +  +  +  + +TG + +L+     S    I   A
Sbjct  237  LIKILETKELNDLHIEALAVIANCLEDMDTMVQ-IQQTGGLKKLLSFAENSTIPDIQKNA  295

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             +AI        E  ++  +        +LL +     +  A+  +S +        +  
Sbjct  296  AKAITK-AAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCENSGS--KDF  352

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
             N+  +P L+ +L   + + ++ A  A+ N T+             G I+PL+NLL++K 
Sbjct  353  FNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADG-IDPLINLLSSKR  411

Query  434  TKIILVILDAISNI----------------------FQAAEKLGETE------------K  459
               I      ++N+                       ++A  + +++            +
Sbjct  412  DGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVE  471

Query  460  LSIMIEECGGLDKIEALQNHENESVYKAS  488
                +   GGL+ +  L   +N+ V K +
Sbjct  472  ARTELRNSGGLEPLVELLRSKNDEVRKHA  500


 Score =  111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 72/399 (18%), Positives = 154/399 (39%), Gaps = 23/399 (6%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ ++S + + +  + +    L+  +       +     IP  +  L +++   IQ
Sbjct  152  LEPLIRLLSSPDPDVKKNSMECIYNLV--QDFQCRAKLQELNAIPPILDLL-KSEYPVIQ  208

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGDGSVF  196
              +   L  IA    E    + D   +   I +L +     +  +A+  + N   D    
Sbjct  209  LLALKTLGVIA-NDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDM---  264

Query  197  RDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL  256
             D +++      L  LL+  + S++     +N    ++    +          +++   L
Sbjct  265  -DTMVQIQQTGGLKKLLSFAENSTIPD-IQKNAAKAITKAAYDPENRKLFHE-QEVEKCL  321

Query  257  VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
            V LL  ++         AIS + +  N           +PQL++LL +    +   A  A
Sbjct  322  VALLGSENDGTKIAASQAISAMCE--NSGSKDFFNNQGIPQLIQLLKSDNEEVREAAALA  379

Query  317  IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
            + N+ T          +A  +    +LL++ +      A   ++N+      ++  + NH
Sbjct  380  LANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRL-NIQNH  438

Query  377  GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI  436
             ++  ++S L  A+   Q +A  AVT       VE    L + G +EPL+ LL +K+ ++
Sbjct  439  DIMHAIISPLRSANTVVQSKAALAVTATACD--VEARTELRNSGGLEPLVELLRSKNDEV  496

Query  437  ILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                  A   +   A       +L  +    G LD +E 
Sbjct  497  RKHASWA---VMVCAGDELTANELCRL----GALDILEE  528


 Score =  108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/276 (21%), Positives = 113/276 (41%), Gaps = 16/276 (6%)

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+   P+    +   T+V +L+  + E+LA  C AI        E    +++ G V  L 
Sbjct  14   KDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLT  73

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            KLL   +  +   A    G + +  D +  +       +V   L    +  I + A+  +
Sbjct  74   KLLTHEDKIVRRNATMIFGILASNNDVKKLLRELDVMNSVIAQLAPEEEVVIHEFASLCL  133

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            +N++A    ++Q +  HG +  L+ +LS  D   +K ++  + N       +    L   
Sbjct  134  ANMSAEYTSKVQ-IFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQD--FQCRAKLQEL  190

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK-IEALQN  478
              I P+++LL ++   I L+ L  +  I    E          M+ +  GLD  I+ L+ 
Sbjct  191  NAIPPILDLLKSEYPVIQLLALKTLGVIANDKES-------RTMLRDNQGLDHLIKILET  243

Query  479  HENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEG  514
             E   ++  +L++I         ED + + +    G
Sbjct  244  KELNDLHIEALAVIANCL-----EDMDTMVQIQQTG  274


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 46/234 (20%), Positives = 85/234 (36%), Gaps = 10/234 (4%)

Query  1    MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA  60
            +S  EN+  P  + +  K   K + +   R++    E+ K        +          A
Sbjct  280  LSFAENSTIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQA  339

Query  61   TSPLQENRNNQGTVN-WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG  119
             S + EN  ++   N   +  +++ + S N E +  A  A   L +             G
Sbjct  340  ISAMCENSGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADG  399

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
             I   ++ L       I   +A  LTN+A         + +   + A IS L S +  + 
Sbjct  400  -IDPLINLLSSKRDGAIA-NAATVLTNMAMQEP-LRLNIQNHDIMHAIISPLRSANTVVQ  456

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTL  233
             +A  A+   A D     +L    G ++PL+ LL      S      ++ +W +
Sbjct  457  SKAALAVTATACDVEARTEL-RNSGGLEPLVELL-----RSKNDEVRKHASWAV  504


> sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis 
thaliana OX=3702 GN=PUB14 PE=1 SV=1
Length=632

 Score =  115 bits (287),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/282 (21%), Positives = 102/282 (36%), Gaps = 11/282 (4%)

Query  81   IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES  140
            +++ + +   E Q  A    R L  R     +  I  AG IP  V  L   D    Q  S
Sbjct  350  LLEKLANGTTEQQRAAAGELRLLAKRNVDNRV-CIAEAGAIPLLVELLSSPD-PRTQEHS  407

Query  141  AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV  200
              AL N+ S       A+VD GAI   + +L +      E A   L +++      +  +
Sbjct  408  VTALLNL-SINEGNKGAIVDAGAITDIVEVLKNGSMEARENAAATLFSLSVIDEN-KVAI  465

Query  201  IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
               GA+  L++LL             ++    + NLC  +           I+  L RLL
Sbjct  466  GAAGAIQALISLLEEGTRRG-----KKDAATAIFNLCIYQGNKSRAVK-GGIVDPLTRLL  519

Query  261  HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI  320
                  ++ +    ++ L+    E    + +   +P LV+++          A   +  +
Sbjct  520  KDAGGGMVDEALAILAILST-NQEGKTAIAEAESIPVLVEIIRTGSPRNRENAAAILWYL  578

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              G  E+  V  + GA      L  N     +++A   +  I
Sbjct  579  CIGNIERLNVAREVGADVALKELTENGTDRAKRKAASLLELI  620


 Score =  111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/275 (19%), Positives = 104/275 (38%), Gaps = 10/275 (4%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
             +  L     +  Q  +A  L  +A    +    + + GAIP  + LL+SP     E +V
Sbjct  350  LLEKLANG-TTEQQRAAAGELRLLAKRNVDNRVCIAEAGAIPLLVELLSSPDPRTQEHSV  408

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
             AL N++ +    +  ++  GA+  ++ +L    M +       N   TL +L    +  
Sbjct  409  TALLNLSIN-EGNKGAIVDAGAITDIVEVLKNGSMEARE-----NAAATLFSLSV-IDEN  461

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
                     +  L+ LL         D   AI  L      +   V K G+V  L +LL 
Sbjct  462  KVAIGAAGAIQALISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAV-KGGIVDPLTRLLK  520

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
             +   +V  AL  +  + T  + +T  + +A ++ V   ++       ++ A   +  + 
Sbjct  521  DAGGGMVDEALAILAILSTNQEGKT-AIAEAESIPVLVEIIRTGSPRNRENAAAILWYLC  579

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
             G  +++      G    L  +      + +++A 
Sbjct  580  IGNIERLNVAREVGADVALKELTENGTDRAKRKAA  614


 Score = 93.5 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 91/217 (42%), Gaps = 8/217 (4%)

Query  252  ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVT  311
            +L  L +L +    +        +  L     +    + + G +P LV+LL + +     
Sbjct  347  VLSLLEKLANGTTEQ-QRAAAGELRLLAKRNVDNRVCIAEAGAIPLLVELLSSPDPRTQE  405

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ  371
             ++ A+ N+    +     ++DAGA+     +L N     ++ A  T+ +++    +   
Sbjct  406  HSVTALLNLSI-NEGNKGAIVDAGAITDIVEVLKNGSMEARENAAATLFSLSV-IDENKV  463

Query  372  QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA  431
             +   G +  L+S+L +   + +K+A  A+ N       +     V  GI++PL  LL  
Sbjct  464  AIGAAGAIQALISLLEEGTRRGKKDAATAIFNLCIYQGNKSRA--VKGGIVDPLTRLLKD  521

Query  432  KDTKII---LVILDAISNIFQAAEKLGETEKLSIMIE  465
                ++   L IL  +S   +    + E E + +++E
Sbjct  522  AGGGMVDEALAILAILSTNQEGKTAIAEAESIPVLVE  558


 Score = 76.2 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 57/345 (17%), Positives = 111/345 (32%), Gaps = 18/345 (5%)

Query  110  PPIDNIIRAGLIPKFV-----SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAI  164
               + ++ AGL P +V     +    ++   +        T    G+S       D   +
Sbjct  291  KSQETLLHAGLTPNYVLKSLIALWCESNGIELPQNQGSCRTTKIGGSSSSD---CDRTFV  347

Query  165  PAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG  224
             + +  LA+        A   L  +A      R  + + GA+  L+ LL+ PD  +    
Sbjct  348  LSLLEKLANGTTEQQRAAAGELRLLAKRNVDNRVCIAEAGAIPLLVELLSSPDPRTQEHS  407

Query  225  YLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE  284
                    LS    NK       A+  I+  L         E   +    +  L+     
Sbjct  408  V--TALLNLSINEGNKGAIVDAGAITDIVEVLKNG----SMEARENAAATLFSLSVIDEN  461

Query  285  RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL  344
            ++ +      +  L+ LL          A  AI N+      +++ V   G +     LL
Sbjct  462  KVAIGAAG-AIQALISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAV-KGGIVDPLTRLL  519

Query  345  TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY  404
             +    +  EA   ++ I +  Q+    +     +P LV ++     + ++ A   +   
Sbjct  520  KDAGGGMVDEALAILA-ILSTNQEGKTAIAEAESIPVLVEIIRTGSPRNRENAAAILWYL  578

Query  405  TSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQ  449
               G +E++      G    L  L      +        +  I Q
Sbjct  579  CI-GNIERLNVAREVGADVALKELTENGTDRAKRKAASLLELIQQ  622


> sp|F4I718|CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 
OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
Length=2136

 Score =  114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 75/364 (21%), Positives = 136/364 (37%), Gaps = 27/364 (7%)

Query  78   VDDIVKGINSSNVENQLQATQAARKL-LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI  136
            VD +V  ++S N  +Q  A     +L LS      I  I+ +G++   +  L + +   +
Sbjct  216  VDIVVSLLSSDNPNSQANAASLLARLVLSFCDS--IQKILNSGVVKSLIQLLEQKNDINV  273

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH---------ISEQAVWALG  187
            +  +A AL  +++ + E  K V D G + A I  + +P            + E A  AL 
Sbjct  274  RASAADALEALSANSDEAKKCVKDAGGVHALIEAIVAPSKECMQGKHGQSLQEHATGALA  333

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
            N+ G     R L+I  G V         P ++      +  L + L    + ++     D
Sbjct  334  NVFG---GMRHLIIYLGQVS------QSPRLTEPIGDVIGALAYALMIFKQPESSENIFD  384

Query  248  AVEQILPTLVRLLHHDDPE-VLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
                I   LV+LL   D + +      A++ L  G +     +        L+ L+  + 
Sbjct  385  P-SVIESILVKLLKPRDTKLIQERILEAMASL-YGNSSLSCYLDDAEAKRVLIALITMAS  442

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR  366
              +    +  +  +        + +     + +F S L       Q+ A   +  +TA  
Sbjct  443  ADVRERLIICLSGLCHDKVGIWEAIGKREGIQLFISFLGLSSEQHQEYAVEMLKILTAQV  502

Query  367  QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH-CGIIEPL  425
             D    V   G +P LV +L     K +++A   + N       E+I   V   G I   
Sbjct  503  DDSKWAVTAAGGIPPLVQLLETGSQKAKEDAACILWNLCCHS--EEIRDCVERAGGIPAF  560

Query  426  MNLL  429
            + LL
Sbjct  561  LWLL  564


 Score = 95.8 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 57/269 (21%), Positives = 105/269 (39%), Gaps = 14/269 (5%)

Query  172  ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTW  231
             +      E     L  IA      R L+  YG   PL   +     +        N+  
Sbjct  49   KTSSPQDKELTTARLLGIAKGKREARRLIGSYGQAMPLFISMLRNGTTLAKV----NVAS  104

Query  232  TLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDG--PNERIGMV  289
             L  LC++K+    +  +   +P L+ +L     E       AI  ++     N+ IGM 
Sbjct  105  ILCVLCKDKDLRLKVL-LGGCIPPLLSVLKSGTMETRKAAAEAIYEVSSAGISNDHIGMK  163

Query  290  V--KTGVVPQL---VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL  344
            +    GVVP L   + L G  +  +      A+ N+    D   ++ ++   + +  SLL
Sbjct  164  IFITEGVVPTLWDQLSLKGNQDKVVEGYVTGALRNLCGVDDGYWRLTLEGSGVDIVVSLL  223

Query  345  TNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVL-SKADFKTQKEAVWAVTN  403
            ++   N Q  A   ++ +     D IQ+++N G+V  L+ +L  K D   +  A  A+  
Sbjct  224  SSDNPNSQANAASLLARLVLSFCDSIQKILNSGVVKSLIQLLEQKNDINVRASAADALEA  283

Query  404  YTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
             ++  + E    +   G +  L+  + A 
Sbjct  284  LSAN-SDEAKKCVKDAGGVHALIEAIVAP  311


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 85/437 (19%), Positives = 167/437 (38%), Gaps = 34/437 (8%)

Query  63   PLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKL-LSREKQPPIDNIIRAG-L  120
              +   ++      +V  +++ +++     Q +    AR L +++ K+     I   G  
Sbjct  24   DAKMEMDDPEKAMATVAQLIEQLHAKTSSPQDKELTTARLLGIAKGKREARRLIGSYGQA  83

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +P F+S L     +  +   A  L  +      + K ++ GG IP  +S+L S      +
Sbjct  84   MPLFISMLRNG-TTLAKVNVASILCVLCKDKDLRLKVLL-GGCIPPLLSVLKSGTMETRK  141

Query  181  QAVWALGNIAGDGSVFR----DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             A  A+  ++  G         + I  G V  L   L++             +T  L NL
Sbjct  142  AAAEAIYEVSSAGISNDHIGMKIFITEGVVPTLWDQLSLKGNQDKVVEGY--VTGALRNL  199

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
            C   +    +      +  +V LL  D+P   A+    ++ L     + I  ++ +GVV 
Sbjct  200  CGVDDGYWRLTLEGSGVDIVVSLLSSDNPNSQANAASLLARLVLSFCDSIQKILNSGVVK  259

Query  297  QLVKLL-GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT------  349
             L++LL   +++ +   A  A+  +   +DE  + V DAG +      +  P        
Sbjct  260  SLIQLLEQKNDINVRASAADALEALSANSDEAKKCVKDAGGVHALIEAIVAPSKECMQGK  319

Query  350  ---NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS  406
               ++Q+ AT  ++N+  G +  I  +      P L                +A+  +  
Sbjct  320  HGQSLQEHATGALANVFGGMRHLIIYLGQVSQSPRLTE----PIGDVIGALAYALMIFKQ  375

Query  407  GGTVEQIVYLVHCGIIEP-LMNLLTAKDTKIILV-ILDAISNI-----FQAAEKLGETEK  459
                E    +    +IE  L+ LL  +DTK+I   IL+A++++             E ++
Sbjct  376  ---PESSENIFDPSVIESILVKLLKPRDTKLIQERILEAMASLYGNSSLSCYLDDAEAKR  432

Query  460  LSIMIEECGGLDKIEAL  476
            + I +      D  E L
Sbjct  433  VLIALITMASADVRERL  449


 Score = 80.4 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 63/470 (13%), Positives = 140/470 (30%), Gaps = 88/470 (19%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLS---REKQPPIDNIIRAGLI  121
             ++   +  +   +  ++  + S  +E +  A +A  ++ S         +   I  G++
Sbjct  112  DKDLRLKVLLGGCIPPLLSVLKSGTMETRKAAAEAIYEVSSAGISNDHIGMKIFITEGVV  171

Query  122  PKFVSFLGRTDCSP--IQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHIS  179
            P     L         ++     AL N+        +  ++G  +   +SLL+S + +  
Sbjct  172  PTLWDQLSLKGNQDKVVEGYVTGALRNLCGVDDGYWRLTLEGSGVDIVVSLLSSDNPNSQ  231

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
              A   L  +          ++  G V  L+ LL   +  ++           L  L  N
Sbjct  232  ANAASLLARLVLSFCDSIQKILNSGVVKSLIQLLEQKNDINVRAS----AADALEALSAN  287

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEV---------LADTCWAISYLTDGPNERIGMVV  290
             + A         +  L+  +     E                A++ +            
Sbjct  288  SDEAKKCVKDAGGVHALIEAIVAPSKECMQGKHGQSLQEHATGALANV------------  335

Query  291  KTGVVPQLVKLLG--ASELPIVTPALRAIGNIVTG-----TDEQTQVVIDAGALA-VFPS  342
              G +  L+  LG  +    +  P    IG +          E ++ + D   +  +   
Sbjct  336  -FGGMRHLIIYLGQVSQSPRLTEPIGDVIGALAYALMIFKQPESSENIFDPSVIESILVK  394

Query  343  LLTNPKTN-IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV  401
            LL    T  IQ+     M+++  G       + +      L+++++ A    ++  +  +
Sbjct  395  LLKPRDTKLIQERILEAMASL-YGNSSLSCYLDDAEAKRVLIALITMASADVRERLIICL  453

Query  402  TNYTSG-----------------------GTVEQIVYLVH------------------CG  420
            +                             + +   Y V                    G
Sbjct  454  SGLCHDKVGIWEAIGKREGIQLFISFLGLSSEQHQEYAVEMLKILTAQVDDSKWAVTAAG  513

Query  421  IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
             I PL+ LL     K        + N+         +E++   +E  GG+
Sbjct  514  GIPPLVQLLETGSQKAKEDAACILWNLCCH------SEEIRDCVERAGGI  557


 Score = 76.2 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 71/402 (18%), Positives = 140/402 (35%), Gaps = 42/402 (10%)

Query  115   IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
             +  AG +     +L  +     ++ +   L  +     E  +  +   ++   I++L   
Sbjct  1213  MAEAGAVEALTKYLSLSPQDSTEY-AISELLRVLFSNHELRQNEMALSSLNQLIAVLRLG  1271

Query  175   HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLS  234
                    A  AL N   D    R+  I   AV PL+ +L     S             L 
Sbjct  1272  SRSARYSAAGAL-NELFDAENIRNSEIACQAVQPLMDILGSVSESEQEV-----ALSALI  1325

Query  235   NLCRN--KNPAPPIDAVEQILPTLVRLLHHDD--PEVLADTCWAISYLTDGPNERIGMVV  290
              L      N A  ID    +L  ++++L       E+  +     S +    N R     
Sbjct  1326  KLSSGNTSNTALLIDVEGSLLENVIKILSSATASEELKINAARLCSVVFSNKNIRTSASA  1385

Query  291   KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN  350
              +G +  L+ L+ +     V  A+ AI  I+   ++  ++        +   L++     
Sbjct  1386  -SGCMKPLITLMQSERSAAVEAAVFAIK-ILLDDEQHLELAAAHNIQELLVGLVSGKNYV  1443

Query  351   IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV  410
             I + +   +  +   R  +   +V  G++   + +L  A            ++  S   V
Sbjct  1444  IIEASLSALIKLGKDRVPRKLDMVEAGIIERCLELLPGAS-----------SSLCS-AVV  1491

Query  411   EQIVYLVHCGII----------EPLMNLLTAKDTKI--ILVILDAISNIFQAAEKLGETE  458
             E    L + G+I          EPL  +L   D  +      L A+ NI    EK    E
Sbjct  1492  ELFRILTNSGVIARRPDVAKTVEPLFAVLLRSDLTLWGQHSALQALVNIL---EKQQTLE  1548

Query  459   KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEE  500
               S    E   +  I  L++  ++++ +    L+  + ++E+
Sbjct  1549  AFSFTPSEA-IVPLISFLESS-SQAIQQLGAELLSHFLTMED  1588


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 63/348 (18%), Positives = 121/348 (35%), Gaps = 21/348 (6%)

Query  103   LLSREKQPPIDNIIRAGLIPKFVSFLGR-TDCSPIQFESA------WALTNIASGTSEQT  155
             +L+         ++ AG +   V  L R T  +  +FE          L  I       +
Sbjct  1010  ILTSVDAKSKVIVMEAGGLEVLVGKLARYTSSAQAEFEDTEGIWISALLLAIMFQDDNVS  1069

Query  156   KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDL-VIKYGAVDPLLALLA  214
              +      IP    LL S        A  A+ ++    +   +L +   GAV  ++ LL 
Sbjct  1070  FSSTTMRIIPTLAVLLGSDELIDRYFAAHAMASLVCTRNRGINLTIANSGAVSGIINLLG  1129

Query  215   VPDMSSLACGYLRNLTWT--------LSNLCRNKNPAPPIDAVEQILPTLVRLLHH--DD  264
               +   L    L N            L +L   ++         + +P LV LL    D 
Sbjct  1130  YVESEILNLVALANEFSLVKEPDQVILQHLFEIEDVRLG-STARKSIPLLVDLLRPIPDR  1188

Query  265   PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT  324
             P         +  + DG +    ++ + G V  L K L  S       A+  +  ++   
Sbjct  1189  PGAPQFAVQILIRIADGSDTNKLLMAEAGAVEALTKYLSLSPQDSTEYAISELLRVLFSN  1248

Query  325   DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS  384
              E  Q  +   +L    ++L     + +  A   + N     ++     +    V  L+ 
Sbjct  1249  HELRQNEMALSSLNQLIAVLRLGSRSARYSAAGAL-NELFDAENIRNSEIACQAVQPLMD  1307

Query  385   VLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL-VHCGIIEPLMNLLTA  431
             +L       Q+ A+ A+   +SG T    + + V   ++E ++ +L++
Sbjct  1308  ILGSVSESEQEVALSALIKLSSGNTSNTALLIDVEGSLLENVIKILSS  1355


 Score = 58.1 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/375 (16%), Positives = 135/375 (36%), Gaps = 65/375 (17%)

Query  64    LQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPK  123
             L + ++ +     ++ +++ G+ S      ++A+ +A   L +++ P   +++ AG+I +
Sbjct  1415  LDDEQHLELAAAHNIQELLVGLVSGKNYVIIEASLSALIKLGKDRVPRKLDMVEAGIIER  1474

Query  124   FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
              +  L              A +++ S   E  + + + G I                   
Sbjct  1475  CLELLP------------GASSSLCSAVVELFRILTNSGVI-------------------  1503

Query  184   WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
                          R  V K   V+PL A+L   D+         +    L N+   +   
Sbjct  1504  -----------ARRPDVAKT--VEPLFAVLLRSDL---TLWGQHSALQALVNILEKQQTL  1547

Query  244   PPIDAV-EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL  302
                     + +  L+  L      +       +S+     + +  +  ++ VVP LV+L 
Sbjct  1548  EAFSFTPSEAIVPLISFLESSSQAIQQLGAELLSHFLTMEDFQQDITTQSAVVP-LVRLA  1606

Query  303   GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT----NPKTNIQKEATWT  358
             G   L +   A++A+  I        + V+DA  +     ++      P  ++ + A + 
Sbjct  1607  GIGILSLQETAIKALEKISASWP---KAVLDAEGIFELSKVILQEDPQPPLDLWESAAFV  1663

Query  359   MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE--QIVYL  416
             +SNI     +   +V     +P LV +L       +   + A+         +    V +
Sbjct  1664  LSNILQYDAECFFRVE----LPVLVKLLFST---IESTVLLALKALMLHEKNDASSTVQM  1716

Query  417   VHCGIIEPLMNLLTA  431
                G I+ L++LL +
Sbjct  1717  AELGAIDALLDLLRS  1731


 Score = 56.9 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 60/365 (16%), Positives = 127/365 (35%), Gaps = 57/365 (16%)

Query  140   SAWALTNIASGTSEQTKAVVDGGAIPAFISLL-------ASPHAHISEQAVWALG-----  187
             + W L  + S  ++    V++ G +   +  L        +         + AL      
Sbjct  1004  ALWLLCILTSVDAKSKVIVMEAGGLEVLVGKLARYTSSAQAEFEDTEGIWISALLLAIMF  1063

Query  188   ---NIAGDGSVFR---DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN  241
                N++   +  R    L +  G+ + +    A   M+SL C   R +  T++N      
Sbjct  1064  QDDNVSFSSTTMRIIPTLAVLLGSDELIDRYFAAHAMASLVCTRNRGINLTIAN------  1117

Query  242   PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT---------  292
                        +  ++ LL + + E+L     A++       E   ++++          
Sbjct  1118  --------SGAVSGIINLLGYVESEILNLV--ALANEFSLVKEPDQVILQHLFEIEDVRL  1167

Query  293   -----GVVPQLVKLLGASELPIVTP--ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT  345
                    +P LV LL         P  A++ +  I  G+D    ++ +AGA+      L+
Sbjct  1168  GSTARKSIPLLVDLLRPIPDRPGAPQFAVQILIRIADGSDTNKLLMAEAGAVEALTKYLS  1227

Query  346   NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYT  405
                 +  + A   +  +     +  Q  +    +  L++VL       +  A  A+    
Sbjct  1228  LSPQDSTEYAISELLRVLFSNHELRQNEMALSSLNQLIAVLRLGSRSARYSAAGALNELF  1287

Query  406   SGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIE  465
                 +      + C  ++PLM++L +       V L A+  +       G T   +++I+
Sbjct  1288  DAENIRNSE--IACQAVQPLMDILGSVSESEQEVALSALIKL-----SSGNTSNTALLID  1340

Query  466   ECGGL  470
               G L
Sbjct  1341  VEGSL  1345


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 50/278 (18%), Positives = 89/278 (32%), Gaps = 11/278 (4%)

Query  121   IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
             +P  V  L  T  S +   +  AL       +  T  + + GAI A + LL S   H  E
Sbjct  1680  LPVLVKLLFSTIESTVLL-ALKALMLHEKNDASSTVQMAELGAIDALLDLLRS---HQCE  1735

Query  181   QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             +   +L  +  +    R+L +   A+ PL   L  P   S     L      L +L +++
Sbjct  1736  EESGSLLEVIFNNPRVRELKLCKYAIAPLSQYLLDPHTRSEPGRLL--AALALGDLSQHE  1793

Query  241   NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
               +    +V      +  L      E+      A+             V + G V  + +
Sbjct  1794  GLSRSSGSVSACRALISVLEEQPTEEMKVVAICALQNFVMNSRTNRRAVAEAGGVLLIQE  1853

Query  301   LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN---PKTNIQKEATW  357
             LL +    +   A   +  +   ++   Q  +    +    + L         I  E   
Sbjct  1854  LLLSCNPEVSGQAALMVKFLF--SNHTLQEYVSNELIRSLTAALERGLWSTATINIEVLR  1911

Query  358   TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQK  395
             T++ I +              +P LV  L       Q 
Sbjct  1912  TLNVIFSNFPKLRASEAATFCIPHLVGALKSGVEDVQG  1949


> sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis 
thaliana OX=3702 GN=PUB10 PE=2 SV=1
Length=628

 Score =  112 bits (281),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/291 (15%), Positives = 101/291 (35%), Gaps = 9/291 (3%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            +  +V  ++S ++E++  A    R L  R     I  I  AG IP  V  L     +  Q
Sbjct  343  IRALVCKLSSQSIEDRRTAVSEIRSLSKRSTDNRI-LIAEAGAIPVLVKLLTSDGDTETQ  401

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              +   + N++       + ++  GA+ + + +L +      E A   L +++      +
Sbjct  402  ENAVTCILNLSIY-EHNKELIMLAGAVTSIVLVLRAGSMEARENAAATLFSLSLADEN-K  459

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
             ++   GA+  L+ LL    +        ++    L NLC  +           + P + 
Sbjct  460  IIIGASGAIMALVDLLQYGSVRG-----KKDAATALFNLCIYQGNKGRAVRAGIVKPLVK  514

Query  258  RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAI  317
             L       +  +    +S L          +++   +P L+  L   +      A   +
Sbjct  515  MLTDSSSERMADEALTILSVLA-SNQVAKTAILRANAIPPLIDCLQKDQPRNRENAAAIL  573

Query  318  GNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD  368
              +     E+   +   GA+     L  +     +++A   +  +    + 
Sbjct  574  LCLCKRDTEKLISIGRLGAVVPLMELSRDGTERAKRKANSLLELLRKSSRK  624


 Score =  109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 55/297 (19%), Positives = 115/297 (39%), Gaps = 8/297 (3%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
            D  AI A +  L+S        AV  + +++   +  R L+ + GA+  L+ LL     +
Sbjct  339  DMSAIRALVCKLSSQSIEDRRTAVSEIRSLSKRSTDNRILIAEAGAIPVLVKLLTSDGDT  398

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT  279
                  +  +   LS    NK     +  +   + ++V +L     E   +    +  L+
Sbjct  399  ETQENAVTCIL-NLSIYEHNK----ELIMLAGAVTSIVLVLRAGSMEARENAAATLFSLS  453

Query  280  DGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
                 +I ++  +G +  LV LL    +     A  A+ N+      + + V  AG +  
Sbjct  454  LADENKI-IIGASGAIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAV-RAGIVKP  511

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVW  399
               +LT+  +    +   T+ ++ A  Q     ++    +P L+  L K   + ++ A  
Sbjct  512  LVKMLTDSSSERMADEALTILSVLASNQVAKTAILRANAIPPLIDCLQKDQPRNRENAAA  571

Query  400  AVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
             +       T E+++ +   G + PLM L      +        +  + +++ KLG 
Sbjct  572  ILLCLCKRDT-EKLISIGRLGAVVPLMELSRDGTERAKRKANSLLELLRKSSRKLGS  627


 Score =  109 bits (272),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 49/279 (18%), Positives = 103/279 (37%), Gaps = 10/279 (4%)

Query  120  LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS-PHAHI  178
             I   V  L        +  +   + +++  +++    + + GAIP  + LL S      
Sbjct  342  AIRALVCKLSSQSIED-RRTAVSEIRSLSKRSTDNRILIAEAGAIPVLVKLLTSDGDTET  400

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             E AV  + N++      ++L++  GAV  ++ +L    M +       N   TL +L  
Sbjct  401  QENAVTCILNLSI-YEHNKELIMLAGAVTSIVLVLRAGSMEARE-----NAAATLFSLSL  454

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
              +    I      +  LV LL +       D   A+  L      +   V + G+V  L
Sbjct  455  A-DENKIIIGASGAIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAV-RAGIVKPL  512

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT  358
            VK+L  S    +      I +++         ++ A A+      L   +   ++ A   
Sbjct  513  VKMLTDSSSERMADEALTILSVLASNQVAKTAILRANAIPPLIDCLQKDQPRNRENAAAI  572

Query  359  MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
            +  +     +++  +   G V  L+ +      + +++A
Sbjct  573  LLCLCKRDTEKLISIGRLGAVVPLMELSRDGTERAKRKA  611


 Score = 72.7 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 83/210 (40%), Gaps = 10/210 (5%)

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP-KT  349
                +  LV  L +  +     A+  I ++   + +   ++ +AGA+ V   LLT+   T
Sbjct  339  DMSAIRALVCKLSSQSIEDRRTAVSEIRSLSKRSTDNRILIAEAGAIPVLVKLLTSDGDT  398

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGT  409
              Q+ A   + N++   +   + ++  G V  +V VL     + ++ A   +  ++    
Sbjct  399  ETQENAVTCILNLSI-YEHNKELIMLAGAVTSIVLVLRAGSMEARENAAATL--FSLSLA  455

Query  410  VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG  469
             E  + +   G I  L++LL     +       A+ N+       G   +  I+      
Sbjct  456  DENKIIIGASGAIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAVRAGIV------  509

Query  470  LDKIEALQNHENESVYKASLSLIEKYFSVE  499
               ++ L +  +E +   +L+++    S +
Sbjct  510  KPLVKMLTDSSSERMADEALTILSVLASNQ  539


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/132 (17%), Positives = 52/132 (39%), Gaps = 3/132 (2%)

Query  323  GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFL  382
                   +  D  A+      L++     ++ A   + +++    D    +   G +P L
Sbjct  329  SDGSFRDLSGDMSAIRALVCKLSSQSIEDRRTAVSEIRSLSKRSTDNRILIAEAGAIPVL  388

Query  383  VSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVIL  441
            V +L+   D +TQ+ AV  + N +     ++++ L   G +  ++ +L A   +      
Sbjct  389  VKLLTSDGDTETQENAVTCILNLSIYEHNKELIML--AGAVTSIVLVLRAGSMEARENAA  446

Query  442  DAISNIFQAAEK  453
              + ++  A E 
Sbjct  447  ATLFSLSLADEN  458


> sp|Q9VM21|GUDU_DROME Armadillo repeat-containing protein gudu 
OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
Length=669

 Score =  112 bits (281),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 56/399 (14%), Positives = 141/399 (35%), Gaps = 18/399 (5%)

Query  62   SPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLI  121
               +       T    + DIV  ++S N E +++ + A  K          D +  AG +
Sbjct  277  CSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAF--DGTTRDLVREAGGL  334

Query  122  PKFVSFLGRTD---CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI  178
               V+ +   +     P+   +  A+  + + T    K +     +   ++LL      +
Sbjct  335  EPLVTIIKDKNVRENKPLLRGATGAIW-MCAVTDANVKVLDQLRTVNHLVALLNDECDEV  393

Query  179  SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
                  A+       S  R+ + + G +  +++LL            L NL   L     
Sbjct  394  LTNVTGAISECVRFQSN-REQLRQAGGLPAMVSLLNSSHAP-----LLENLAKGLKECAE  447

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVK-TGVVPQ  297
            + +    ++ ++  +  +  LL +    V A   +AI       N+   +V    G +  
Sbjct  448  DPDSMRILEDLD-AVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMEL  506

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            +V LL + ++ +++    AI  I         ++ D   +     L+      ++     
Sbjct  507  VVGLLKSKDIMVLSAVCAAIATIAQ-DQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAA  565

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLV  417
             ++       +  +++     V  +V+ ++  +    +    A+   +     +  + + 
Sbjct  566  AVAACACFG-NNTEELGRLRTVTPIVTYMTSDNPLVHRSTAMALEKLSMD--PQNCITMH  622

Query  418  HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
              G++  L+  + + + ++ L     + NI + A +  E
Sbjct  623  QSGVVPFLLECIGSTNKELQLAAAGCLRNIRELALRAEE  661


 Score =  101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 85/469 (18%), Positives = 167/469 (36%), Gaps = 79/469 (17%)

Query  39   RKAKKDDQ-------MLK-RRNVSSFPDDATSPLQENRNNQGTVN-----------WSVD  79
            R  KK +Q         K +R V++   D T         +               +++ 
Sbjct  12   RSRKKKEQCGSCPNRFSKDKRQVAAEDSDTTEVESSTDEEERWKEVARAAEIPADYYNIQ  71

Query  80   DIVKGINSSNVENQLQATQAARK--LLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
             +VK I + N    + +    +   L ++  Q  I +I   G +   V+ L  +D     
Sbjct  72   KLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDI---GGLDVLVNILECSDTKC--  126

Query  138  FESAWALTNIA--SGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
                 AL  ++  +   +  K +VD   IP  + +L S    +   A   L N+     +
Sbjct  127  --CLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANV-CKVRL  183

Query  196  FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT  255
             R  V   G +  L+ L+ +                 LS L   ++   P D     L +
Sbjct  184  ARKYVRTCGGIPKLVDLIDIK----------------LSILKTPRDQLSPDD-----LES  222

Query  256  LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR  315
            L         ++      A+  L D  +    M  K+G+VP + +LL +  + +V P + 
Sbjct  223  L---------DMTRAGARALFTLADSKHNMEQM-RKSGIVPLMAQLLKSCHIDVVIPIMG  272

Query  316  AIGNIVTGTDEQTQVVI-DAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV  374
             +      ++ + Q+ I   G +    S L++  T ++ E +  +    A        V 
Sbjct  273  TVRK--CSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYK-CAFDGTTRDLVR  329

Query  375  NHGLVPFLVSVLSKADFKTQKE----AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT  430
              G +  LV+++   + +  K     A  A+  +    T   +  L     +  L+ LL 
Sbjct  330  EAGGLEPLVTIIKDKNVRENKPLLRGATGAI--WMCAVTDANVKVLDQLRTVNHLVALLN  387

Query  431  AKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNH  479
             +  +++  +  AIS   +        +     + + GGL  + +L N 
Sbjct  388  DECDEVLTNVTGAISECVRF-------QSNREQLRQAGGLPAMVSLLNS  429


> sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana 
OX=3702 GN=FBX5 PE=1 SV=1
Length=930

 Score =  110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 66/381 (17%), Positives = 132/381 (35%), Gaps = 59/381 (15%)

Query  74   VNWSVDDIVKGINSSNVENQ-LQATQAARKLLSREKQPPIDN-----IIRAGLIPKFVSF  127
            +N     ++  + SS  + Q   AT  A  ++  ++   ID      +++ G I   +  
Sbjct  387  LNEGAALLLNLMQSSQEDVQERSATGLATFVVVDDENASIDCGRAEAVMKDGGIRLLLE-  445

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALG  187
            L ++    +Q E+A A+ N+ S  +   K+V + G I     L  S +  ++E+A   L 
Sbjct  446  LAKSWREGLQSEAAKAIANL-SVNANIAKSVAEEGGIKILAGLAKSMNRLVAEEAAGGLW  504

Query  188  NIAGDGSVFRDLVIKYGAVDPLLALL--------------------AVPDMSSLACGYLR  227
            N++  G   ++ + + G V  L+ L+                       D          
Sbjct  505  NLSV-GEEHKNAIAQAGGVKALVDLIFRWPNGCDGVLERAAGALANLAADDKCSMEVAKA  563

Query  228  NLTWTLSNLCRN-----------------------KNPAPPIDAVEQILPTLVRLLHHDD  264
                 L  L RN                        N    +      L  LV+L     
Sbjct  564  GGVHALVMLARNCKYEGVQEQAARALANLAAHGDSNNNNAAVGQEAGALEALVQLTKSPH  623

Query  265  PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP---IVTPALRAIGNIV  321
              V  +   A+  L+   ++    +   G V  LV L  +       +   A  A+  + 
Sbjct  624  EGVRQEAAGALWNLSF-DDKNRESISVAGGVEALVALAQSCSNASTGLQERAAGALWGLS  682

Query  322  TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPF  381
              ++  +  +   G +    +L  +   ++ + A   + N+     + ++ +V  G VP 
Sbjct  683  V-SEANSVAIGREGGVPPLIALARSEAEDVHETAAGALWNLAFNPGNALR-IVEEGGVPA  740

Query  382  LVSVLSKA-DFKTQKEAVWAV  401
            LV + S +     +  A  A+
Sbjct  741  LVHLCSSSVSKMARFMAALAL  761


 Score =  101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 67/348 (19%), Positives = 123/348 (35%), Gaps = 37/348 (11%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGN-IAGDGSV------FRDLVIKYGAVDPLLA  211
            ++ GA    ++L+ S    + E++   L   +  D           + V+K G +  LL 
Sbjct  387  LNEGA-ALLLNLMQSSQEDVQERSATGLATFVVVDDENASIDCGRAEAVMKDGGIRLLLE  445

Query  212  LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT  271
            L       S   G        ++NL  N N      A E  +  L  L    +  V  + 
Sbjct  446  L-----AKSWREGLQSEAAKAIANLSVNAN-IAKSVAEEGGIKILAGLAKSMNRLVAEEA  499

Query  272  CWAISYLTDGPNERIGMVVKTGVVPQLVKLL----GASELPIVTPALRAIGNIVTGTDEQ  327
               +  L+ G  E    + + G V  LV L+       +  +   A       +   D+ 
Sbjct  500  AGGLWNLSVG-EEHKNAIAQAGGVKALVDLIFRWPNGCDGVLERAAGALAN--LAADDKC  556

Query  328  TQVVIDAGALAVFPSLLTNPK-TNIQKEATWTMSNITAGRQDQIQQVV---NHGLVPFLV  383
            +  V  AG +     L  N K   +Q++A   ++N+ A               G +  LV
Sbjct  557  SMEVAKAGGVHALVMLARNCKYEGVQEQAARALANLAAHGDSNNNNAAVGQEAGALEALV  616

Query  384  SVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL-TAKDTK--IILVI  440
             +        ++EA  A+ N +      + + +   G +E L+ L  +  +    +    
Sbjct  617  QLTKSPHEGVRQEAAGALWNLSFDDKNRESISV--AGGVEALVALAQSCSNASTGLQERA  674

Query  441  LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS  488
              A+         L  +E  S+ I   GG+  + AL   E E V++ +
Sbjct  675  AGAL-------WGLSVSEANSVAIGREGGVPPLIALARSEAEDVHETA  715


 Score =  100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 71/368 (19%), Positives = 131/368 (36%), Gaps = 33/368 (9%)

Query  128  LGRTDCSPIQFESAWALTNIASGTSEQT-------KAVVDGGAIPAFISLLASPHAHISE  180
            L ++    +Q  SA  L        E         +AV+  G I   + L  S    +  
Sbjct  397  LMQSSQEDVQERSATGLATFVVVDDENASIDCGRAEAVMKDGGIRLLLELAKSWREGLQS  456

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
            +A  A+ N++ + ++ +  V + G +  L  L     M+ L         W LS    +K
Sbjct  457  EAAKAIANLSVNANIAKS-VAEEGGIKILAGLAKS--MNRLVAEEAAGGLWNLSVGEEHK  513

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEV--LADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
            N           +  LV L+         + +            ++    V K G V  L
Sbjct  514  NAIAQ----AGGVKALVDLIFRWPNGCDGVLERAAGALANLAADDKCSMEVAKAGGVHAL  569

Query  299  VKLLGASELP-IVTPALRAIGNIVTGTD---EQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
            V L    +   +   A RA+ N+    D       V  +AGAL     L  +P   +++E
Sbjct  570  VMLARNCKYEGVQEQAARALANLAAHGDSNNNNAAVGQEAGALEALVQLTKSPHEGVRQE  629

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK---ADFKTQKEAVWAVTNYTSGGTVE  411
            A   + N++   +++ + +   G V  LV++      A    Q+ A  A+   +      
Sbjct  630  AAGALWNLSFDDKNR-ESISVAGGVEALVALAQSCSNASTGLQERAAGALWGLSVSEANS  688

Query  412  QIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD  471
              V +   G + PL+ L  ++   +      A+ N+             ++ I E GG+ 
Sbjct  689  --VAIGREGGVPPLIALARSEAEDVHETAAGALWNL-------AFNPGNALRIVEEGGVP  739

Query  472  KIEALQNH  479
             +  L + 
Sbjct  740  ALVHLCSS  747


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 61/371 (16%), Positives = 120/371 (32%), Gaps = 64/371 (17%)

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
              DD  + +   R      +  +  +++   S     Q +A +A   L S        ++
Sbjct  418  VVDDENASIDCGRAEAVMKDGGIRLLLELAKSWREGLQSEAAKAIANL-SVNANIA-KSV  475

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL----  171
               G I      L ++    +  E+A  L N++ G  E   A+   G + A + L+    
Sbjct  476  AEEGGIKILAG-LAKSMNRLVAEEAAGGLWNLSVG-EEHKNAIAQAGGVKALVDLIFRWP  533

Query  172  -----------------------------------------ASPHAHISEQAVWALGNIA  190
                                                        +  + EQA  AL N+A
Sbjct  534  NGCDGVLERAAGALANLAADDKCSMEVAKAGGVHALVMLARNCKYEGVQEQAARALANLA  593

Query  191  --GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
              GD +     V  + GA++ L+ L   P       G  +     L NL  + +      
Sbjct  594  AHGDSNNNNAAVGQEAGALEALVQLTKSPHE-----GVRQEAAGALWNLSFD-DKNRESI  647

Query  248  AVEQILPTLVRLLHH---DDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            +V   +  LV L          +      A+  L+         + + G VP L+ L  +
Sbjct  648  SVAGGVEALVALAQSCSNASTGLQERAAGALWGLSV-SEANSVAIGREGGVPPLIALARS  706

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI-QKEATWTMSNIT  363
                +   A  A+ N+          +++ G +     L ++  + + +  A   ++ + 
Sbjct  707  EAEDVHETAAGALWNLAF-NPGNALRIVEEGGVPALVHLCSSSVSKMARFMAALALAYMF  765

Query  364  AGRQDQIQQVV  374
             GR D+   ++
Sbjct  766  DGRMDEYALMI  776


> sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis 
thaliana OX=3702 GN=UPL4 PE=3 SV=1
Length=1502

 Score =  108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 77/474 (16%), Positives = 176/474 (37%), Gaps = 64/474 (14%)

Query  54   SSFPDDATSPLQENRNNQGTVN-WSVDDIVKGINSS-NVENQLQATQAARKLLSREKQPP  111
            S   D     LQ+ +  + + +   +  ++  +    +   QL       ++LS   +  
Sbjct  86   SDEEDPRQRVLQDYQRQRSSGDHGKLKSLLLNLTGETDPSGQLSRLTELCEVLSFSTEES  145

Query  112  IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS-L  170
            + +++   L P  V      + + I   +  A+T +        + +V    IPA    L
Sbjct  146  LSSVMANMLSPVLVKLAKHENNADIMLLAIRAITYLCDVYPPSVEFLVRHDTIPALCQRL  205

Query  171  LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLT  230
            L   +  ++EQ + AL  I+ D  V     +  GA+  +L+ +        +    R   
Sbjct  206  LTIEYLDVAEQCLQALEKISRDEPV---ACLNAGAIMAVLSFIDF-----FSTSIQRVAI  257

Query  231  WTLSNLCRN---KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE---  284
             T+ N+C+    ++P+P +DAV    P L  LL ++D +++ +    ++ + D  +E   
Sbjct  258  STVVNICKQLSSESPSPFMDAV----PILCTLLQYEDRQLVENVAICLTKIADQASESPA  313

Query  285  RIGMVVKTGVV---PQLVKL--LGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV  339
             +  + + G++     L+ L        P+    +  +  + +G+    + + +      
Sbjct  314  MLDQLCRHGLINESTHLLNLNSRTTLSQPVYNGVIGMLRKLSSGSALAFRTLYELNIGYS  373

Query  340  FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN------------------------  375
               +++    +    +T  ++  +    + ++ V+                         
Sbjct  374  LKEIMSTYDISHSVSSTHPINACSNQVHEVLKLVIELLPASPVEDNQLASEKESFLVNQP  433

Query  376  -------HGLVPFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQIVYLVH-CGIIEPLM  426
                     ++P ++ VL+  A+       + A+   T       IV L+    +   L 
Sbjct  434  DLLQQFGRDMLPVMIQVLNSGANVYVSYGCLSAIHKLTCLSKSGDIVELLKNTNMSSVLA  493

Query  427  NLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE  480
             +L+ KD  +I+V L     + +          L+  I+E G    IEAL + +
Sbjct  494  GILSRKDHHVIVVALQVAEVLLEKYRD----TFLNSFIKE-GVFFAIEALLSSD  542


> sp|E4NKF8|PUB1_MEDTR U-box domain-containing protein 1 OS=Medicago 
truncatula OX=3880 GN=PUB1 PE=1 SV=1
Length=694

 Score =  105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/276 (20%), Positives = 112/276 (41%), Gaps = 9/276 (3%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
             V  L     + IQ +SA+ +  +A    +  + + + GAIP  ++LL S  + I E  V
Sbjct  408  LVGKLATGS-TDIQRQSAYEIRLLAKTGMDNRRIIAEVGAIPFLVTLLVSKDSRIQEHVV  466

Query  184  WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
             AL N++      + L++  GA+D ++ +L              N    + +L    +  
Sbjct  467  TALFNLSIYD-NNKILIMAAGAIDNIVEVLEFGKTMEARE----NAAAAIYSLSMIDDCK  521

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
              I A  + +P LV LL         D   A+  L      ++  +VK+G V  LV+LL 
Sbjct  522  VQIGASSRAIPALVGLLKEGTIIGKRDAATALFNLAVYNPNKLS-IVKSGAVTLLVELLM  580

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
              +  I   +L  +  ++  ++   ++      + +   LL       ++ +   +  + 
Sbjct  581  DDKAGITDDSLAVLAVLLGCSEGLEEIKNSKSLVPLLIDLLRFGSVKGKENSITLLLGLC  640

Query  364  AGRQDQIQQ--VVNHGLVPFLVSVLSKADFKTQKEA  397
                + +    + N   +P L S+ +    + +++A
Sbjct  641  KEEGELVAMRLLANPRSIPSLQSLAADGSLRARRKA  676


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 64/326 (20%), Positives = 124/326 (38%), Gaps = 17/326 (5%)

Query  42   KKDDQMLKRRNVSSFP---DDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQ  98
            K ++ + K  N SS     ++A   + EN+ ++  V  + + +V  + + + + Q Q+  
Sbjct  366  KMNEAITKNNNSSSKRHKNENAIDHISENKASKDAVKMTAEFLVGKLATGSTDIQRQSAY  425

Query  99   AARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV  158
              R LL++        I   G IP  V+ L   D S IQ     AL N++         +
Sbjct  426  EIR-LLAKTGMDNRRIIAEVGAIPFLVTLLVSKD-SRIQEHVVTALFNLSIY-DNNKILI  482

Query  159  VDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            +  GAI   + +L         E A  A+ +++        +     A+  L+ LL    
Sbjct  483  MAAGAIDNIVEVLEFGKTMEARENAAAAIYSLSMIDDCKVQIGASSRAIPALVGLLKEGT  542

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
            +        R+    L NL    NP          +  LV LL  D   +  D+   ++ 
Sbjct  543  IIG-----KRDAATALFNLAVY-NPNKLSIVKSGAVTLLVELLMDDKAGITDDSLAVLAV  596

Query  278  LTDGPNERIGMVVKTG-VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAG-  335
            L  G +E +  +  +  +VP L+ LL    +     ++  +  +     E   + + A  
Sbjct  597  L-LGCSEGLEEIKNSKSLVPLLIDLLRFGSVKGKENSITLLLGLCKEEGELVAMRLLANP  655

Query  336  -ALAVFPSLLTNPKTNIQKEATWTMS  360
             ++    SL  +     +++A   + 
Sbjct  656  RSIPSLQSLAADGSLRARRKADALLR  681


 Score = 49.2 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 49/114 (43%), Gaps = 9/114 (8%)

Query  380  PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV  439
             FLV  L+      Q+++ + +      G ++    +   G I  L+ LL +KD++I   
Sbjct  406  EFLVGKLATGSTDIQRQSAYEIRLLAKTG-MDNRRIIAEVGAIPFLVTLLVSKDSRIQEH  464

Query  440  ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EALQNHENESVYKASLSLI  492
            ++ A+ N+          +   I+I   G +D I E L+  +     + + + I
Sbjct  465  VVTALFNLSIY-------DNNKILIMAAGAIDNIVEVLEFGKTMEARENAAAAI  511


 Score = 49.2 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 3/111 (3%)

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
                  L    T+IQ+++ + +  +     D  + +   G +PFLV++L   D + Q+  
Sbjct  406  EFLVGKLATGSTDIQRQSAYEIRLLAKTGMDNRRIIAEVGAIPFLVTLLVSKDSRIQEHV  465

Query  398  VWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT-AKDTKIILVILDAISNI  447
            V A+ N +     +  + ++  G I+ ++ +L   K  +       AI ++
Sbjct  466  VTALFNLSIYDNNK--ILIMAAGAIDNIVEVLEFGKTMEARENAAAAIYSL  514


> sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis 
thaliana OX=3702 GN=PUB15 PE=2 SV=2
Length=660

 Score =  105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 56/281 (20%), Positives = 109/281 (39%), Gaps = 10/281 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +   V  L  +     Q  S   +  +A    E    + + GAIP  + LL+ P + I E
Sbjct  381  VSLLVEALSSSQLEE-QRRSVKQMRLLARENPENRVLIANAGAIPLLVQLLSYPDSGIQE  439

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             AV  L N++ D  V + L+   GA+  ++ +L   +  +          ++LS L  NK
Sbjct  440  NAVTTLLNLSID-EVNKKLISNEGAIPNIIEILENGNREARENSAA--ALFSLSMLDENK  496

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
                    +   +P LV LL H       D   A+  L+     +   +   G+V  L+ 
Sbjct  497  V----TIGLSNGIPPLVDLLQHGTLRGKKDALTALFNLSLNSANKGRAI-DAGIVQPLLN  551

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
            LL    L ++  AL  +  + +  + + Q +     +      +       ++ AT  + 
Sbjct  552  LLKDKNLGMIDEALSILLLLASHPEGR-QAIGQLSFIETLVEFIRQGTPKNKECATSVLL  610

Query  361  NITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV  401
             + +     I   +  G+  +LV + +    + Q++A   +
Sbjct  611  ELGSNNSSFILAALQFGVYEYLVEITTSGTNRAQRKANALI  651


 Score = 99.3 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 66/313 (21%), Positives = 118/313 (38%), Gaps = 18/313 (6%)

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
             P+   SP  +N          V  +V+ ++SS +E Q ++ +  R LL+RE       I
Sbjct  364  IPEKEVSPDSQNEQKD-----EVSLLVEALSSSQLEEQRRSVKQMR-LLARENPENRVLI  417

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH  175
              AG IP  V  L   D S IQ  +   L N++       K + + GAIP  I +L + +
Sbjct  418  ANAGAIPLLVQLLSYPD-SGIQENAVTTLLNLSIDEV-NKKLISNEGAIPNIIEILENGN  475

Query  176  AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSN  235
                E +  AL +++      +  +     + PL+ LL    +        ++    L N
Sbjct  476  REARENSAAALFSLSMLDEN-KVTIGLSNGIPPLVDLLQHGTLRG-----KKDALTALFN  529

Query  236  LCRNK-NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
            L  N  N    IDA   I+  L+ LL   +  ++ +    +  L   P E    + +   
Sbjct  530  LSLNSANKGRAIDA--GIVQPLLNLLKDKNLGMIDEALSILLLLASHP-EGRQAIGQLSF  586

Query  295  VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
            +  LV+ +          A   +  + +         +  G       + T+     Q++
Sbjct  587  IETLVEFIRQGTPKNKECATSVLLELGSNNSSFILAALQFGVYEYLVEITTSGTNRAQRK  646

Query  355  ATWTMSNITAGRQ  367
            A   +  I+   Q
Sbjct  647  ANALIQLISKSEQ  659


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 69/172 (40%), Gaps = 4/172 (2%)

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP  312
            +  LV  L     E    +   +  L     E   ++   G +P LV+LL   +  I   
Sbjct  381  VSLLVEALSSSQLEEQRRSVKQMRLLARENPENRVLIANAGAIPLLVQLLSYPDSGIQEN  440

Query  313  ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ  372
            A+  + N+    +   +++ + GA+     +L N     ++ +   + +++    +    
Sbjct  441  AVTTLLNLSI-DEVNKKLISNEGAIPNIIEILENGNREARENSAAALFSLSM-LDENKVT  498

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
            +     +P LV +L     + +K+A+ A+ N +     +     +  GI++P
Sbjct  499  IGLSNGIPPLVDLLQHGTLRGKKDALTALFNLSLNSANKGRA--IDAGIVQP  548


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 49/117 (42%), Gaps = 2/117 (2%)

Query  337  LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE  396
            +++    L++ +   Q+ +   M  +     +    + N G +P LV +LS  D   Q+ 
Sbjct  381  VSLLVEALSSSQLEEQRRSVKQMRLLARENPENRVLIANAGAIPLLVQLLSYPDSGIQEN  440

Query  397  AVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            AV  + N +     ++++   + G I  ++ +L   + +       A+ ++    E 
Sbjct  441  AVTTLLNLSIDEVNKKLIS--NEGAIPNIIEILENGNREARENSAAALFSLSMLDEN  495


> sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus 
musculus OX=10090 GN=Armc3 PE=1 SV=1
Length=881

 Score =  104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 58/274 (21%), Positives = 117/274 (43%), Gaps = 13/274 (5%)

Query  240  KNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLV  299
            K+   PI    +   T+V +L   + ++LA  C AI        E    +++ G V  L 
Sbjct  14   KDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEPLT  73

Query  300  KLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
            KLL   +  +   A+   G + + +D +  +       +V   L    +  I + A+  +
Sbjct  74   KLLTHEDKTVRRNAMMIFGILASNSDVKKLLRELEVMNSVIAQLSPEEEVVIHEFASLCL  133

Query  360  SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC  419
            +N++     ++Q +  HG +  L+ +LS +D   +K ++  + N       +    L   
Sbjct  134  ANMSVEYTGKVQ-IFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQD--FQCRTTLQEL  190

Query  420  GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI-EALQN  478
              I P++ LL ++   I L+ L  +  I    E          M++E  GLD + + L+ 
Sbjct  191  NAIPPILELLRSEYPIIQLLALKTLGVITCDKEA-------RTMLKENQGLDHLTKILET  243

Query  479  HENESVYKASLSLIEKYFSVEEEEDQNVVPETTS  512
             E   ++  +LS+I     +E+ +   ++ +T S
Sbjct  244  KELNDLHVEALSVIAN--CLEDMDTMVLMQQTGS  275


 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/274 (18%), Positives = 109/274 (40%), Gaps = 15/274 (5%)

Query  168  ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
            + +L SP   I  +A  A+   A  G   +  +++ GAV+PL  LL   D         R
Sbjct  31   VLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDK-----TVRR  85

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD--TCWAISYLTDGPNER  285
            N       L  N +    +  +E +   + +L    + EV+        ++ ++     +
Sbjct  86   NAMMIFGILASNSDVKKLLRELEVMNSVIAQL--SPEEEVVIHEFASLCLANMSVEYTGK  143

Query  286  IGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT  345
            +  + + G +  L++LL +S+  +   ++  I N+V     +T  + +  A+     LL 
Sbjct  144  VQ-IFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDFQCRT-TLQELNAIPPILELLR  201

Query  346  NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF-KTQKEAVWAVTNY  404
            +    IQ  A  T+  IT   ++    +  +  +  L  +L   +      EA+  + N 
Sbjct  202  SEYPIIQLLALKTLGVITC-DKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANC  260

Query  405  TSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIIL  438
                 ++ +V +   G ++ +++   +     I 
Sbjct  261  LED--MDTMVLMQQTGSLKKVLSFAESSTIPDIQ  292


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 71/452 (16%), Positives = 154/452 (34%), Gaps = 61/452 (13%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            V+ + K +   +   +  A      L S      +  +    ++   ++ L   +   I 
Sbjct  69   VEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKL--LRELEVMNSVIAQLSPEEEVVIH  126

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR  197
              ++  L N++   + + + + + G +   I LL+S    + + ++  + N+  D    R
Sbjct  127  EFASLCLANMSVEYTGKVQ-IFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDF-QCR  184

Query  198  DLVIKYGAVDPLLALL--AVPDMSSLACGYLRNLTW-----TLSNLCRNKNPAPPIDAVE  250
              + +  A+ P+L LL    P +  LA   L  +T      T+    +  +    I   +
Sbjct  185  TTLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETK  244

Query  251  Q-------ILPTLVRLLHHDDPEVLADTCWAI------SYLTDGPN--------------  283
            +        L  +   L   D  VL     ++      +  +  P+              
Sbjct  245  ELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSFAESSTIPDIQKNAAKAIAKAAY  304

Query  284  --ERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG----NIVTGTDEQTQVVIDAGAL  337
              E   +  +  V   LV LLG+        A +AI     N+        +   +   +
Sbjct  305  DPENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSC------KEFFNTQGI  358

Query  338  AVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
                 LL +    +++ A   ++N+T               +  L+++LS         A
Sbjct  359  PQIVQLLRSDNEEVREAAALALANLTTSSPANANAAAEADAIDPLINILSSKRDGAIANA  418

Query  398  VWAVTNYTSGGTVEQIVYLVH-CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGE  456
               +TN     T E +  ++    I+  L+  L + +T +       ++      E    
Sbjct  419  ATVLTNMA---TQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEA---  472

Query  457  TEKLSIMIEECGGLDKIEALQNHENESVYKAS  488
                   +  CGGL  +  L + +N+ V + +
Sbjct  473  ----RTQLRNCGGLVPLVGLLHSKNDEVRRHA  500


 Score = 93.5 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 72/391 (18%), Positives = 143/391 (37%), Gaps = 25/391 (6%)

Query  102  KLLSREKQPPIDNIIRAGLI----PKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKA  157
            K + +E +PP  ++     I       V  + ++    I  ++  A+   A    E    
Sbjct  3    KKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKAT  62

Query  158  VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            +++ GA+     LL      +   A+   G I    S  + L+ +   ++ ++A L+   
Sbjct  63   LLELGAVEPLTKLLTHEDKTVRRNAMMIFG-ILASNSDVKKLLRELEVMNSVIAQLS---  118

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
                        +  L+N+                L  L+RLL   DP+V  ++   I  
Sbjct  119  -PEEEVVIHEFASLCLANMSVEYT-GKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYN  176

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L      R   + +   +P +++LL +    I   AL+ +G I    + +T +  + G L
Sbjct  177  LVQDFQCRT-TLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQG-L  234

Query  338  AVFPSLLTNPKTN-IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF-KTQK  395
                 +L   + N +  EA   ++N      D +  +   G +  ++S    +     QK
Sbjct  235  DHLTKILETKELNDLHVEALSVIAN-CLEDMDTMVLMQQTGSLKKVLSFAESSTIPDIQK  293

Query  396  EAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLG  455
             A  A+          ++ +     + + L+ LL +      +    AIS +    E L 
Sbjct  294  NAAKAIAKAAYDPENRKVFH--EQEVEKCLVTLLGSDSDGTKIAASQAISALC---ENLS  348

Query  456  ETEKLSIMIEECGGLDKIEALQNHENESVYK  486
              E  +       G+ +I  L   +NE V +
Sbjct  349  CKEFFNT-----QGIPQIVQLLRSDNEEVRE  374


 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 56/406 (14%), Positives = 124/406 (31%), Gaps = 97/406 (24%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQ  137
            ++ +++ ++SS+ + +  + +    L+  +       +     IP  +  L R++   IQ
Sbjct  152  LEPLIRLLSSSDPDVKKNSIECIYNLV--QDFQCRTTLQELNAIPPILELL-RSEYPIIQ  208

Query  138  FESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAGD----  192
              +   L  I +   E    + +   +     +L +     +  +A+  + N   D    
Sbjct  209  LLALKTLGVI-TCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTM  267

Query  193  -------------------------------------GSVFRDLVIKYGAVDPLLALLAV  215
                                                     R +  +      L+ LL  
Sbjct  268  VLMQQTGSLKKVLSFAESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLL-G  326

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
             D            +  +S LC N +     +   Q +P +V+LL  D+ EV      A+
Sbjct  327  SDSDGTKIA----ASQAISALCENLSCKEFFNT--QGIPQIVQLLRSDNEEVREAAALAL  380

Query  276  SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVT-------------  322
            + LT           +   +  L+ +L +     +  A   + N+ T             
Sbjct  381  ANLTTSSPANANAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEI  440

Query  323  ----------------------------GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
                                          + +TQ+  + G L     LL +    +++ 
Sbjct  441  MHALLGPLHSTNTLVQSTAALTVAATACDVEARTQLR-NCGGLVPLVGLLHSKNDEVRRH  499

Query  355  ATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ-KEAVW  399
            A+W +  + AG +    ++   G +  L  +      K +  EA +
Sbjct  500  ASWAVM-VCAGDEPMAVELCRLGALNILEEINRSLSRKNKFSEAAY  544


 Score = 47.3 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 61/194 (31%), Gaps = 44/194 (23%)

Query  57   PDDATSPLQENRNNQGTVNWS-VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
               A S L EN + +   N   +  IV+ + S N E +  A  A   L +          
Sbjct  336  ASQAISALCENLSCKEFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANAAA  395

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTS-----------------------  152
                 I   ++ L       I   +A  LTN+A+                          
Sbjct  396  EAD-AIDPLINILSSKRDGAIA-NAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNT  453

Query  153  -----------------EQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSV  195
                             E    + + G +   + LL S +  +   A WA+   AGD  +
Sbjct  454  LVQSTAALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPM  513

Query  196  FRDLVIKYGAVDPL  209
              +L  + GA++ L
Sbjct  514  AVELC-RLGALNIL  526


> sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana 
OX=3702 GN=At3g60350 PE=2 SV=1
Length=928

 Score =  104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 72/421 (17%), Positives = 148/421 (35%), Gaps = 65/421 (15%)

Query  38   LRKAKK-DDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDD----IVKGINSSNVEN  92
            +RK K  D+ ML    +          + E+ N+QG  ++ ++     ++  + S+  + 
Sbjct  340  IRKDKSIDEIML---WIEWIISHTLLRIAESSNSQGLNDFWLNQGATLLLSLMQSAQEDV  396

Query  93   Q-LQATQAARKLLSREKQPPIDN-----IIRAGLIPKFVSFLGRTDCSPIQFESAWALTN  146
            Q   AT  A  ++  ++   ID      ++R G I   +  L ++    +Q E+A A+ N
Sbjct  397  QERAATGLATFIVVDDENASIDCGRAEAVMRDGGIRLLLE-LAKSWREGLQSEAAKAIAN  455

Query  147  IASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAV  206
            + S  ++  KAV + G I     L  S +  ++E+A   L N++  G   ++ + + G V
Sbjct  456  L-SVNAKVAKAVAEEGGISVLADLAKSMNRLVAEEAAGGLWNLSV-GEEHKNAIAQAGGV  513

Query  207  DPLLALL--------------------AVPDMSSLACGYLRNLTWTLSNLCRNKNPA---  243
            + L+ L+                       D               L  L RN       
Sbjct  514  NALVDLIFRWPHGCDGVLERAAGALANLAADDKCSMEVARAGGVHALVMLARNCKYEGAQ  573

Query  244  --------------------PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPN  283
                                  +      L  LV+L       V  +   A+  L    +
Sbjct  574  EQAARALANLAAHGDSNGNNAAVGQEAGALEALVQLTQSPHEGVKQEAAGALWNLAF-DD  632

Query  284  ERIGMVVKTGVVPQLVKLLGASELP---IVTPALRAIGNIVTGTDEQTQVVIDAGALAVF  340
            +    +   G V  LV L  +S      +      A+  +   ++  +  +   G +   
Sbjct  633  KNRESIAAFGGVEALVALAKSSSNASTGLQERVAGALWGLSV-SEANSIAIGHEGGIPPL  691

Query  341  PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWA  400
             +L+ +   ++ + A   + N++    + ++ V   G+V  +    S      +  A  A
Sbjct  692  IALVRSEAEDVHETAAGALWNLSFNPGNALRIVEEGGVVALVQLCSSSVSKMARFMAALA  751

Query  401  V  401
            +
Sbjct  752  L  752


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 71/345 (21%), Positives = 119/345 (34%), Gaps = 31/345 (9%)

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGN-IAGDGSV------FRDLVIKYGAVDPLLA  211
            ++ GA    +SL+ S    + E+A   L   I  D           + V++ G +  LL 
Sbjct  378  LNQGAT-LLLSLMQSAQEDVQERAATGLATFIVVDDENASIDCGRAEAVMRDGGIRLLLE  436

Query  212  LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT  271
            L       S   G        ++NL  N   A    A E  +  L  L    +  V  + 
Sbjct  437  L-----AKSWREGLQSEAAKAIANLSVNAKVAKA-VAEEGGISVLADLAKSMNRLVAEEA  490

Query  272  CWAISYLTDGPNERIGMVVKTGVVPQLVKLL---GASELPIVTPALRAIGNIVTGTDEQT  328
               +  L+ G  E    + + G V  LV L+         ++  A  A    +   D+ +
Sbjct  491  AGGLWNLSVG-EEHKNAIAQAGGVNALVDLIFRWPHGCDGVLERAAGA-LANLAADDKCS  548

Query  329  QVVIDAGALAVFPSLLTNPK-TNIQKEATWTMSNITAGRQDQIQQVV---NHGLVPFLVS  384
              V  AG +     L  N K    Q++A   ++N+ A               G +  LV 
Sbjct  549  MEVARAGGVHALVMLARNCKYEGAQEQAARALANLAAHGDSNGNNAAVGQEAGALEALVQ  608

Query  385  VLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAI  444
            +        ++EA  A+ N            +   G +E L+ L  +            +
Sbjct  609  LTQSPHEGVKQEAAGALWNLAFDDKNR--ESIAAFGGVEALVALAKSS-----SNASTGL  661

Query  445  -SNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS  488
               +  A   L  +E  SI I   GG+  + AL   E E V++ +
Sbjct  662  QERVAGALWGLSVSEANSIAIGHEGGIPPLIALVRSEAEDVHETA  706


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 71/370 (19%), Positives = 132/370 (36%), Gaps = 29/370 (8%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQT-------KAVVDGGAIPAFISLLASPHA  176
             +  L ++    +Q  +A  L        E         +AV+  G I   + L  S   
Sbjct  384  LLLSLMQSAQEDVQERAATGLATFIVVDDENASIDCGRAEAVMRDGGIRLLLELAKSWRE  443

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
             +  +A  A+ N++ +  V +  V + G +  L  L     M+ L         W LS  
Sbjct  444  GLQSEAAKAIANLSVNAKVAK-AVAEEGGISVLADLAKS--MNRLVAEEAAGGLWNLSVG  500

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP  296
              +KN       V  ++  + R  H  D   + +            ++    V + G V 
Sbjct  501  EEHKNAIAQAGGVNALVDLIFRWPHGCDG--VLERAAGALANLAADDKCSMEVARAGGVH  558

Query  297  QLVKLLGASELP-IVTPALRAIGNIVTGTD---EQTQVVIDAGALAVFPSLLTNPKTNIQ  352
             LV L    +       A RA+ N+    D       V  +AGAL     L  +P   ++
Sbjct  559  ALVMLARNCKYEGAQEQAARALANLAAHGDSNGNNAAVGQEAGALEALVQLTQSPHEGVK  618

Query  353  KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK---ADFKTQKEAVWAVTNYTSGGT  409
            +EA   + N+    +++ + +   G V  LV++      A    Q+    A+   +    
Sbjct  619  QEAAGALWNLAFDDKNR-ESIAAFGGVEALVALAKSSSNASTGLQERVAGALWGLSVSEA  677

Query  410  VEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG  469
                + + H G I PL+ L+ ++   +      A+ N+             ++ I E GG
Sbjct  678  NS--IAIGHEGGIPPLIALVRSEAEDVHETAAGALWNL-------SFNPGNALRIVEEGG  728

Query  470  LDKIEALQNH  479
            +  +  L + 
Sbjct  729  VVALVQLCSS  738


 Score = 67.7 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 114/370 (31%), Gaps = 64/370 (17%)

Query  56   FPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI  115
              DD  + +   R      +  +  +++   S     Q +A +A   L           +
Sbjct  409  VVDDENASIDCGRAEAVMRDGGIRLLLELAKSWREGLQSEAAKAIANLSV--NAKVAKAV  466

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL----  171
               G I      L ++    +  E+A  L N++ G  E   A+   G + A + L+    
Sbjct  467  AEEGGISVLAD-LAKSMNRLVAEEAAGGLWNLSVG-EEHKNAIAQAGGVNALVDLIFRWP  524

Query  172  --------------------ASPHAHISEQA-VWALGNIA--------------------  190
                                      ++    V AL  +A                    
Sbjct  525  HGCDGVLERAAGALANLAADDKCSMEVARAGGVHALVMLARNCKYEGAQEQAARALANLA  584

Query  191  --GDGSVFRDLV-IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPID  247
              GD +     V  + GA++ L+ L   P       G  +     L NL  + +      
Sbjct  585  AHGDSNGNNAAVGQEAGALEALVQLTQSPHE-----GVKQEAAGALWNLAFD-DKNRESI  638

Query  248  AVEQILPTLVRLLHHDD---PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
            A    +  LV L          +      A+  L+         +   G +P L+ L+ +
Sbjct  639  AAFGGVEALVALAKSSSNASTGLQERVAGALWGLSV-SEANSIAIGHEGGIPPLIALVRS  697

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI-QKEATWTMSNIT  363
                +   A  A+ N+ +        +++ G +     L ++  + + +  A   ++ + 
Sbjct  698  EAEDVHETAAGALWNL-SFNPGNALRIVEEGGVVALVQLCSSSVSKMARFMAALALAYMF  756

Query  364  AGRQDQIQQV  373
             GR D+   +
Sbjct  757  DGRMDEYAMI  766


> sp|Q9C7G1|PUB45_ARATH U-box domain-containing protein 45 OS=Arabidopsis 
thaliana OX=3702 GN=PUB45 PE=1 SV=1
Length=768

 Score =  104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/279 (18%), Positives = 106/279 (38%), Gaps = 14/279 (5%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP----HAHIS  179
             ++ L   D    +      +  +     E    + + G + A +  L S     +A   
Sbjct  426  LLTTLTDVDTLRKKCRVVEQIRVLLKDDEEARILMGENGCVEALLQFLGSALNENNASAQ  485

Query  180  EQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRN  239
            +    AL N+A D +  ++L++  G +  L  +L  P           NL+         
Sbjct  486  KVGAMALFNLAVDNNRNKELMLASGIIPLLEEMLCNPHSHGSVTAIYLNLSCL-------  538

Query  240  KNPAPPIDAVEQILPTLVRLL-HHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
               A P+      +P +V LL    + +   D   ++ +L+  P   I  ++   +V  L
Sbjct  539  -EEAKPVIGSSLAVPFMVNLLWTETEVQCKVDALHSLFHLSTYPP-NIPCLLSADLVNAL  596

Query  299  VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT  358
              L  + E      +L  + N+V     + ++V     ++   ++L   + N Q++A   
Sbjct  597  QSLTISDEQRWTEKSLAVLLNLVLNEAGKDEMVSAPSLVSNLCTILDTGEPNEQEQAVSL  656

Query  359  MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA  397
            +  +    +   + V+  G++P LVS+      + ++ A
Sbjct  657  LLILCNHSEICSEMVLQEGVIPSLVSISVNGTQRGRERA  695


 Score = 42.3 bits (98),  Expect = 0.011, Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 92/264 (35%), Gaps = 23/264 (9%)

Query  45   DQMLKRRNVSSFPDDATSPLQENRNNQGT---VNWSVDDIVKGINSSNVENQLQATQAAR  101
            D + K+  V           +E R   G    V   +  +   +N +N   Q     A  
Sbjct  434  DTLRKKCRVVEQIRVLLKDDEEARILMGENGCVEALLQFLGSALNENNASAQKVGAMALF  493

Query  102  KLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTS--EQTKAVV  159
             L   +     + ++ +G+IP     L           S  ++T I    S  E+ K V+
Sbjct  494  NLA-VDNNRNKELMLASGIIPLLEEMLCNP-------HSHGSVTAIYLNLSCLEEAKPVI  545

Query  160  DGG-AIPAFISLLASPHAHISEQ--AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVP  216
                A+P  ++LL +    +  +  A+ +L +++         ++    V+ L +L    
Sbjct  546  GSSLAVPFMVNLLWTE-TEVQCKVDALHSLFHLSTYPPNI-PCLLSADLVNALQSLTISD  603

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS  276
            +           L   L+   ++      + +   ++  L  +L   +P         + 
Sbjct  604  EQRWTEKSLAVLLNLVLNEAGKD-----EMVSAPSLVSNLCTILDTGEPNEQEQAVSLLL  658

Query  277  YLTDGPNERIGMVVKTGVVPQLVK  300
             L +       MV++ GV+P LV 
Sbjct  659  ILCNHSEICSEMVLQEGVIPSLVS  682


> sp|O44326|HMP2_CAEEL Beta-catenin-like protein hmp-2 OS=Caenorhabditis 
elegans OX=6239 GN=hmp-2 PE=1 SV=1
Length=678

 Score =  102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 78/408 (19%), Positives = 144/408 (35%), Gaps = 33/408 (8%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            +     +   L     +      S+ D+VK +   +     +A   A  +LSRE     +
Sbjct  56   TQQLKQSVMDLLTYEGSNDMSGLSLPDLVKLMCDHDESVVARAVHRA-YMLSREDPNFFN  114

Query  114  N--IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT---KAVVDGGAIPAFI  168
                     +   ++   ++    ++  +  AL    S  SEQ      +   G +   I
Sbjct  115  APGFDHRSFVEALMA-ASKSSNVNVRRNAIGAL----SHMSEQRGGPLLIFRSGGLAEII  169

Query  169  SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
             +L      +   AV  L N+    S  R       AV+ L      P +       L  
Sbjct  170  RMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEAL-----TPHLHKTNPKLLAQ  224

Query  229  LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL--HHDDPEVLADTCWAISYLTDGPNERI  286
            +   L  L  +  P+            LV +L  + D  +++      I  L+  P    
Sbjct  225  VADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCP-SNK  283

Query  287  GMVVKTGVVPQL-VKLLGASELPIVTPALRAIGNI---VTGTDEQTQVVIDAGALAVFPS  342
              ++  G +P L V+L  A +    T  L A+ N+    T  +  TQ++I          
Sbjct  284  PALISLGCLPALYVELCTAKDERSQTAILVAMRNLSDSATNEENLTQLII------KLLE  337

Query  343  LLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKAD--FKTQKEAVWA  400
            ++      +   A  T+SN+T       Q V +HG +  LV+ + +     +  + A+ A
Sbjct  338  IIRVANDGMTACACGTLSNLTCNNTRNKQTVCSHGGIDALVTAIRRLPEVEEVTEPALCA  397

Query  401  VTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISN  446
            + + T+  ++  E    L  C     +++ L    T +I   L  I N
Sbjct  398  LRHCTARHSLAEEAQSELRFCQAFPVILDQLETLRTPVIKAALGVIRN  445


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 65/421 (15%), Positives = 130/421 (31%), Gaps = 67/421 (16%)

Query  77   SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPI  136
             V+ ++    SSNV  +  A  A   +  +   P +  I R+G + + +  L  +  S +
Sbjct  123  FVEALMAASKSSNVNVRRNAIGALSHMSEQRGGPLL--IFRSGGLAEIIRMLYDSLESVV  180

Query  137  QFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF  196
             + +   L N+    S+         A+ A    L   +  +  Q    L  +  D +  
Sbjct  181  HY-AVTTLRNLLMHVSDSRAQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPS  239

Query  197  RDLVIKYGAVDPLLALL----AVPDMSSLACGYLRNLTWTLSN----------------L  236
            +   +       L+++L        +       +R+L+   SN                L
Sbjct  240  KITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYVEL  299

Query  237  CRNKNPAPPI----------------DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD  280
            C  K+                     + + Q++  L+ ++   +  + A  C  +S LT 
Sbjct  300  CTAKDERSQTAILVAMRNLSDSATNEENLTQLIIKLLEIIRVANDGMTACACGTLSNLTC  359

Query  281  GPNERIGMVVKTGVVPQLVKLLGA--SELPIVTPALRAIGNIVTGT---DEQTQVVIDAG  335
                    V   G +  LV  +        +  PAL A+ +        +E    +    
Sbjct  360  NNTRNKQTVCSHGGIDALVTAIRRLPEVEEVTEPALCALRHCTARHSLAEEAQSELRFCQ  419

Query  336  ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKAD-----  390
            A  V    L   +T + K A   + N           ++   L+       +        
Sbjct  420  AFPVILDQLETLRTPVIKAALGVIRN---------SALLQTNLIELTQEQTANGHTAVSL  470

Query  391  -FKTQKEAVWAVT---NYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISN  446
                 + A+ A+    +    G     ++ V  G +  L  L  A    +     D I  
Sbjct  471  TMDILRRAITAIEENPDIAVDGVP---MWGVIEGAVSALHQL--ANHPAVAAACCDDIGQ  525

Query  447  I  447
            +
Sbjct  526  V  526


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 45/260 (17%), Positives = 80/260 (31%), Gaps = 46/260 (18%)

Query  253  LPTLVRLLHHDDPEVLADTCWAISYLTDGPNE--RIGMVVKTGVVPQLVKLLGASELPIV  310
            LP LV+L+   D  V+A        L+                 V  L+    +S + + 
Sbjct  80   LPDLVKLMCDHDESVVARAVHRAYMLSREDPNFFNAPGFDHRSFVEALMAASKSSNVNVR  139

Query  311  TPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI  370
              A+ A+ ++         ++  +G LA    +L +   ++   A  T+ N+     D  
Sbjct  140  RNAIGALSHMSEQRGG-PLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSR  198

Query  371  QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY---------------  415
             Q      V  L   L K + K   +    +          +I +               
Sbjct  199  AQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILRE  258

Query  416  ---------------------------LVHCGIIEPL-MNLLTAKDTKIILVILDAISNI  447
                                       L+  G +  L + L TAKD +    IL A+ N+
Sbjct  259  YSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYVELCTAKDERSQTAILVAMRNL  318

Query  448  FQAAEKLGETEKLSIMIEEC  467
              +A       +L I + E 
Sbjct  319  SDSATNEENLTQLIIKLLEI  338


> sp|A8HNV0|RSP14_CHLRE Radial spoke protein 14 OS=Chlamydomonas 
reinhardtii OX=3055 GN=RSP14 PE=1 SV=1
Length=387

 Score = 98.9 bits (245),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 79/356 (22%), Positives = 132/356 (37%), Gaps = 12/356 (3%)

Query  51   RNVSSF-PDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQ  109
            R++ +F        L E    +G    +   +V+ +   N   + ++  AAR+LLS    
Sbjct  12   RHIQAFEAKPNPKALPETAVTRGFEKVAFPKLVRELTCDNAVVRKKSLLAARELLSSPVN  71

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS  169
                  + AG  P  V+ L        ++ +A  L  +A+            G + A  +
Sbjct  72   HV--QCVAAGATPAIVALLQDQTDDETRYYAAGTLKLLAAKEVGARDLAQHSG-LDALAA  128

Query  170  LLASPHAHISEQAVWALGNIAGDGSVFRDL-VIKYGAVDPLLALLAVPDMSSLACGYLRN  228
             L  P   + ++A  AL   A   S  R L     GAV P L  LA+ +    A G  + 
Sbjct  129  ALEDPSEGVRDEAYGALIEAARFDSTRRALEACGSGAVLPRLMELALLEAQGGAAGRAQQ  188

Query  229  ---LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER  285
               L +T +    N      +  V Q +P L  LL  + P  +      +        + 
Sbjct  189  GLVLLFTCTQARHNAGILSQLVDVAQAIPHLAGLLKPELPMPVRHAAAELLGALATREDA  248

Query  286  IGMVVKTGVVPQLVKLLGASELPI--VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
                V+ G VP L+ L  +  +P+   T A+ A+G I    + +   +   G LA   S+
Sbjct  249  KIQAVQVGAVPLLL-LAASPSVPVPFATSAVAALGAITIRREGKYAALESPGGLAGLVSV  307

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVW  399
            L      +   A   +SN+ A   +    +V  G  P L  +   A  +  K A  
Sbjct  308  LDPCHEQLCINAMTAVSNV-AEAPEARAILVASGAGPKLQHIFETATVEVVKRAAA  362


 Score = 54.6 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 59/308 (19%), Positives = 101/308 (33%), Gaps = 27/308 (9%)

Query  163  AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA  222
            A P  +  L   +A + ++++ A   +     V     +  GA   ++ALL         
Sbjct  39   AFPKLVRELTCDNAVVRKKSLLAARELLS-SPVNHVQCVAAGATPAIVALLQDQTDDETR  97

Query  223  CGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLT--D  280
                     TL  L   +  A  +      L  L   L      V  +   A+      D
Sbjct  98   YY----AAGTLKLLAAKEVGARDLAQHSG-LDALAAALEDPSEGVRDEAYGALIEAARFD  152

Query  281  GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV---------TGTDEQTQVV  331
                 +       V+P+L++L           A RA   +V               +Q+V
Sbjct  153  STRRALEACGSGAVLPRLMELALLEAQG--GAAGRAQQGLVLLFTCTQARHNAGILSQLV  210

Query  332  IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF  391
              A A+     LL        + A   +    A R+D   Q V  G VP L+ + +    
Sbjct  211  DVAQAIPHLAGLLKPELPMPVRHAAAELLGALATREDAKIQAVQVGAVPLLL-LAASPSV  269

Query  392  KTQK--EAVWAVTNYTS--GGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNI  447
                   AV A+   T    G       L   G +  L+++L     ++ +  + A+SN+
Sbjct  270  PVPFATSAVAALGAITIRREGKY---AALESPGGLAGLVSVLDPCHEQLCINAMTAVSNV  326

Query  448  FQAAEKLG  455
             +A E   
Sbjct  327  AEAPEARA  334


> sp|Q9UQB3|CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 
GN=CTNND2 PE=1 SV=3
Length=1225

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 60/399 (15%), Positives = 129/399 (32%), Gaps = 57/399 (14%)

Query  108  KQPPIDNII--------RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV  159
            + P ID+I         R   +P+ +  L       +Q  +A  L ++  G ++    + 
Sbjct  531  RSPSIDSIQKDPREFGWRDPELPEVIQMLQHQ-FPSVQSNAAAYLQHLCFGDNKIKAEIR  589

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNI--AGDGSVFRDLVIKYGAVDPLLALLAVPD  217
              G I   + LL      +   A  AL N+         +  +   G +  L+ LL    
Sbjct  590  RQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTT  649

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV--------------RLLHHD  263
               +    +  + W LS+ C         DA+  +   ++              R +   
Sbjct  650  DLEIR-ELVTGVLWNLSS-CDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLH  707

Query  264  DPEVLADTCWAISYLTDGPNERIGMVVKTGVVP-QLVKLLGAS------ELPIVTPALRA  316
              +VL +    +  ++    E    + +   +   L+ ++ ++      +   V   +  
Sbjct  708  SSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCI  767

Query  317  IGNIVTGTDEQTQVVIDAGA--LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ-----  369
            + N+      +T      G   L        N K        W         QDQ     
Sbjct  768  LRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESS-GCWGKKKKKKKSQDQWDGVG  826

Query  370  -----------IQQVVNHGLVPFLVSVLSK-ADFKTQKEAVWAVTNYTSGGTVEQI---V  414
                       IQ + +  +V   +++LS+ ++  T + A  A+ N  +G     +    
Sbjct  827  PLPDCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRA  886

Query  415  YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
             +     +  L+ LL   + +++  +  A+ N+      
Sbjct  887  AVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRN  925


 Score = 93.9 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 67/471 (14%), Positives = 143/471 (30%), Gaps = 59/471 (13%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            +     +   +Q++    G  +  + ++++ +       Q  A    + L          
Sbjct  528  TLARSPSIDSIQKDPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHL-CFGDNKIKA  586

Query  114  NIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG--TSEQTKAVVDGGAIPAFISLL  171
             I R G I   V  L     + +   +  AL N+  G    +   A+ + G IPA + LL
Sbjct  587  EIRRQGGIQLLVDLL-DHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLL  645

Query  172  -ASPHAHISEQAVWALGNI----AGDGSVFRDL--VIKYGAVDPLLALLAVPDMSSLACG  224
              +    I E     L N+    A    + +D   V+    + P       P        
Sbjct  646  RKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQ  705

Query  225  -----YLRNLTWTLSNLCR-NKNPAPPIDAVEQILPTLVRLLHHD------DPEVLADTC  272
                  LRN T  L N+    +     +   + +   L+ ++         D + + +  
Sbjct  706  LHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCV  765

Query  273  WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ---  329
              +  L+           +     +L  LL          +    G        Q Q   
Sbjct  766  CILRNLSYRLAAETSQ-GQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDG  824

Query  330  ---------------VVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGR----QDQ  369
                           ++     +  + +LL+     +  + A   + N+ AG        
Sbjct  825  VGPLPDCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYI  884

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
               V     +P LV +L   + +       A+ N       +    L+    +  L++ L
Sbjct  885  RAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNK---ELIGKYAMRDLVHRL  941

Query  430  TAKDTK-------IILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI  473
               +         +    + A+       E + +  + +  + + GG++K+
Sbjct  942  PGGNNSNNTASKAMSDDTVTAV--CCTLHEVITKNMENAKALRDAGGIEKL  990


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 73/413 (18%), Positives = 118/413 (29%), Gaps = 108/413 (26%)

Query  91    ENQLQATQAARKLLSREKQPPIDNII--RAGLIPKFVSFLGRTDCSPIQFESAWALTNIA  148
             E    A  A R L+  +     + I     G IP  V  L +T    I+      L N++
Sbjct  607   EVHRSACGALRNLVYGKANDD-NKIALKNCGGIPALVRLLRKTTDLEIRELVTGVLWNLS  665

Query  149   SGTSEQTKAVVDGGAI--------------PAF-----ISLLASPHAHISEQAVWALGNI  189
             S  + +   + D  A+                      I L +S    +   A   L N+
Sbjct  666   SCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSS---QVLRNATGCLRNV  722

Query  190   AGDGSVFRDLVIKY-GAVDPLLALLAVPDMSS--------LACGYLRNLTWTLS------  234
             +  G   R  + +  G  D LL ++     SS             LRNL++ L+      
Sbjct  723   SSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNLSYRLAAETSQG  782

Query  235   ----------NLCRNKN------------------PAPPIDAVEQ---------------  251
                        LC   N                       D V                 
Sbjct  783   QHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLW  842

Query  252   ----ILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERI----GMVVKTGVVPQLVKLLG  303
                 + P L  L    +P+ L     A+  L  G  +        V K   +P LV+LL 
Sbjct  843   HPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLR  902

Query  304   ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL---TNPKTNIQKEA-----  355
                  +V     A+ N+    D + + +I   A+      L    N      K       
Sbjct  903   IDNDRVVCAVATALRNMAL--DVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTV  960

Query  356   ---TWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKA----DFKTQKEAVWAV  401
                  T+  +     +  + + + G +  LV +          K  K A   +
Sbjct  961   TAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVL  1013


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 46/222 (21%)

Query  107   EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGT---SEQTKAVV-DGG  162
             E    I  +    ++  +++ L           +A AL N+A+G+   S   +A V    
Sbjct  833   EPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEK  892

Query  163   AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA  222
              +P  + LL   +  +      AL N+A D    ++L+ KY A+  L+  L   + S+  
Sbjct  893   GLPILVELLRIDNDRVVCAVATALRNMALD-VRNKELIGKY-AMRDLVHRLPGGNNSNNT  950

Query  223   CGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGP  282
                                                     DD   +   C  +  +    
Sbjct  951   ASKA----------------------------------MSDDT--VTAVCCTLHEVITKN  974

Query  283   NERIGMVVKTGVVPQLVKLLGAS----ELPIVTPALRAIGNI  320
              E    +   G + +LV +  +        +V  A + + ++
Sbjct  975   MENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSM  1016


> sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 
1 OS=Bos taurus OX=9913 GN=RAP1GDS1 PE=1 SV=1
Length=558

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 65/387 (17%), Positives = 146/387 (38%), Gaps = 29/387 (7%)

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ-  154
                  + L++      + I  +G++  F S L        Q      + N+ +  ++  
Sbjct  26   CLDCLLQALTQNNMETSEKIQGSGILQVFASLLIP------QSSCTAKVANVIAEIAKNE  79

Query  155  --TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL  212
                  VD G I   + LL S    +  Q   ALGNI  D    +  +I  G +  L+ L
Sbjct  80   FMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKL  139

Query  213  LAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC  272
            L +    +            L+ L  +K      +  E+++    + + HD  E++ +  
Sbjct  140  LGIHCQKAALTEMCLVAFGNLAELESSKEQFASTNIAEELVKLFKKQIEHDKREMVFEVL  199

Query  273  WAISYLTDGPNERIGMVVKTGVVPQLVKLLGA---SELPIVTPALRAIGNIVT---GTDE  326
              ++      +     +V++G+V  L++++     S+       L+   +++      DE
Sbjct  200  APLAE----NDAIKLQLVESGLVECLLEIVQQKVDSDKEEDIAELKTASDLMVLLLLGDE  255

Query  327  QTQVVIDAGALAVFPSLLT---NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLV  383
              Q + + G   VF  +L+   +    +Q      ++N      + I  +V++G+V  L+
Sbjct  256  SMQKLFEGGKGNVFQRVLSWIPSNNHQLQLAGALAIANFARNDGNCI-HMVDNGIVEKLM  314

Query  384  SVL----SKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV  439
             +L       +   Q  A+  + N       +    ++  G+ E ++  L ++   +   
Sbjct  315  DLLDRHVEDGNVTVQHAALSCLRNLAIPVVNK--AKMLSAGVTEAVLKFLKSEMPPVQFK  372

Query  440  ILDAISNIFQAAEKLGETEKLSIMIEE  466
            +L  +  +  A  +  E    ++ + E
Sbjct  373  LLGTLRMLIDAQAEAAEQLGKNVKLVE  399


 Score = 83.1 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 63/374 (17%), Positives = 117/374 (31%), Gaps = 59/374 (16%)

Query  116  IRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL--AS  173
            + AGLI   V  L   D   +  ++  AL NI   +      +++ G IP  + LL    
Sbjct  86   VDAGLISPLVQLLNSKD-QEVLLQTGRALGNICYDSHSLQAQLINMGVIPTLVKLLGIHC  144

Query  174  PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTL  233
              A ++E  + A GN+A   S            + L+ L                L    
Sbjct  145  QKAALTEMCLVAFGNLAELESSKEQFA-STNIAEELVKLFKKQIEHDKREMVFEVLAPLA  203

Query  234  SNLC---------------------RNKNPAPPIDAVEQILPTLVRLLH-----------  261
             N                        + +    I  ++     +V LL            
Sbjct  204  ENDAIKLQLVESGLVECLLEIVQQKVDSDKEEDIAELKTASDLMVLLLLGDESMQKLFEG  263

Query  262  --------------HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL----G  303
                           ++ ++      AI+         I MV   G+V +L+ LL     
Sbjct  264  GKGNVFQRVLSWIPSNNHQLQLAGALAIANFARNDGNCIHMV-DNGIVEKLMDLLDRHVE  322

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
               + +   AL  + N+          ++ AG        L +    +Q +   T+  + 
Sbjct  323  DGNVTVQHAALSCLRNLAI-PVVNKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLI  381

Query  364  AGRQDQIQQV-VNHGLVPFLVSVLSKADF-KTQKEAVWAVTNYTSGG-TVEQIVYLVHCG  420
              + +  +Q+  N  LV  LV      D      E+   ++       + + I  +V  G
Sbjct  382  DAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG  441

Query  421  IIEPLMNLLTAKDT  434
             I+ L+ + T++  
Sbjct  442  GIKHLVTMATSEHV  455


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 100/296 (34%), Gaps = 49/296 (17%)

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL----ASPHAHISEQAVWAL  186
            ++   +Q   A A+ N A         +VD G +   + LL       +  +   A+  L
Sbjct  278  SNNHQLQLAGALAIANFAR-NDGNCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSCL  336

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWT------------  232
             N+A    V +  ++  G  + +L  L    P +     G LR L               
Sbjct  337  RNLAI-PVVNKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNV  395

Query  233  -----LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG  287
                 L   C  K+ A  +    ++L  L+R     D                     I 
Sbjct  396  KLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDV--------------------IK  435

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVID-AGALAVFPSLLTN  346
             +V++G +  LV +  +  + +   AL A+  I        +  ++ A  + +   LL +
Sbjct  436  TIVQSGGIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAQLVQILHRLLAD  495

Query  347  PK--TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWA  400
             +    I+  +   +  +  G +   ++V +   +  +  + S  +    ++A   
Sbjct  496  ERSAPEIKYNSMVLICALM-GSESLHKEVQDLAFLDVVSKLRSHENKSVAQQASLT  550


 Score = 35.4 bits (80),  Expect = 1.3, Method: Composition-based stats.
 Identities = 17/103 (17%), Positives = 39/103 (38%), Gaps = 2/103 (2%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
            + ++K + S     Q +     R L+  + +          L+ + V +    D + +  
Sbjct  356  EAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMG  415

Query  139  ESAWALTNIASGTSEQT--KAVVDGGAIPAFISLLASPHAHIS  179
            ES   L+ +   +  +   K +V  G I   +++  S H  + 
Sbjct  416  ESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHVIMQ  458


> sp|O95996|APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo 
sapiens OX=9606 GN=APC2 PE=1 SV=1
Length=2303

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 58/303 (19%), Positives = 108/303 (36%), Gaps = 32/303 (11%)

Query  149  SGTSEQTKAVVDGGAIPAFISLLASP-----------HAHISEQAVWALGNIA-GDGSVF  196
            S   E  +A+ + G + A   LL              +  +   A   L N+  GD +  
Sbjct  422  SFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVANK  481

Query  197  RDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              L  + G ++ ++A LA    ++  +    LRNL+W      R    +  +      + 
Sbjct  482  ATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSW------RADINSKKVLREAGSVT  535

Query  255  TLVRL-LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLL----GASELP  308
             LV+  L       L     A+  L+    E    + +  G +  LV  L     ++ L 
Sbjct  536  ALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLA  595

Query  309  IVTPA---LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
            I+      LR + ++V   ++  QV+ D   L      LT+    I   A  T+ N++A 
Sbjct  596  IIESGGGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSAR  655

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG--GTVEQIVYLVHCG-II  422
                 + + + G V  L +++          +  A+ N  +      +     V  G  +
Sbjct  656  SARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCV  715

Query  423  EPL  425
              L
Sbjct  716  PSL  718


 Score = 83.9 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/275 (16%), Positives = 96/275 (35%), Gaps = 17/275 (6%)

Query  133  CSPIQFESAWALTNIASGTSEQTKAVVDG-GAIPAFISLLASPHAHISEQAVWALGNIA-  190
               ++  +   LTN+  G       +    G + A ++ LAS    + +     L N++ 
Sbjct  459  NLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSW  518

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVE  250
                  + ++ + G+V  L+  +      S     L +  W LS    +      I  V+
Sbjct  519  RADINSKKVLREAGSVTALVQCVLRATKESTLKSVL-SALWNLS--AHSTENKAAICQVD  575

Query  251  QILPTLVRLL----HHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLLG  303
              L  LV  L      +   ++      +  ++       +   ++     +  L++ L 
Sbjct  576  GALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLT  635

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
            +  L IV+ A   + N+   +    +++ D GA+ +  +L+ +    I   +   + N+ 
Sbjct  636  SHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLL  695

Query  364  AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            A R  + Q           V          +K+  
Sbjct  696  AHRPAKHQAAATAVSPGSCV-----PSLYVRKQRA  725


 Score = 72.3 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 85/265 (32%), Gaps = 14/265 (5%)

Query  37   ELRKAKKDD-QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQ  95
            E+ K  +D   +  RR       + T     N+         ++ IV  + S + E    
Sbjct  449  EMHKMTRDPLNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQV  508

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT  155
             +   R L  R        +  AG +   V  + R            AL N+++ ++E  
Sbjct  509  VSSILRNLSWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENK  568

Query  156  KAVVDG-GAIPAFISLL----ASPHAHISEQAVWALGNIA---GDGSVFRDLVIKYGAVD  207
             A+    GA+   +S L     S    I E     L N++        +R ++  +  + 
Sbjct  569  AAICQVDGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLVATREDYRQVLRDHNCLQ  628

Query  208  PLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEV  267
             LL       ++S +   + N   TL NL         +      +  L  L+H     +
Sbjct  629  TLLQ-----HLTSHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMI  683

Query  268  LADTCWAISYLTDGPNERIGMVVKT  292
               +  A+  L      +       
Sbjct  684  AMGSAAALRNLLAHRPAKHQAAATA  708


 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 65/451 (14%), Positives = 142/451 (31%), Gaps = 76/451 (17%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA-------  176
             +S L   D    Q ++A  L  ++S + E   A+   G +P  + +L    A       
Sbjct  279  LLSMLATRD----QEDTARTLLAMSS-SPESCVAMRRSGCLPLLLQILHGTEAAAGGRAG  333

Query  177  --------HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL---------------  213
                        +A  AL NI       + L  K   V  +L  +               
Sbjct  334  APGAPGAKDARMRANAALHNIVFSQPD-QGLARKEMRVLHVLEQIRAYCETCWDWLQARD  392

Query  214  ---AVPDMSSLACGY---LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPE-  266
                     S        +   T  +  L  ++     ++ +   L  +  LL  D    
Sbjct  393  GGPEGGGAGSAPIPIEPQICQATCAVMKLSFDEEYRRAMNEL-GGLQAVAELLQVDYEMH  451

Query  267  ----------VLADTCWAISYLTDGPNERIGMVV-KTGVVPQLVKLLGASELPIVTPALR  315
                      +       ++ LT G       +  + G +  +V  L +    +      
Sbjct  452  KMTRDPLNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSS  511

Query  316  AIGNIVTGTDEQTQVVI-DAGALAVFPSL-LTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             + N+    D  ++ V+ +AG++       L   K +  K     + N++A   +    +
Sbjct  512  ILRNLSWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAI  571

Query  374  VNH-GLVPFLVSVLSKADFKTQKEAVWAV-------TNYTS--GGTVEQIVYLVHCGIIE  423
                G + FLVS L+   +K Q  ++  +        N +S      +    L     ++
Sbjct  572  CQVDGALGFLVSTLT---YKCQSNSLAIIESGGGILRNVSSLVATREDYRQVLRDHNCLQ  628

Query  424  PLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENES  483
             L+  LT+    I+      + N+         + +   ++ + G +  +  L + +++ 
Sbjct  629  TLLQHLTSHSLTIVSNACGTLWNL------SARSARDQELLWDLGAVGMLRNLVHSKHKM  682

Query  484  VYKASLSLIEKYFSVEEEEDQNVVPETTSEG  514
            +   S + +    +    + Q      +   
Sbjct  683  IAMGSAAALRNLLAHRPAKHQAAATAVSPGS  713


> sp|Q9C6Y4|CSI2_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 2 
OS=Arabidopsis thaliana OX=3702 GN=CSI2 PE=3 SV=1
Length=2114

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 83/403 (21%), Positives = 161/403 (40%), Gaps = 32/403 (8%)

Query  66   ENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGL--IPK  123
               ++      ++  +++ +++     Q +    AR L   + +     II   +  +P 
Sbjct  3    SEMDDPEKAAVTITRLIEQLHAKKSSAQEKELSTARLLGLAKGKKECRKIISQNVNAMPA  62

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
            F+S L R+     +  SA  LT +    + ++K ++ GG IP  +SLL S          
Sbjct  63   FISLL-RSGTLLAKLNSASVLTVLCKDKNVRSKILI-GGCIPPLLSLLKSDSVDAKRVVA  120

Query  184  WALGNIA-----GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR  238
             A+  ++     GD    +  V + G V  L   L              +L   L NLC 
Sbjct  121  EAIYEVSLCGMDGDNVGTKIFVTE-GVVPSLWDQLKTGKKQDK--TVEGHLVGALRNLCG  177

Query  239  NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL  298
            +K+    +   +  +  +++LL   +P   ++    ++ L       I  V ++G V  L
Sbjct  178  DKDGFWALTLEDGGVDIILKLLQSSNPVSQSNAASLLARLIRIFTSSISKVEESGAVQVL  237

Query  299  VKLLGASELPIVTPA-LRAIGNIVTGTDEQTQVVIDAGALAVFPS-LLTNPKTNI-----  351
            V+LLG      V  + + A+  I + ++E   V  D   + +  S ++ + K ++     
Sbjct  238  VQLLGEENSVFVRASVVNALEAITSKSEEAITVARDLDGIHLLISAVVASSKESVEEETE  297

Query  352  ---QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVT--NYTS  406
               Q   T  ++N+  G    I  +    L P L   ++           +A+     + 
Sbjct  298  RVLQSYGTQALANLCGGMSGLIVYLGGLSLSPRLTEPIA----DILGALAYALRKFQLSC  353

Query  407  GGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV-ILDAISNIF  448
            G T E     +  GI   L+ LL  +DT++I   IL+A+ ++F
Sbjct  354  GDTREAFDPTLTEGI---LVKLLKPRDTQLIHERILEAMESLF  393


 Score = 70.0 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 46/321 (14%), Positives = 101/321 (31%), Gaps = 19/321 (6%)

Query  143  ALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK  202
             L+N+     +   A+     I   I  L        E +V  L  +  +    R  V  
Sbjct  429  CLSNLCKH-GDVWDAIGKREGIQILIPYLGLSSEQHQELSVEFLAILTDNVEESRWAVTS  487

Query  203  YGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHH  262
             G + PLL +L            +R +     NLC +             +P L+ LL +
Sbjct  488  AGGIPPLLQILETGVSQKAKDDAVRVIL----NLCCHSEEIRLCVEKAGAIPALLGLLKN  543

Query  263  DDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVT  322
              P+    +   +  L    +          V+ Q+  L         T  +R +G+++ 
Sbjct  544  GGPKSQESSANTLLKLIKTADPS--------VIEQVQALFLGDAPKSKTHLIRVLGHVLA  595

Query  323  GTDEQ---TQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
                +   T+       L      L +    +++ A   ++++ + R+D    +      
Sbjct  596  SASLEEFVTKGSAANNGLRSLVQRLASSNEKMKENAASVLADLFSSRKDLCGGLGFDEDD  655

Query  380  PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHC---GIIEPLMNLLTAKDTKI  436
                 +LS        +   A+ + ++    +     +      +I+PL+        + 
Sbjct  656  NPCTKLLSGNTHAVATQLAHALGSLSNPTKKKTATKKLSGPEVEVIKPLIKSAKTNPIES  715

Query  437  ILVILDAISNIFQAAEKLGET  457
                +  ++N+        E 
Sbjct  716  TENPMSTLANLLSDPNVAAEA  736


 Score = 68.5 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 66/419 (16%), Positives = 139/419 (33%), Gaps = 30/419 (7%)

Query  91   ENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG  150
            E   + +     +L+   +     +  AG IP  +  L        + ++   + N+   
Sbjct  461  EQHQELSVEFLAILTDNVEESRWAVTSAGGIPPLLQILETGVSQKAKDDAVRVILNLCCH  520

Query  151  TSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLL  210
            + E    V   GAIPA + LL +      E +   L  +               +V   +
Sbjct  521  SEEIRLCVEKAGAIPALLGLLKNGGPKSQESSANTLLKLIK---------TADPSVIEQV  571

Query  211  ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD  270
              L + D        +R L   L++    +       A    L +LV+ L   + ++  +
Sbjct  572  QALFLGDAPKSKTHLIRVLGHVLAS-ASLEEFVTKGSAANNGLRSLVQRLASSNEKMKEN  630

Query  271  TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV  330
                ++ L     +  G +          KLL  +   + T    A+G++   T ++T  
Sbjct  631  AASVLADLFSSRKDLCGGLGFDEDDNPCTKLLSGNTHAVATQLAHALGSLSNPTKKKTAT  690

Query  331  VIDAG----ALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVL  386
               +G     +               +    T++N+ +      + + N  +V  L  VL
Sbjct  691  KKLSGPEVEVIKPLIKSAKTNPIESTENPMSTLANLLSDPNVAAEAL-NDDVVSALTRVL  749

Query  387  SKADFKTQKEAVWAVTNYTSG-------GTVEQIVYLVHCGIIEPLMNLLTAKD--TKII  437
             +   + ++ A  A+                EQ  + V       L++LL A D      
Sbjct  750  REGTLQGKRNASHALHQLLKHFQVSDVFKGNEQCRFAVSE-----LIDLLNATDLNNSAF  804

Query  438  LVILDAISNIFQA-AEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY  495
            + +L+ +S + +A           S   E    LD +       +  V   ++ ++ ++
Sbjct  805  IDVLEVLSLLAKAKYGANLSHNPFSAFGEVPSNLDSLVRGLAEGHPLVQDKAIEILSRF  863


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 63/326 (19%), Positives = 111/326 (34%), Gaps = 30/326 (9%)

Query  142   WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV-----W-ALGNIAGDGSV  195
             W L+ I S        V++G  +      L    ++  E +      W A+  +A     
Sbjct  984   WLLSIICSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEEKWIAMSFLAVMSQE  1043

Query  196   FRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV-EQILP  254
              +  V+   A + +L  LA P M S            L+ L R+KN     + +   I+ 
Sbjct  1044  PK--VVSSPATENILQTLA-PFMQSEQMIDGYFTAQVLAALVRHKNDKTISEIMNSDIVE  1100

Query  255   TLVRLL--HHDDPEVLADTCWAISYLTDGPNERIGMV------VKTG-----VVPQLVKL  301
             T + L+     D   L      +S L   P E    V      V++G      +P LV L
Sbjct  1101  TTINLVGCEESDTRSLCALAEELS-LVQNPYEATLEVLFENERVRSGSFTKKCIPLLVNL  1159

Query  302   LGASELPI--VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTM  359
             L      +  +  A+R +  I    D    ++ +AGAL      L+    +  +     +
Sbjct  1160  LKPYADKVGGIPVAIRLLRRIADNDDLSKLLIAEAGALDALAKYLSLSPQDSTEITVSEL  1219

Query  360   SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL-VH  418
                     +  +       +  L+ +L  A   T+  A   +    S    E I    + 
Sbjct  1220  LESLFRSPEITRHKTAISSMKQLIGILHLASRSTRYNAARVLCELFSS---EHIRDSELA  1276

Query  419   CGIIEPLMNLLTAKDTKIILVILDAI  444
                + PL+ +L        +  L A+
Sbjct  1277  WKALSPLIEMLNTTLESERVAALTAL  1302


 Score = 54.6 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/398 (14%), Positives = 123/398 (31%), Gaps = 38/398 (10%)

Query  90    VENQLQATQAARKL-LSREKQPPIDNIIRAGLIPKFVSFLGRTDCSP---IQFESAWALT  145
             V  +++  Q    + L R        +   G I +    +   D      +   +A+ L 
Sbjct  1585  VGIRVRNLQEIALMGLERSSVTWPKEVADTGGIQELSKVIIDEDPQLPVYLWESAAFILC  1644

Query  146   NIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA  205
             NI     E     V    IP    +L S        A+ AL             +I+   
Sbjct  1645  NILRINPEHYYFTV---TIPVLSKMLFSTAESTVILAIDAL-------------IIRENQ  1688

Query  206   VDPLLALLAVPDMSSLACGYLRN-----LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL  260
                 +  +A           LR+     L+  L  L             + +L  L   +
Sbjct  1689  DSSSVQEMAESSALDALLDLLRSHHCEELSARLLELILRNPKVRETKICQFVLTPLSEYI  1748

Query  261   HHDDPEVLADTCWAISYLTDGPNERIGMVVKTG----VVPQLVKLLG-ASELPIVTPALR  315
                DP+ ++++   +  +  G   +   + K          L+ LL       +    +R
Sbjct  1749  L--DPDTISESAKILIAMALGDISQHEGLAKATDSPVACRALISLLEDEPSEEMQMVVMR  1806

Query  316   AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN  375
             A+ N    +    + + +AG +     +L +    +  +A   + ++ +     +Q+ V+
Sbjct  1807  ALENFAMHSRTSRKAMAEAGGVYWVQEMLRSSNPQVSTQAALIIKSLFSN--HTLQEYVS  1864

Query  376   HGLVPFLVSVLSK---ADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
               ++  L + + +          E V  + N       +          I  L+  L + 
Sbjct  1865  GEIIKSLTNAMEREFWTTTAINVEIVRTL-NTILTTFPKLRSSEAATACIPHLIGALKSG  1923

Query  433   DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
             + +     +D I  + Q+   +      S  +     +
Sbjct  1924  EQEARDSAMDTIYTLRQSWTTMPTETARSQAVLAADAI  1961


 Score = 51.5 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 64/437 (15%), Positives = 135/437 (31%), Gaps = 72/437 (16%)

Query  99    AARKLLSREKQPPIDN--IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTK  156
             A R L        +    I  AG +     +L  +     +   +  L ++   + E T+
Sbjct  1173  AIRLLRRIADNDDLSKLLIAEAGALDALAKYLSLSPQDSTEITVSELLESLFR-SPEITR  1231

Query  157   AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVP  216
                   ++   I +L          A   L  +       RD  + + A+ PL+ +L   
Sbjct  1232  HKTAISSMKQLIGILHLASRSTRYNAARVLCEL-FSSEHIRDSELAWKALSPLIEMLNTT  1290

Query  217   DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT---------------------  255
               S             L  L    NP P I    +  P                      
Sbjct  1291  LESERVA-----ALTALVKLTMGINPRPDILTSLEGNPLDNIYKILSLDSSSLESKTSAA  1345

Query  256   -LVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGV--------VPQLVK-----  300
              + R L  ++           I  L           ++ G+        + + V+     
Sbjct  1346  RICRFLFTNEGLRTSTSAACCIVSLISLIRTGKSTAIEAGMFALDRLLDIKRFVEVAEEH  1405

Query  301   --------LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP-SLLTNPKTNI  351
                      + +    I   A+  +  +      +   +I  G +      L  +P +++
Sbjct  1406  DCVNLFYGYVASENYLISEAAISCLTKMAKDNTPRKMDLIKMGIIEKCISQLSKSPPSSL  1465

Query  352   QKEATWTMSNIT-----AGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKE--AVWAVTNY  404
                       +T     A  QD I+ V        L+ +L + D   Q +   + A+ N 
Sbjct  1466  CSVIADLFRVLTNVGVIARSQDAIKMV------QPLLLILLRQDLDFQGQLGGLQAIANI  1519

Query  405   TSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII---LVILDAISNIFQAAEKLGETEKLS  461
                  V + + +    II PL+ LL ++   +     ++L ++  + +  E++     ++
Sbjct  1520  LEKPMVLESLKIASSTIIMPLIPLLESESIAVKNATTILLTSLLEMQRFQEEITTKNLIA  1579

Query  462   IMIEECGGLDKIEALQN  478
              +++  G   ++  LQ 
Sbjct  1580  PLVKLVGI--RVRNLQE  1594


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 69/198 (35%), Gaps = 17/198 (9%)

Query  124   FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV  183
              +S L       +Q     AL N A  +    KA+ + G +     +L S +  +S QA 
Sbjct  1788  LISLLEDEPSEEMQMVVMRALENFAMHSRTSRKAMAEAGGVYWVQEMLRSSNPQVSTQAA  1847

Query  184   WALGNIAGDGSVFRDLVIKYGAVDPLLALLAVP--DMSSLACGYLRNLTWTLSNLCRNKN  241
               + ++  +    ++ V     +  L   +       +++    +R L   L+       
Sbjct  1848  LIIKSLFSNH-TLQEYVSGE-IIKSLTNAMEREFWTTTAINVEIVRTLNTILTTF----P  1901

Query  242   PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL----TDGPNE--RIGMVVKTGVV  295
                  +A    +P L+  L   + E        I  L    T  P E  R   V+    +
Sbjct  1902  KLRSSEAATACIPHLIGALKSGEQEARDSAMDTIYTLRQSWTTMPTETARSQAVLAADAI  1961

Query  296   PQLVKLLGASELPIVTPA  313
             P L  ++ +    + +PA
Sbjct  1962  PVLQLMMKS---KLKSPA  1976


> sp|Q68FH0|PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 
PE=1 SV=1
Length=1190

 Score = 94.3 bits (233),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 77/466 (17%), Positives = 157/466 (34%), Gaps = 60/466 (13%)

Query  58   DDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIR  117
              +   +Q++       +  + +++  +       Q  A    + L           + R
Sbjct  509  SPSIDSIQKDPREFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHL-CFGDNKVKMEVYR  567

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASG--TSEQTKAVVDGGAIPAFISLL-ASP  174
             G I   V  L       +Q  +  AL N+  G  T E   A+ + G IPA + LL  S 
Sbjct  568  LGGIKHLVDLL-DHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSI  626

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG----------  224
             A + E     L N++   +V   ++    A+  L   + VP                  
Sbjct  627  DAEVRELVTGVLWNLSSCDAVKMTIIRD--ALSTLTNTVIVPHSGWNNSSFDDDHKIKFQ  684

Query  225  ---YLRNLTWTLSNLCR-NKNPAPPIDAVEQILPTLVRLLH------HDDPEVLADTCWA  274
                LRN T  L NL    +     + + E ++ +L+ ++H        D + + +    
Sbjct  685  TSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCT  744

Query  275  ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP----------IVTPALRA--------  316
            +  L+      +      G + +L  LLG                     R         
Sbjct  745  LRNLSYRLELEVPQARLLG-LNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDG  803

Query  317  IGNI--VTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGR----QDQ  369
            +G I  ++ + +  +++     +  + +LL  +      + +  ++ N++AG        
Sbjct  804  VGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYI  863

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
               V     +P LV +L   + +       A+ N       +    L+    +  L+N L
Sbjct  864  RAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNK---ELIGKYAMRDLVNRL  920

Query  430  TAKDTKIILV--ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI  473
               +   IL    + AI       E   +  + +  + + GG++K+
Sbjct  921  PGGNGPSILSDETVAAI--CCALHEVTSKNMENAKALADSGGIEKL  964


 Score = 88.5 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 60/407 (15%), Positives = 130/407 (32%), Gaps = 69/407 (17%)

Query  107  EKQPPIDNII--------RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV  158
             + P ID+I         R   +P+ +  L       +Q  +A  L ++  G ++    V
Sbjct  507  TRSPSIDSIQKDPREFAWRDPELPEVIHMLQHQ-FPSVQANAAAYLQHLCFGDNKVKMEV  565

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNI--AGDGSVFRDLVIKYGAVDPLLALLAVP  216
               G I   + LL      + + A  AL N+         +  +   G +  LL LL   
Sbjct  566  YRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKS  625

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL-----------------  259
              + +    +  + W LS        A  +  +   L TL                    
Sbjct  626  IDAEVR-ELVTGVLWNLS-----SCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDH  679

Query  260  -LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGAS------ELPIVT  311
             +      VL +T   +  L+    E    +    G+V  L+ ++         +   V 
Sbjct  680  KIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVE  739

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE-ATW-------------  357
              +  + N+    + +       G L     LL     +   E + W             
Sbjct  740  NCVCTLRNLSYRLELEVPQARLLG-LNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQE  798

Query  358  ----TMSNI--TAGRQDQIQQVVNHGLVPFLVSVL-SKADFKTQKEAVWAVTNYTSGGTV  410
                 +  I   +     ++ + +  +V   +++L   ++  T + +  ++ N ++ G  
Sbjct  799  DQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSA-GNW  857

Query  411  EQIVYLVHC----GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            +   Y+         +  L+ LL   + +++  +  A+ N+      
Sbjct  858  KFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRN  904


 Score = 78.9 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 69/416 (17%), Positives = 135/416 (32%), Gaps = 64/416 (15%)

Query  91   ENQLQATQAARKLL---SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNI  147
            E Q  A  A R L+   S ++      +   G IP  +  L ++  + ++      L N+
Sbjct  584  EVQKNACGALRNLVFGKSTDENKI--AMKNVGGIPALLRLLRKSIDAEVRELVTGVLWNL  641

Query  148  ASGTSEQTKAVVDGGAIPAFISLL---------ASPHAH---------ISEQAVWALGNI  189
            +S   +  K  +   A+    + +         +S             +       L N+
Sbjct  642  SS--CDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNL  699

Query  190  AGDGSVFRDLVIKY-GAVDPLLALLA-VPDMSSLACGYLRNLTWTLSNLCRN---KNPAP  244
            +  G   R  +    G VD LL ++    + S      + N   TL NL      + P  
Sbjct  700  SSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQA  759

Query  245  PIDAVEQILPTLVRLLHHDDPEV-----------------LADTCWAISYLTDGPNERIG  287
             +  + ++   L +     D E                    D    I  L+  P + + 
Sbjct  760  RLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSP-KGVE  818

Query  288  MVVKTGVV-PQLVKLLGASELPIVTPALRAIGNIVTGT----DEQTQVVIDAGALAVFPS  342
            M+    VV P L  L  +S    +  +  ++ N+  G           V     L +   
Sbjct  819  MLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVE  878

Query  343  LLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS--KADFKTQKEAVWA  400
            LL      +       + N+    ++  ++++    +  LV+ L           E V A
Sbjct  879  LLRMDNDRVVSSVATALRNMALDVRN--KELIGKYAMRDLVNRLPGGNGPSILSDETVAA  936

Query  401  VT---NYTSGGTVEQIVYLVHCGIIEPLMNLL----TAKDTKIILVILDAISNIFQ  449
            +    +  +   +E    L   G IE L+N+          K++      ++ ++Q
Sbjct  937  ICCALHEVTSKNMENAKALADSGGIEKLVNITKGRGDRSSLKVVKAAAQVLNTLWQ  992


> sp|Q05AL1|ARMC8_DANRE Armadillo repeat-containing protein 8 OS=Danio 
rerio OX=7955 GN=armc8 PE=2 SV=1
Length=673

 Score = 93.9 bits (232),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 75/463 (16%), Positives = 144/463 (31%), Gaps = 68/463 (15%)

Query  51   RNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP  110
            R   +    + S   EN          +  +++G+  S++       +  R +      P
Sbjct  80   RTECAVVLGSLSMGTENNIKSLVDCHIIPALLQGLLCSDLIFIEACLRCLRTVFISPVTP  139

Query  111  PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL  170
                     +IP  +S L R+  +  Q        +    T E    + + GAI     L
Sbjct  140  VQLLYTDPTVIPHLMSLLSRSQHT--QEYITQIFAH-CCKTPEHQTVLFNHGAIQNIAPL  196

Query  171  LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS-LACGYLRNL  229
            L SP   +  QA+     +A + +     ++        L+ + V  M            
Sbjct  197  LISPSYKVRMQALKCFSVLAYENAQVSMTLVNVLVDGEQLSQVFVRMMQRDKPIEMQLTA  256

Query  230  TWTLSNLCRNKNPAPPID-AVEQILPTLVRL-------------------LHHDDPEVLA  269
               L+ +CR        +  V + LP LVR+                   L   D E+  
Sbjct  257  AKCLTYMCRAGAIRTEDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLMEPDIELQR  316

Query  270  DT-------------------CWAIS----------------------YLTDGPNE---R  285
                                   AI+                      Y + G N+   R
Sbjct  317  IASVTDHLVSMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGSNDEDIR  376

Query  286  IGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT  345
              +     ++ ++V  L  S + +   A+R + ++     +      D         LL 
Sbjct  377  KKITETENMMDRIVSGLSESSIKVRLAAVRCLHSLSRSVQQLRTSFHDHAVWKPLMKLLQ  436

Query  346  NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYT  405
            N    +   A+ T+ N+        + ++  G++  L S+        +   +WA+ N  
Sbjct  437  NAPDEVLVMASSTLCNLLLEFSPSKEPILESGVIELLCSLTQSDSSALRVNGIWALMNMA  496

Query  406  SGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIF  448
                 +  V +V     E L  LL+  DT +++  L  + N+ 
Sbjct  497  FQADQKVKVEIVRALGTEQLFRLLSDPDTNVLMKTLGLLRNLL  539


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 74/465 (16%), Positives = 168/465 (36%), Gaps = 36/465 (8%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPID--NIIRAG--LIPKFVSFLGRTDC  133
            + +I   + S + + ++QA +    L     Q  +   N++  G  L   FV  + R   
Sbjct  190  IQNIAPLLISPSYKVRMQALKCFSVLAYENAQVSMTLVNVLVDGEQLSQVFVRMMQRDKP  249

Query  134  SPIQFESAWALTNIASGTSEQTK-AVVDGGAIPAFISLLASPHA-HISEQAVWALGNIAG  191
              +Q  +A  LT +    + +T+   +    +P  + + +         +    L  +  
Sbjct  250  IEMQLTAAKCLTYMCRAGAIRTEDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLME  309

Query  192  DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGY----------------LRNLTWTL--  233
                 + +       D L+++LA       +                   LR   + L  
Sbjct  310  PDIELQRI---ASVTDHLVSMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYA  366

Query  234  SNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG  293
            S    +++    I   E ++  +V  L     +V       +  L+    +         
Sbjct  367  SLGSNDEDIRKKITETENMMDRIVSGLSESSIKVRLAAVRCLHSLSRSVQQLRTSFHDHA  426

Query  294  VVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQK  353
            V   L+KLL  +   ++  A   + N++       + ++++G + +  SL  +  + ++ 
Sbjct  427  VWKPLMKLLQNAPDEVLVMASSTLCNLLLEFSPSKEPILESGVIELLCSLTQSDSSALRV  486

Query  354  EATWTMSNITAGRQDQIQ-QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN-YTSGGTVE  411
               W + N+      +++ ++V       L  +LS  D     + +  + N  ++   ++
Sbjct  487  NGIWALMNMAFQADQKVKVEIVRALGTEQLFRLLSDPDTNVLMKTLGLLRNLLSTRPHID  546

Query  412  QIVYLVHCGIIEPLMNLLTAKDT-KIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL  470
            QI+      I++ +  +L  + + ++    L  ++NI       G T K  IM ++   L
Sbjct  547  QIMSSHGKQIMQAVTLILEGEHSIEVKEQTLCILANIA-----DGNTAKELIMTDD-DML  600

Query  471  DKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGY  515
             KI+    H N  +  A+   I      EE+  Q    +    G+
Sbjct  601  QKIKYYMGHSNVKLQLAATFCISNLIWNEEDGSQERQDKLREMGF  645


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 92/243 (38%), Gaps = 10/243 (4%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLH--HDDPEVLADTCWAISYLTDGPNERIGMVV  290
            + N     N       V   +P L+ LL       E+  +    +  L+ G    I  +V
Sbjct  43   MKNAVIGNNKQKANLIVLGAVPRLLYLLQQSSSTLELRTECAVVLGSLSMGTENNIKSLV  102

Query  291  KTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNPKT  349
               ++P L++ L  S+L  +   LR +  +        Q++  D   +    SLL +   
Sbjct  103  DCHIIPALLQGLLCSDLIFIEACLRCLRTVFISPVTPVQLLYTDPTVIPHLMSLL-SRSQ  161

Query  350  NIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA--VWAVTNYTSG  407
            + Q+  T   ++     + Q   + NHG +  +  +L    +K + +A   ++V  Y + 
Sbjct  162  HTQEYITQIFAHCCKTPEHQT-VLFNHGAIQNIAPLLISPSYKVRMQALKCFSVLAYENA  220

Query  408  G-TVEQIVYLVHCGIIE-PLMNLL-TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
              ++  +  LV    +    + ++   K  ++ L     ++ + +A     E   + +  
Sbjct  221  QVSMTLVNVLVDGEQLSQVFVRMMQRDKPIEMQLTAAKCLTYMCRAGAIRTEDNCIVLKT  280

Query  465  EEC  467
              C
Sbjct  281  LPC  283


 Score = 61.9 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 75/490 (15%), Positives = 159/490 (32%), Gaps = 95/490 (19%)

Query  72   GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRT  131
              V  +    V  +   + +N LQ     +            N+I  G +P+ +  L ++
Sbjct  15   SEVTATSRHYVDRLFDPDPQNVLQGVIDMKN-AVIGNNKQKANLIVLGAVPRLLYLLQQS  73

Query  132  DCS-PIQFESAWALTNIASGTSEQTKAVVDGGAIPAF-----------------------  167
              +  ++ E A  L +++ GT    K++VD   IPA                        
Sbjct  74   SSTLELRTECAVVLGSLSMGTENNIKSLVDCHIIPALLQGLLCSDLIFIEACLRCLRTVF  133

Query  168  ------ISLLA-------------SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDP  208
                  + LL              S   H  E       +        + ++  +GA+  
Sbjct  134  ISPVTPVQLLYTDPTVIPHLMSLLSRSQHTQEYITQIFAHC-CKTPEHQTVLFNHGAIQN  192

Query  209  LLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDP-EV  267
            +  LL  P                  N   +      +   EQ+    VR++  D P E+
Sbjct  193  IAPLLISPSYKVRMQALKCFSVLAYENAQVSMTLVNVLVDGEQLSQVFVRMMQRDKPIEM  252

Query  268  LADTCWAISYLTDGPNERIG---MVVKTGVVPQLVKL-------------------LGAS  305
                   ++Y+      R     +V+KT  +P LV++                   L   
Sbjct  253  QLTAAKCLTYMCRAGAIRTEDNCIVLKT--LPCLVRMCSKERLLEERVEGAETLAYLMEP  310

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN--------PKTNIQKEATW  357
            ++ +          I + TD    ++ D        S +T+           +  ++A +
Sbjct  311  DIELQR--------IASVTDHLVSMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAF  362

Query  358  TMSNITAGRQDQIQQVV--NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVY  415
             +        + I++ +     ++  +VS LS++  K +  AV  + +  S    +    
Sbjct  363  KLYASLGSNDEDIRKKITETENMMDRIVSGLSESSIKVRLAAVRCLHSL-SRSVQQLRTS  421

Query  416  LVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA  475
                 + +PLM LL     +++++    + N+        E       I E G ++ + +
Sbjct  422  FHDHAVWKPLMKLLQNAPDEVLVMASSTLCNLLLEFSPSKEP------ILESGVIELLCS  475

Query  476  LQNHENESVY  485
            L   ++ ++ 
Sbjct  476  LTQSDSSALR  485


> sp|Q9C7R6|PUB17_ARATH U-box domain-containing protein 17 OS=Arabidopsis 
thaliana OX=3702 GN=PUB17 PE=2 SV=1
Length=729

 Score = 93.5 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 52/280 (19%), Positives = 109/280 (39%), Gaps = 10/280 (4%)

Query  121  IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE  180
            +   + +L     +  Q  +A  +  +A    E    + + GAIP    LL S +A   E
Sbjct  408  VSILIKYLADGSQAA-QTVAAREIRLLAKTGKENRAYIAEAGAIPHLCRLLTSENAIAQE  466

Query  181  QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK  240
             +V A+ N++        ++ +   ++ ++++L    +S L      N   TL +L    
Sbjct  467  NSVTAMLNLSIYEKNKSRIMEEGDCLESIVSVL----VSGLTVEAQENAAATLFSLSAVH  522

Query  241  NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK  300
                 I  V+Q +  L  LL +  P    D   A+  L+  P+    M+ + G V  LV 
Sbjct  523  EYKKRIAIVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMI-EGGGVSSLVG  581

Query  301  LLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS  360
             L      +   A  A+  +V  +     +  +  A+A    ++       ++ A   + 
Sbjct  582  ALK--NEGVAEEAAGALALLVRQSLGAEAIGKEDSAVAGLMGMMRCGTPRGKENAVAALL  639

Query  361  NIT-AGRQDQIQQVVNHGLVPFLVS-VLSKADFKTQKEAV  398
             +  +G     ++V+    +  L+  +L     + +++A 
Sbjct  640  ELCRSGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAA  679


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 56/313 (18%), Positives = 105/313 (34%), Gaps = 11/313 (4%)

Query  155  TKAVVDGG--AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL  212
            TKA V+     +   I  LA         A   +  +A  G   R  + + GA+  L  L
Sbjct  397  TKAAVEANKATVSILIKYLADGSQAAQTVAAREIRLLAKTGKENRAYIAEAGAIPHLCRL  456

Query  213  LAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI-DAVEQILPTLVRLLHHDDPEVLADT  271
            L   +  +            LS   +NK+      D +E I+  LV  L     E   + 
Sbjct  457  LTSENAIAQENSV--TAMLNLSIYEKNKSRIMEEGDCLESIVSVLVSGLT---VEAQENA  511

Query  272  CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVV  331
               +  L+     +  + +    V  L  LL          A+ A+ N+ T  D  +++ 
Sbjct  512  AATLFSLSAVHEYKKRIAIVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRM-  570

Query  332  IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADF  391
            I+ G ++     L N     +      +    +   + I +      V  L+ ++     
Sbjct  571  IEGGGVSSLVGALKNEGVAEEAAGALALLVRQSLGAEAIGK--EDSAVAGLMGMMRCGTP  628

Query  392  KTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAA  451
            + ++ AV A+      G       ++    I  L+  L    TK       +++ +FQ  
Sbjct  629  RGKENAVAALLELCRSGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRR  688

Query  452  EKLGETEKLSIMI  464
            E       +   +
Sbjct  689  ENAAMRSGVYGFV  701


 Score = 65.8 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 52/307 (17%), Positives = 108/307 (35%), Gaps = 13/307 (4%)

Query  54   SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
            +  P+++ +     +        +V  ++K +   +   Q  A +  R LL++  +    
Sbjct  384  TDSPNESFASALPTKAAVEANKATVSILIKYLADGSQAAQTVAAREIR-LLAKTGKENRA  442

Query  114  NIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS  173
             I  AG IP     L   +    Q  S  A+ N++     +++ + +G  + + +S+L S
Sbjct  443  YIAEAGAIPHLCRLLTSENAIA-QENSVTAMLNLSIYEKNKSRIMEEGDCLESIVSVLVS  501

Query  174  P-HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWT  232
                   E A   L +++      + + I    V+ L  LL             ++    
Sbjct  502  GLTVEAQENAAATLFSLSAVHEYKKRIAIVDQCVEALALLLQNG-----TPRGKKDAVTA  556

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L NL  + +    +      + +LV  L ++     A    A+        E IG   + 
Sbjct  557  LYNLSTHPDNCSRMIE-GGGVSSLVGALKNEGVAEEAAGALALLVRQSLGAEAIGK--ED  613

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQV-VIDAGALAVFPS-LLTNPKTN  350
              V  L+ ++          A+ A+  +           V+ A A+A     LL      
Sbjct  614  SAVAGLMGMMRCGTPRGKENAVAALLELCRSGGAAVAEKVLRAPAIAGLLQTLLFTGTKR  673

Query  351  IQKEATW  357
             +++A  
Sbjct  674  ARRKAAS  680


 Score = 45.0 bits (105),  Expect = 0.002, Method: Composition-based stats.
 Identities = 19/167 (11%), Positives = 59/167 (35%), Gaps = 25/167 (15%)

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP  380
             +    +  V  +   +++    L +     Q  A   +  +    ++    +   G +P
Sbjct  392  ASALPTKAAVEANKATVSILIKYLADGSQAAQTVAAREIRLLAKTGKENRAYIAEAGAIP  451

Query  381  FLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTA---------  431
             L  +L+  +   Q+ +V A+ N +     +  + +     +E ++++L +         
Sbjct  452  HLCRLLTSENAIAQENSVTAMLNLSIYEKNKSRI-MEEGDCLESIVSVLVSGLTVEAQEN  510

Query  432  ---------------KDTKIILVILDAISNIFQAAEKLGETEKLSIM  463
                           K   I+   ++A++ + Q     G+ + ++ +
Sbjct  511  AAATLFSLSAVHEYKKRIAIVDQCVEALALLLQNGTPRGKKDAVTAL  557


> sp|Q99569|PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 
PE=1 SV=2
Length=1192

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 75/466 (16%), Positives = 157/466 (34%), Gaps = 60/466 (13%)

Query  58   DDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIR  117
              +   +Q++       +  + +++  +       Q  A    + L           + R
Sbjct  510  SPSIDSIQKDPREFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHL-CFGDNKVKMEVCR  568

Query  118  AGLIPKFVSFLGRTDCSPIQFESAWALTNIASG--TSEQTKAVVDGGAIPAFISLL-ASP  174
             G I   V  L       +Q  +  AL N+  G  T E   A+ + G IPA + LL  S 
Sbjct  569  LGGIKHLVDLL-DHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSI  627

Query  175  HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACG----------  224
             A + E     L N++   +V   ++    A+  L   + VP                  
Sbjct  628  DAEVRELVTGVLWNLSSCDAVKMTIIRD--ALSTLTNTVIVPHSGWNNSSFDDDHKIKFQ  685

Query  225  ---YLRNLTWTLSNLCR-NKNPAPPIDAVEQILPTLVRLLH------HDDPEVLADTCWA  274
                LRN T  L NL    +     + + E ++ +L+ ++H        D + + +    
Sbjct  686  TSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCT  745

Query  275  ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALR------------------A  316
            +  L+      +      G + +L  LLG       +                       
Sbjct  746  LRNLSYRLELEVPQARLLG-LNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDG  804

Query  317  IGNI--VTGTDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGR----QDQ  369
            +G I  ++ + +  +++     +  + +LL  +      + +  ++ N++AG        
Sbjct  805  VGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYI  864

Query  370  IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
               V     +P LV +L   + +       A+ N       +    L+    +  L+N L
Sbjct  865  RAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNK---ELIGKYAMRDLVNRL  921

Query  430  TAKDTKIILV--ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI  473
               +   +L    + AI       E   +  + +  + + GG++K+
Sbjct  922  PGGNGPSVLSDETMAAI--CCALHEVTSKNMENAKALADSGGIEKL  965


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 60/407 (15%), Positives = 130/407 (32%), Gaps = 69/407 (17%)

Query  107  EKQPPIDNII--------RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV  158
             + P ID+I         R   +P+ +  L       +Q  +A  L ++  G ++    V
Sbjct  508  TRSPSIDSIQKDPREFAWRDPELPEVIHMLQHQ-FPSVQANAAAYLQHLCFGDNKVKMEV  566

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNI--AGDGSVFRDLVIKYGAVDPLLALLAVP  216
               G I   + LL      + + A  AL N+         +  +   G +  LL LL   
Sbjct  567  CRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKS  626

Query  217  DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRL-----------------  259
              + +    +  + W LS        A  +  +   L TL                    
Sbjct  627  IDAEVR-ELVTGVLWNLS-----SCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDH  680

Query  260  -LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGAS------ELPIVT  311
             +      VL +T   +  L+    E    +    G+V  L+ ++         +   V 
Sbjct  681  KIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVE  740

Query  312  PALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE-ATW-------------  357
              +  + N+    + +       G L     LL     +   E + W             
Sbjct  741  NCVCTLRNLSYRLELEVPQARLLG-LNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQE  799

Query  358  ----TMSNI--TAGRQDQIQQVVNHGLVPFLVSVL-SKADFKTQKEAVWAVTNYTSGGTV  410
                 +  I   +     ++ + +  +V   +++L   ++  T + +  ++ N ++ G  
Sbjct  800  DQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSA-GNW  858

Query  411  EQIVYLVHC----GIIEPLMNLLTAKDTKIILVILDAISNIFQAAEK  453
            +   Y+         +  L+ LL   + +++  +  A+ N+      
Sbjct  859  KFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRN  905


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 66/415 (16%), Positives = 131/415 (32%), Gaps = 62/415 (15%)

Query  91   ENQLQATQAARKLL---SREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNI  147
            E Q  A  A R L+   S ++          G IP  +  L ++  + ++      L N+
Sbjct  585  EVQKNACGALRNLVFGKSTDENKIAMK--NVGGIPALLRLLRKSIDAEVRELVTGVLWNL  642

Query  148  ASGTSEQTKAVVDGGAIPAFISLL---------ASPHAH---------ISEQAVWALGNI  189
            +S   +  K  +   A+    + +         +S             +       L N+
Sbjct  643  SS--CDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNL  700

Query  190  AGDGSVFRDLVIKY-GAVDPLLALLA-VPDMSSLACGYLRNLTWTLSNLCRN---KNPAP  244
            +  G   R  +    G VD LL ++    + S      + N   TL NL      + P  
Sbjct  701  SSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQA  760

Query  245  PIDAVEQILPTLVRLLHHDDPEV-----------------LADTCWAISYLTDGPNERIG  287
             +  + ++   L +     D E                    D    I  L+  P     
Sbjct  761  RLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEM  820

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGT----DEQTQVVIDAGALAVFPSL  343
            +   + V P L  L  +S    +  +  ++ N+  G           V     L +   L
Sbjct  821  LWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVEL  880

Query  344  LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLS--KADFKTQKEAVWAV  401
            L      +       + N+    ++  ++++    +  LV+ L           E + A+
Sbjct  881  LRMDNDRVVSSVATALRNMALDVRN--KELIGKYAMRDLVNRLPGGNGPSVLSDETMAAI  938

Query  402  T---NYTSGGTVEQIVYLVHCGIIEPLMNLL----TAKDTKIILVILDAISNIFQ  449
                +  +   +E    L   G IE L+N+          K++      ++ ++Q
Sbjct  939  CCALHEVTSKNMENAKALADSGGIEKLVNITKGRGDRSSLKVVKAAAQVLNTLWQ  993


> sp|Q96DC7|TMCO6_HUMAN Transmembrane and coiled-coil domain-containing 
protein 6 OS=Homo sapiens OX=9606 GN=TMCO6 PE=1 SV=2
Length=493

 Score = 90.8 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 79/461 (17%), Positives = 166/461 (36%), Gaps = 39/461 (8%)

Query  40   KAKKDDQMLKRRNV-SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQ  98
            KA+++ Q++ +R + +  P++A          +  V   +    +G      E    A  
Sbjct  32   KARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQFLRQAQRGTEEKEREG---ALV  88

Query  99   AARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV  158
            + R+ L   +      I   G +   V  L  ++ + +Q E+A  L  + S + + T A 
Sbjct  89   SLRRGLQHPETQQ-TFIRLEGSMRTLVGLLT-SNQALLQLEAARCLHEL-SHSEQSTVAE  145

Query  159  VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM  218
                A    ++ L+S  +   E  ++ LGN+  +    R  ++  G V  L A +  P +
Sbjct  146  ACLPATSYLLTYLSSHSSDFIELCLYTLGNLIVESEAVRRQLLPQGIVPALAACIQSPHV  205

Query  219  SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH---HDDPEVLADTCWAI  275
            +      L      L           P      +   ++++L      +P V  +  W +
Sbjct  206  AV--LEALGYALSQLLQAEEAPEKIIPSILASTLPQHMLQMLQPGPKLNPGVAVEFAWCL  263

Query  276  SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIV-----------TPALRAIGNIVT--  322
             Y+         +++  G +  L  LL      +             P LR + N++T  
Sbjct  264  HYIICSQVSN-PLLIGHGALSTLGLLLLDLAGAVQKTEDAGLELLACPVLRCLSNLLTEA  322

Query  323  -----GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHG  377
                 G   Q +      AL +        + ++  E  W ++N+TA        +++  
Sbjct  323  AVETVGGQMQLRDERVVAALFILLQFFFQKQPSLLPEGLWLLNNLTANSPSFCTSLLSLD  382

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
            L+  L+ +L  ++       +  + N    G       L    ++  L++ L   DT+++
Sbjct  383  LIEPLLQLLPVSNV-VSVMVLTVLCNVAEKG-PAYCQRLWPGPLLPALLHTLAFSDTEVV  440

Query  438  LVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQN  478
                   S        L + E + + +++  GL  +E  Q 
Sbjct  441  -----GQSLELLHLLFLYQPEAVQVFLQQS-GLQALERHQE  475


> sp|O35927|CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 
GN=Ctnnd2 PE=1 SV=1
Length=1247

 Score = 91.6 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 63/424 (15%), Positives = 132/424 (31%), Gaps = 82/424 (19%)

Query  108  KQPPIDNII--------RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV  159
            + P ID+I         R   +P+ +  L       +Q  +A  L ++  G ++    + 
Sbjct  528  RSPSIDSIQKDPREFGWRDPELPEVIQMLQHQ-FPSVQSNAAAYLQHLCFGDNKIKAEIR  586

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNI--AGDGSVFRDLVIKYGAVDPLLALLAVPD  217
              G I   + LL      +   A  AL N+         +  +   G +  L+ LL    
Sbjct  587  RQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTT  646

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV--------------RLLHHD  263
               +    +  + W LS+ C         DA+  +   ++              R +   
Sbjct  647  DLEIR-ELVTGVLWNLSS-CDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLH  704

Query  264  DPEVLADTCWAISYLTDGPNERIGMVVKTGVVP-QLVKLLGAS------ELPIVTPALRA  316
              +VL +    +  ++    E    + +   +   L+ ++ ++      +   V   +  
Sbjct  705  SSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCI  764

Query  317  IGNIVTGTDEQTQVVIDAGA--LAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ-----  369
            + N+      +T      G   L       TN K        W         QDQ     
Sbjct  765  LRNLSYRLAAETSQGQHMGTDELDGLLCGETNGKDTESS-GCWGKKKKKKKSQDQWDGVG  823

Query  370  -----------IQQVVNHGLVPFLVSVLSK-ADFKTQKEAVWAVTNYTSGG---------  408
                       IQ + +  +V   +++LS+ ++  T + A  A+ N  +G          
Sbjct  824  PLPDCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAEDVA  883

Query  409  ---------------TVEQIVYLVHC----GIIEPLMNLLTAKDTKIILVILDAISNIFQ  449
                             +  VY+         +  L+ LL   + +++  +  A+ N+  
Sbjct  884  GMAYALRSLPEGAPCLPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMAL  943

Query  450  AAEK  453
                
Sbjct  944  DVRN  947


 Score = 85.8 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 69/495 (14%), Positives = 145/495 (29%), Gaps = 82/495 (17%)

Query  54    SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPID  113
             +     +   +Q++    G  +  + ++++ +       Q  A    + L          
Sbjct  525   TLARSPSIDSIQKDPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHL-CFGDNKIKA  583

Query  114   NIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG--TSEQTKAVVDGGAIPAFISLL  171
              I R G I   V  L     + +   +  AL N+  G    +   A+ + G IPA + LL
Sbjct  584   EIRRQGGIQLLVDLL-DHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLL  642

Query  172   -ASPHAHISEQAVWALGNI----AGDGSVFRDL--VIKYGAVDPLLALLAVPDMSSLACG  224
               +    I E     L N+    A    + +D   V+    + P       P        
Sbjct  643   RKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQ  702

Query  225   -----YLRNLTWTLSNLCR-NKNPAPPIDAVEQILPTLVRLLHHD------DPEVLADTC  272
                   LRN T  L N+    +     +   + +   L+ ++         D + + +  
Sbjct  703   LHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCV  762

Query  273   WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ---  329
               +  L+           +     +L  LL        T +    G        Q Q   
Sbjct  763   CILRNLSYRLAAETSQ-GQHMGTDELDGLLCGETNGKDTESSGCWGKKKKKKKSQDQWDG  821

Query  330   ---------------VVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGR-------  366
                            ++     +  + +LL+     +  + A   + N+ AG        
Sbjct  822   VGPLPDCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAED  881

Query  367   ----------------------QDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY  404
                                         V     +P LV +L   + +       A+ N 
Sbjct  882   VAGMAYALRSLPEGAPCLPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNM  941

Query  405   TSGGTVEQIV------YLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
                   ++++       LVH   +    N   +    +    + A+       E + +  
Sbjct  942   ALDVRNKELIGKYAMRDLVHR--LPGGNNSNNSGSKAMSDDTVTAV--CCTLHEVITKNM  997

Query  459   KLSIMIEECGGLDKI  473
             + +  + + GG++K+
Sbjct  998   ENAKALRDAGGIEKL  1012


 Score = 81.2 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 53/287 (18%), Positives = 108/287 (38%), Gaps = 37/287 (13%)

Query  190  AGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV  249
            AG  S + D    Y  +    ++ +    S  A      L  + S     K+P       
Sbjct  490  AGPASNYAD---PYRQLQYCASVDSPYSKSGPALPPEGTLARSPSIDSIQKDPR-EFGWR  545

Query  250  EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI  309
            +  LP ++++L H  P V ++    + +L  G N+    + + G +  LV LL      +
Sbjct  546  DPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEV  605

Query  310  VTPALRAIGNIVTG--TDEQTQVVIDAGALAVFPSLL-TNPKTNIQKEATWTMSNITAGR  366
               A  A+ N+V G   D+    + + G +     LL       I++  T  + N+++  
Sbjct  606  HRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDLEIRELVTGVLWNLSSCD  665

Query  367  -------QDQIQQVVNHGLVP-------FL-----VSVLSKADFKTQKEAVWAVTNYTSG  407
                   QD +  + N  ++P        L     + + S    +  + A   + N +S 
Sbjct  666  ALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSS---QVLRNATGCLRNVSSA  722

Query  408  GTVEQIVYLVHCGII-EPLMNLLTAK------DTKIILVILDAISNI  447
            G  E    +  C  + + L+ ++ +       D+K +   +  + N+
Sbjct  723  GE-EARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNL  768


 Score = 68.1 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 73/443 (16%), Positives = 126/443 (28%), Gaps = 90/443 (20%)

Query  91    ENQLQATQAARKLLSREKQPPIDNII--RAGLIPKFVSFLGRTDCSPIQFESAWALTNIA  148
             E    A  A R L+  +     + I     G IP  V  L +T    I+      L N++
Sbjct  604   EVHRSACGALRNLVYGKANDD-NKIALKNCGGIPALVRLLRKTTDLEIRELVTGVLWNLS  662

Query  149   SGTSEQTKAVVDGGAI--------------PAF-----ISLLASPHAHISEQAVWALGNI  189
             S  + +   + D  A+                      I L +S    +   A   L N+
Sbjct  663   SCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSS---QVLRNATGCLRNV  719

Query  190   AGDGSVFRDLVIKY-GAVDPLLALLAVPDMSS-LACGYLRNLTWTLSNLCRNKNPAPPID  247
             +  G   R  + +  G  D LL ++     SS +    + N    L NL   +  A    
Sbjct  720   SSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNLSY-RLAAETSQ  778

Query  248   AVEQILPTLVRLL--HHDDPEVLADTCWAISYL----------------TDGPNERIGMV  289
                     L  LL    +  +  +  CW                        P + I M+
Sbjct  779   GQHMGTDELDGLLCGETNGKDTESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQML  838

Query  290   VKTGVV-PQLVKLLGASELPIVTPALRAIGNIVTG-------------------------  323
                 +V P L  L   S    +  A  A+ N+  G                         
Sbjct  839   WHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAEDVAGMAYALRSLPEGAPC  898

Query  324   ----TDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
                 +      V     L +   LL      +       + N+    ++  ++++    +
Sbjct  899   LPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRN--KELIGKYAM  956

Query  380   PFLVSVL-----------SKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNL  428
               LV  L                 T       +    +   +E    L   G IE L+ +
Sbjct  957   RDLVHRLPGGNNSNNSGSKAMSDDTVTAVCCTLHEVITK-NMENAKALRDAGGIEKLVGI  1015

Query  429   LTAKDTKIILVILDAISNIFQAA  451
               +K  K    ++ A S +  + 
Sbjct  1016  SKSKGDKHSPKVVKAASQVLNSM  1038


> sp|O93614|GDS1A_XENLA Rap1 GTPase-GDP dissociation stimulator 
1-A OS=Xenopus laevis OX=8355 GN=rap1gds1-a PE=1 SV=1
Length=607

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 65/380 (17%), Positives = 130/380 (34%), Gaps = 33/380 (9%)

Query  99   AARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ---T  155
               + L        + I ++G++  F S L        Q   A  + +I +  ++     
Sbjct  29   CLLQALGHNNTESSEKIQQSGILQLFASILNS------QSSCASKVAHIVAEIAKNELMR  82

Query  156  KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA----VDPLLA  211
               V+ G IP  + LL S    +  Q   ALGNI  D    R  V + G     VD L +
Sbjct  83   IPCVEAGLIPPLVQLLHSKDQEVLLQTGRALGNICYDNHEGRRAVDQEGGAQIVVDHLRS  142

Query  212  LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEV-LAD  270
            +  + D SS     +      L N     +          ++P LV LL        L +
Sbjct  143  MCTLTDPSSEKLMTVFCGM--LMNYSSENDSLQTQLIQMGVIPILVDLLGVHSQNTALTE  200

Query  271  TCW-AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQ  329
             C  A   L +           T +  ++VKL            +  +   +   D    
Sbjct  201  MCLVAFGNLAEL-ESSKEQFAGTNIAEEIVKLFKKQTEHEKREIIFEVLAPLAENDAIKM  259

Query  330  VVIDAGALAVFPSLLTNPKTNIQK------EATWTMSNITAGRQDQIQQVVNHG---LVP  380
             +++AG +     ++     + +       + +  +  +     + +Q++   G   +  
Sbjct  260  QLVEAGLVECLLDVVQQTVNSEKDDDIAELKTSSDLMVLLLLGDESMQKLFEGGKGSVFQ  319

Query  381  FLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT----AKDTKI  436
             ++S L   + + Q     A+ N+         +++V   I++ L++LL       +  +
Sbjct  320  RVLSWLPSNNHQLQLAGALAIANFARNDG--NCIHMVDSEIVQKLLDLLDRHVEDGNVTV  377

Query  437  ILVILDAISNIFQAAEKLGE  456
                L A+ N+        +
Sbjct  378  QHAALSALRNLAIPVVNKAK  397


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 67/459 (15%), Positives = 146/459 (32%), Gaps = 68/459 (15%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGR------T  131
            +  +V+ ++S + E  LQ  +A   +   +       + + G     V  L         
Sbjct  91   IPPLVQLLHSKDQEVLLQTGRALGNI-CYDNHEGRRAVDQEGGAQIVVDHLRSMCTLTDP  149

Query  132  DCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL--ASPHAHISEQAVWALGNI  189
                +       L N +S        ++  G IP  + LL   S +  ++E  + A GN+
Sbjct  150  SSEKLMTVFCGMLMNYSSENDSLQTQLIQMGVIPILVDLLGVHSQNTALTEMCLVAFGNL  209

Query  190  AGDGSVFRDL-----------------------------------------VIKYGAVDP  208
            A   S                                              +++ G V+ 
Sbjct  210  AELESSKEQFAGTNIAEEIVKLFKKQTEHEKREIIFEVLAPLAENDAIKMQLVEAGLVEC  269

Query  209  LL---ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ-ILPTLVRLLHHDD  264
            LL         +          +    +  L  +++     +  +  +   ++  L  ++
Sbjct  270  LLDVVQQTVNSEKDDDIAELKTSSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWLPSNN  329

Query  265  PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL----GASELPIVTPALRAIGNI  320
             ++      AI+         I MV  + +V +L+ LL        + +   AL A+ N+
Sbjct  330  HQLQLAGALAIANFARNDGNCIHMV-DSEIVQKLLDLLDRHVEDGNVTVQHAALSALRNL  388

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLV  379
                      ++ AG        L +    +Q +   T+  +   + +  +Q+  N  L 
Sbjct  389  AI-PVVNKAKMLSAGVAEEVLKFLRSEMPPVQFKLLGTLRMLIDAQAEAAEQIGKNEKLA  447

Query  380  PFLVSVLSKADF-KTQKEAVWAVTNYTSGG-TVEQIVYLVHCGIIEPLMNLLTAKDTKII  437
              LV      D      E+   ++       + + I  +V  G I+ L+ + T++   + 
Sbjct  448  ERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIRTIVQSGGIKHLVTMATSEHVIMQ  507

Query  438  LVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
               L A+  I     +  E +     +E    ++ +  L
Sbjct  508  NEALVALGLIAALELQAAEHD-----LESAKLVEVLHRL  541


 Score = 73.5 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 76/450 (17%), Positives = 151/450 (34%), Gaps = 42/450 (9%)

Query  62   SPLQENRNNQGTVNWSVDDIVK--GINSSNV---ENQLQATQAARKLLSREKQPPIDNII  116
            S   ++   Q      +  +V   G++S N    E  L A     +L S ++Q    NI 
Sbjct  166  SSENDSLQTQLIQMGVIPILVDLLGVHSQNTALTEMCLVAFGNLAELESSKEQFAGTNIA  225

Query  117  RAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI----SLLA  172
                I K        +   I FE    L    +        +V+ G +   +      + 
Sbjct  226  EE--IVKLFKKQTEHEKREIIFEVLAPL----AENDAIKMQLVEAGLVECLLDVVQQTVN  279

Query  173  SPHAH----ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
            S        +   +   +  + GD S+ +      G+V   +      +   L       
Sbjct  280  SEKDDDIAELKTSSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWLPSNNHQLQLAG---  336

Query  229  LTWTLSNLCRNKNPAPPI---DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNER  285
                ++N  RN      +   + V+++L  L R +   +  V      A+  L   P   
Sbjct  337  -ALAIANFARNDGNCIHMVDSEIVQKLLDLLDRHVEDGNVTVQHAALSALRNLAI-PVVN  394

Query  286  IGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLL-  344
               ++  GV  +++K L +   P+    L  +  ++   D Q +     G        L 
Sbjct  395  KAKMLSAGVAEEVLKFLRSEMPPVQFKLLGTLRMLI---DAQAEAAEQIGKNEKLAERLV  451

Query  345  ----TNPKTNIQKEATWTMSNITAGRQ--DQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
                      +  E+   +S +    +  D I+ +V  G +  LV++ +      Q EA+
Sbjct  452  EWCEAKDHAGVMGESNRLLSALIRHSKSKDVIRTIVQSGGIKHLVTMATSEHVIMQNEAL  511

Query  399  WAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE  458
             A+    +         L    ++E L  LL  +         +   N          + 
Sbjct  512  VALGLIAALELQAAEHDLESAKLVEVLHRLLLDE-----RSAPEIKYNSMVLICAAMGSV  566

Query  459  KLSIMIEECGGLDKIEALQNHENESVYKAS  488
             L   +++   LD +  L++HEN++V + +
Sbjct  567  PLHKEVQKLAFLDVVSKLRSHENKTVAQQA  596


 Score = 59.6 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 64/376 (17%), Positives = 128/376 (34%), Gaps = 60/376 (16%)

Query  37   ELRKAKKDDQMLKRRNV---SSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSN----  89
            E+ K  K     ++R +      P      ++      G V   +D + + +NS      
Sbjct  227  EIVKLFKKQTEHEKREIIFEVLAPLAENDAIKMQLVEAGLVECLLDVVQQTVNSEKDDDI  286

Query  90   VENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIAS  149
             E +  +      LL  E    +    +  +  + +S+L  ++   +Q   A A+ N A 
Sbjct  287  AELKTSSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWLP-SNNHQLQLAGALAIANFAR  345

Query  150  GTSEQTKAVVDGGAIPAFISLL----ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA  205
                    +VD   +   + LL       +  +   A+ AL N+A    V +  ++  G 
Sbjct  346  -NDGNCIHMVDSEIVQKLLDLLDRHVEDGNVTVQHAALSALRNLAI-PVVNKAKMLSAGV  403

Query  206  VDPLLALLAV--PDMSSLACGYLRNLTWT-----------------LSNLCRNKNPAPPI  246
             + +L  L    P +     G LR L                    L   C  K+ A  +
Sbjct  404  AEEVLKFLRSEMPPVQFKLLGTLRMLIDAQAEAAEQIGKNEKLAERLVEWCEAKDHAGVM  463

Query  247  DAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASE  306
                ++L  L+R     D                     I  +V++G +  LV +  +  
Sbjct  464  GESNRLLSALIRHSKSKDV--------------------IRTIVQSGGIKHLVTMATSEH  503

Query  307  LPIVTPALRAIGNIVTGTDEQTQVVID-AGALAVFPSLLTNPK--TNIQKEA----TWTM  359
            + +   AL A+G I     +  +  ++ A  + V   LL + +    I+  +       M
Sbjct  504  VIMQNEALVALGLIAALELQAAEHDLESAKLVEVLHRLLLDERSAPEIKYNSMVLICAAM  563

Query  360  SNITAGRQDQIQQVVN  375
             ++   ++ Q    ++
Sbjct  564  GSVPLHKEVQKLAFLD  579


> sp|P70478|APC_RAT Adenomatous polyposis coli protein OS=Rattus 
norvegicus OX=10116 GN=Apc PE=1 SV=1
Length=2842

 Score = 88.5 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 100/273 (37%), Gaps = 18/273 (7%)

Query  135  PIQFESAWALTNIASGTSEQTKAVVD-GGAIPAFISLLASPHAHISEQAVWALGNIA-GD  192
             ++  +  ALTN+  G       +    G + A ++ L S    + +     L N++   
Sbjct  494  TLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRA  553

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
                +  + + G+V  L+         S     L +  W LS  C        I AV+  
Sbjct  554  DVNSKKTLREVGSVKALMECALEVKKESTLKSVL-SALWNLSAHCTENK--ADICAVDGA  610

Query  253  LPTLVRLL----HHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLLGAS  305
            L  LV  L      +   ++      +  ++       +   ++ +   +  L++ L + 
Sbjct  611  LAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH  670

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
             L IV+ A   + N+     +  + + D GA+++  +L+ +    I   +   + N+ A 
Sbjct  671  SLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  730

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            R  + +   +  ++    S+        +K+  
Sbjct  731  RPAKYK---DANIMSPGSSL---PSLHVRKQKA  757


 Score = 87.8 bits (216),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 50/282 (18%), Positives = 90/282 (32%), Gaps = 29/282 (10%)

Query  149  SGTSEQTKAVVDGGAIPAFISLLA-----------SPHAHISEQAVWALGNIA-GDGSVF  196
            S   E   A+ + G + A   LL                 +   A  AL N+  GD +  
Sbjct  455  SFDEEHRHAMNELGGLQAIAELLQVDCEMHGLTDDHYSVTLRRYAGMALTNLTFGDVANK  514

Query  197  RDLVIKYGAVDPLLALLAVP--DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              L    G +  L+A L     D+  +    LRNL+W      R    +         + 
Sbjct  515  ATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSW------RADVNSKKTLREVGSVK  568

Query  255  TLVRL-LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGASELPIVTP  312
             L+   L       L     A+  L+    E    +    G +  LV  L          
Sbjct  569  ALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLA  628

Query  313  A-------LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
                    LR + +++   ++  Q++ +   L      L +    I   A  T+ N++A 
Sbjct  629  IIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSAR  688

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG  407
                 + + + G V  L +++          +  A+ N  + 
Sbjct  689  NPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  730


 Score = 67.7 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/309 (16%), Positives = 98/309 (32%), Gaps = 49/309 (16%)

Query  50   RRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQ  109
            RR       + T     N+    ++   +  +V  + S + + Q       R L  R   
Sbjct  496  RRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADV  555

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT--KAVVDGGAIPAF  167
                 +   G +   +                 AL N+++  +E       VD GA+   
Sbjct  556  NSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVD-GALAFL  614

Query  168  ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
            +                  G +          +I+ G                   G LR
Sbjct  615  V------------------GTLTYRSQTNTLAIIESGG------------------GILR  638

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG  287
            N++   S +  N++    I      L TL++ L      ++++ C  +  L+    +   
Sbjct  639  NVS---SLIATNED-HRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQE  694

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP  347
             +   G V  L  L+ +    I   +  A+ N++     + +   DA  ++   SL   P
Sbjct  695  ALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYK---DANIMSPGSSL---P  748

Query  348  KTNIQKEAT  356
              +++K+  
Sbjct  749  SLHVRKQKA  757


 Score = 64.6 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 70/532 (13%), Positives = 164/532 (31%), Gaps = 90/532 (17%)

Query  22   KDSTEMRRRRIEVNVELRKAKKDDQMLKRRNV----SSFPDDATSPLQENRNNQGTVNWS  77
            +D  +  +RRI    ++ K      +L+ R +    ++  + ++    E  +++      
Sbjct  206  QDMEKRAQRRIARIQQIEKD-----ILRVRQLLQSQAAEAERSSQSKHETASHEAERQLE  260

Query  78   VDDIVKGINSSNVENQLQATQAARKLL-----SREKQPPIDNIIRAG----LIPKFVSFL  128
               + +   +++   Q  A +   +       S     P       G    ++   +S L
Sbjct  261  GQGVAESNLATSGSGQSSAARVDHETAGVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSML  320

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH-----------  177
            G  D   +       L  ++S + +   ++   G +P  I LL                 
Sbjct  321  GTHDKDDMSRT----LLAMSS-SQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSK  375

Query  178  -ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-----------------AVPDMS  219
                +A  AL NI       +    +   +  LL  +                    D +
Sbjct  376  EARARASAALHNIIHSQPDDKRGRREIRVL-HLLEQIRAYCETCWEWQEAHEQGMDQDKN  434

Query  220  SLACGY---LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH-----------HDDP  265
             +       +      L  L  ++     ++ +   L  +  LL            H   
Sbjct  435  PMPAPVEHQICPAVCVLMKLSFDEEHRHAMNEL-GGLQAIAELLQVDCEMHGLTDDHYSV  493

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVV-PQLVKLLGASELPIVTPALRAIGNIVTGT  324
             +      A++ LT G       +         LV  L +    +       + N+    
Sbjct  494  TLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRA  553

Query  325  DEQTQVVI-DAGALAVFPSL-LTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPF  381
            D  ++  + + G++       L   K +  K     + N++A   +    +    G + F
Sbjct  554  DVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAF  613

Query  382  LVSVLSKADFKTQKEAVWAV-------TNYTS--GGTVEQIVYLVHCGIIEPLMNLLTAK  432
            LV  L+   +++Q   +  +        N +S      +    L     ++ L+  L + 
Sbjct  614  LVGTLT---YRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH  670

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
               I+      + N+     K  E       + + G +  ++ L + +++ +
Sbjct  671  SLTIVSNACGTLWNLSARNPKDQE------ALWDMGAVSMLKNLIHSKHKMI  716


> sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo 
sapiens OX=9606 GN=TRIP12 PE=1 SV=1
Length=1992

 Score = 88.1 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 89/228 (39%), Gaps = 15/228 (7%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
              +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I  
Sbjct  440  QQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMN  499

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFR  197
             +  ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S   
Sbjct  500  HACRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS---  554

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +++ G +   L  L        +    RN     +N C++  P      V   LP L 
Sbjct  555  KAILQAGGLADCLLYLEF-----FSINAQRNALAIAANCCQSITP-DEFHFVADSLPLLT  608

Query  258  RLLHHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLL  302
            + L H D + +  TC   + L D        +  V    ++  + +LL
Sbjct  609  QRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLL  656


 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/190 (18%), Positives = 66/190 (35%), Gaps = 8/190 (4%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTD-GPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPA  313
            L++ L   D          +  L   G  E +G      VVP L+ LL       I+  A
Sbjct  442  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  501

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             RA+  ++      + VV+DA        L      ++ ++A   +  +    +   + +
Sbjct  502  CRALTYMMEALPRSSAVVVDA-IPVFLEKLQVIQCIDVAEQALTALEML---SRRHSKAI  557

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            +  G +   +  L       Q+ A+    N     T ++  ++     +  L   LT +D
Sbjct  558  LQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADS--LPLLTQRLTHQD  615

Query  434  TKIILVILDA  443
             K +      
Sbjct  616  KKSVESTCLC  625


> sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus 
musculus OX=10090 GN=Trip12 PE=1 SV=1
Length=2025

 Score = 88.1 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 89/228 (39%), Gaps = 15/228 (7%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
              +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I  
Sbjct  446  QQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMN  505

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFR  197
             +  ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S   
Sbjct  506  HACRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS---  560

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +++ G +   L  L        +    RN     +N C++  P      V   LP L 
Sbjct  561  KAILQAGGLADCLLYLEF-----FSINAQRNALAIAANCCQSITP-DEFHFVADSLPLLT  614

Query  258  RLLHHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLL  302
            + L H D + +  TC   + L D        +  V    ++  + +LL
Sbjct  615  QRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLL  662


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/190 (18%), Positives = 66/190 (35%), Gaps = 8/190 (4%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTD-GPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPA  313
            L++ L   D          +  L   G  E +G      VVP L+ LL       I+  A
Sbjct  448  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  507

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             RA+  ++      + VV+DA        L      ++ ++A   +  +    +   + +
Sbjct  508  CRALTYMMEALPRSSAVVVDA-IPVFLEKLQVIQCIDVAEQALTALEML---SRRHSKAI  563

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            +  G +   +  L       Q+ A+    N     T ++  ++     +  L   LT +D
Sbjct  564  LQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADS--LPLLTQRLTHQD  621

Query  434  TKIILVILDA  443
             K +      
Sbjct  622  KKSVESTCLC  631


> sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos 
taurus OX=9913 GN=TRIP12 PE=2 SV=2
Length=1992

 Score = 88.1 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 89/228 (39%), Gaps = 15/228 (7%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
              +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I  
Sbjct  440  QQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMN  499

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFR  197
             +  ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S   
Sbjct  500  HACRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS---  554

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +++ G +   L  L        +    RN     +N C++  P      V   LP L 
Sbjct  555  KAILQAGGLADCLLYLEF-----FSINAQRNALAIAANCCQSITP-DEFHFVADSLPLLT  608

Query  258  RLLHHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLL  302
            + L H D + +  TC   + L D        +  V    ++  + +LL
Sbjct  609  QRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLL  656


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/190 (18%), Positives = 66/190 (35%), Gaps = 8/190 (4%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTD-GPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPA  313
            L++ L   D          +  L   G  E +G      VVP L+ LL       I+  A
Sbjct  442  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  501

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             RA+  ++      + VV+DA        L      ++ ++A   +  +    +   + +
Sbjct  502  CRALTYMMEALPRSSAVVVDA-IPVFLEKLQVIQCIDVAEQALTALEML---SRRHSKAI  557

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            +  G +   +  L       Q+ A+    N     T ++  ++     +  L   LT +D
Sbjct  558  LQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADS--LPLLTQRLTHQD  615

Query  434  TKIILVILDA  443
             K +      
Sbjct  616  KKSVESTCLC  625


> sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus 
norvegicus OX=10116 GN=Trip12 PE=1 SV=1
Length=2025

 Score = 88.1 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 89/228 (39%), Gaps = 15/228 (7%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
              +++G+ +S+   QLQA     +LL    +  +       ++P  ++ L       I  
Sbjct  446  QQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMN  505

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFR  197
             +  ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S   
Sbjct  506  HACRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS---  560

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +++ G +   L  L        +    RN     +N C++  P      V   LP L 
Sbjct  561  KAILQAGGLADCLLYLEF-----FSINAQRNALAIAANCCQSITP-DEFHFVADSLPLLT  614

Query  258  RLLHHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLL  302
            + L H D + +  TC   + L D        +  V    ++  + +LL
Sbjct  615  QRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLL  662


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/190 (18%), Positives = 66/190 (35%), Gaps = 8/190 (4%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTD-GPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPA  313
            L++ L   D          +  L   G  E +G      VVP L+ LL       I+  A
Sbjct  448  LLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  507

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             RA+  ++      + VV+DA        L      ++ ++A   +  +    +   + +
Sbjct  508  CRALTYMMEALPRSSAVVVDA-IPVFLEKLQVIQCIDVAEQALTALEML---SRRHSKAI  563

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            +  G +   +  L       Q+ A+    N     T ++  ++     +  L   LT +D
Sbjct  564  LQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADS--LPLLTQRLTHQD  621

Query  434  TKIILVILDA  443
             K +      
Sbjct  622  KKSVESTCLC  631


> sp|Q61315|APC_MOUSE Adenomatous polyposis coli protein OS=Mus 
musculus OX=10090 GN=Apc PE=1 SV=1
Length=2845

 Score = 88.1 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 100/273 (37%), Gaps = 18/273 (7%)

Query  135  PIQFESAWALTNIASGTSEQTKAVVD-GGAIPAFISLLASPHAHISEQAVWALGNIA-GD  192
             ++  +  ALTN+  G       +    G + A ++ L S    + +     L N++   
Sbjct  494  TLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRA  553

Query  193  GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI  252
                +  + + G+V  L+         S     L +  W LS  C        I AV+  
Sbjct  554  DVNSKKTLREVGSVKALMECALEVKKESTLKSVL-SALWNLSAHCTENK--ADICAVDGA  610

Query  253  LPTLVRLL----HHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLLGAS  305
            L  LV  L      +   ++      +  ++       +   ++ +   +  L++ L + 
Sbjct  611  LAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH  670

Query  306  ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
             L IV+ A   + N+     +  + + D GA+++  +L+ +    I   +   + N+ A 
Sbjct  671  SLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  730

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
            R  + +   +  ++    S+        +K+  
Sbjct  731  RPAKYK---DANIMSPGSSL---PSLHVRKQKA  757


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 50/282 (18%), Positives = 90/282 (32%), Gaps = 29/282 (10%)

Query  149  SGTSEQTKAVVDGGAIPAFISLLA-----------SPHAHISEQAVWALGNIA-GDGSVF  196
            S   E   A+ + G + A   LL                 +   A  AL N+  GD +  
Sbjct  455  SFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANK  514

Query  197  RDLVIKYGAVDPLLALLAVP--DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              L    G +  L+A L     D+  +    LRNL+W      R    +         + 
Sbjct  515  ATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSW------RADVNSKKTLREVGSVK  568

Query  255  TLVRL-LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGASELPIVTP  312
             L+   L       L     A+  L+    E    +    G +  LV  L          
Sbjct  569  ALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLA  628

Query  313  A-------LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
                    LR + +++   ++  Q++ +   L      L +    I   A  T+ N++A 
Sbjct  629  IIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSAR  688

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG  407
                 + + + G V  L +++          +  A+ N  + 
Sbjct  689  NPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  730


 Score = 67.3 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/309 (16%), Positives = 98/309 (32%), Gaps = 49/309 (16%)

Query  50   RRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQ  109
            RR       + T     N+    ++   +  +V  + S + + Q       R L  R   
Sbjct  496  RRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADV  555

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT--KAVVDGGAIPAF  167
                 +   G +   +                 AL N+++  +E       VD GA+   
Sbjct  556  NSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVD-GALAFL  614

Query  168  ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
            +                  G +          +I+ G                   G LR
Sbjct  615  V------------------GTLTYRSQTNTLAIIESGG------------------GILR  638

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG  287
            N++   S +  N++    I      L TL++ L      ++++ C  +  L+    +   
Sbjct  639  NVS---SLIATNED-HRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQE  694

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP  347
             +   G V  L  L+ +    I   +  A+ N++     + +   DA  ++   SL   P
Sbjct  695  ALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYK---DANIMSPGSSL---P  748

Query  348  KTNIQKEAT  356
              +++K+  
Sbjct  749  SLHVRKQKA  757


 Score = 62.7 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 70/532 (13%), Positives = 165/532 (31%), Gaps = 90/532 (17%)

Query  22   KDSTEMRRRRIEVNVELRKAKKDDQMLKRRNV----SSFPDDATSPLQENRNNQGTVNWS  77
            +D  +  +RRI    ++ K      +L+ R +    ++  + ++    +  +++      
Sbjct  206  QDMEKRAQRRIARIQQIEKD-----ILRVRQLLQSQAAEAERSSQSRHDAASHEAGRQHE  260

Query  78   VDDIVKGINSSNVENQLQATQAARKLLSR-----EKQPPIDNIIRAG----LIPKFVSFL  128
               + +   +++   Q  AT+   +  S          P       G    ++   +S L
Sbjct  261  GHGVAESNTAASSSGQSPATRVDHETASVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSML  320

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH-----------  177
            G  D   +       L  ++S + +   ++   G +P  I LL                 
Sbjct  321  GTHDKDDMSRT----LLAMSS-SQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSK  375

Query  178  -ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-----------------AVPDMS  219
                +A  AL NI       +    +   +  LL  +                    D +
Sbjct  376  EARARASAALHNIIHSQPDDKRGRREIRVL-HLLEQIRAYCETCWEWQEAHEQGMDQDKN  434

Query  220  SLACGY---LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH-----------HDDP  265
             +       +      L  L  ++     ++ +   L  +  LL            H   
Sbjct  435  PMPAPVEHQICPAVCVLMKLSFDEEHRHAMNEL-GGLQAIAELLQVDCEMYGLTNDHYSV  493

Query  266  EVLADTCWAISYLTDGPNERIGMVVKTGVV-PQLVKLLGASELPIVTPALRAIGNIVTGT  324
             +      A++ LT G       +         LV  L +    +       + N+    
Sbjct  494  TLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRA  553

Query  325  DEQTQVVI-DAGALAVFPSL-LTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPF  381
            D  ++  + + G++       L   K +  K     + N++A   +    +    G + F
Sbjct  554  DVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAF  613

Query  382  LVSVLSKADFKTQKEAVWAV-------TNYTS--GGTVEQIVYLVHCGIIEPLMNLLTAK  432
            LV  L+   +++Q   +  +        N +S      +    L     ++ L+  L + 
Sbjct  614  LVGTLT---YRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH  670

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
               I+      + N+     K  E       + + G +  ++ L + +++ +
Sbjct  671  SLTIVSNACGTLWNLSARNPKDQE------ALWDMGAVSMLKNLIHSKHKMI  716


> sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis 
thaliana OX=3702 GN=TIO PE=1 SV=1
Length=1322

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 104/276 (38%), Gaps = 19/276 (7%)

Query  159   VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM  218
             V+ G    FI  + SP   +  +    L  I  D   +  ++++ G    +L  L   ++
Sbjct  984   VNSG----FILNIGSPGVRVCMEDRDLLKAIEEDMDKYIIVLLEVGVPSLILRCLDHLEL  1039

Query  219   SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL---PTLVRLL-HHDDPEVLADTCWA  274
                    +R + +    + R   P   +D V + L     + +LL      EV+ D    
Sbjct  1040  KD----LVRPVAFLAKMVGR---PRLAVDLVSKGLLDPNRMKKLLNQSSPREVILDILMI  1092

Query  275   ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
             IS L+         + +  V+  L + L   +  I   A  A+GN+          + + 
Sbjct  1093  ISDLSRMDKAFYKYIGEASVLQPLKEYLTHVDPNIRAKACSALGNMCRHNGYFYSALAEH  1152

Query  335   GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFK-T  393
               + +      +P    QK A + + N         +++     +  L +VL+ A+   T
Sbjct  1153  QIIGLLIDRCADPDKRTQKFACFAIGNAAYHNDTLYEELRRS--ITQLANVLTTAEEDKT  1210

Query  394   QKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
             +  A  A++N     + +    +V  G ++ L+ L+
Sbjct  1211  KANAAGALSNLVRN-SNKLCEDIVSKGALQTLLRLV  1245


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/234 (21%), Positives = 95/234 (41%), Gaps = 11/234 (5%)

Query  246   IDAVEQILPTLV-RLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVP-QLVKLL-  302
             I  +E  +P+L+ R L H + + L      ++ +   P   + +V K  + P ++ KLL 
Sbjct  1019  IVLLEVGVPSLILRCLDHLELKDLVRPVAFLAKMVGRPRLAVDLVSKGLLDPNRMKKLLN  1078

Query  303   GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI  362
              +S   ++   L  I ++        + + +A  L      LT+   NI+ +A   + N+
Sbjct  1079  QSSPREVILDILMIISDLSRMDKAFYKYIGEASVLQPLKEYLTHVDPNIRAKACSALGNM  1138

Query  363   TAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGII  422
                       +  H ++  L+   +  D +TQK A +A+ N       + +   +   I 
Sbjct  1139  CRHNGYFYSALAEHQIIGLLIDRCADPDKRTQKFACFAIGNAAYH--NDTLYEELRRSIT  1196

Query  423   EPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
             +    L TA++ K       A+SN+ +       + KL   I   G L  +  L
Sbjct  1197  QLANVLTTAEEDKTKANAAGALSNLVR------NSNKLCEDIVSKGALQTLLRL  1244


 Score = 64.6 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 51/332 (15%), Positives = 121/332 (36%), Gaps = 30/332 (9%)

Query  52    NVSSFPDDATSPLQENRNNQGTVNWSVDD---IVKGINSSNVENQLQATQAARKLLSREK  108
              V     D    ++E+ +    V   V     I++ ++   +++ ++      K++ R +
Sbjct  998   RVCMEDRDLLKAIEEDMDKYIIVLLEVGVPSLILRCLDHLELKDLVRPVAFLAKMVGRPR  1057

Query  109   QPPIDNIIRAGLIP-KFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAF  167
                +D + +  L P +    L ++    +  +    +++++       K + +   +   
Sbjct  1058  L-AVDLVSKGLLDPNRMKKLLNQSSPREVILDILMIISDLSRMDKAFYKYIGEASVLQPL  1116

Query  168   ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDM--SSLACGY  225
                L     +I  +A  ALGN+      F   + ++  +  L+   A PD      AC  
Sbjct  1117  KEYLTHVDPNIRAKACSALGNMCRHNGYFYSALAEHQIIGLLIDRCADPDKRTQKFACFA  1176

Query  226   LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPE-VLADTCWAISYLTDGPNE  284
             + N  +    L          + + + +  L  +L   + +   A+   A+S L    N+
Sbjct  1177  IGNAAYHNDTL---------YEELRRSITQLANVLTTAEEDKTKANAAGALSNLVRNSNK  1227

Query  285   RIGMVVKTGVVPQLVKLLGASELPIVTP-------------ALRAIGNIVTGTDEQTQVV  331
                 +V  G +  L++L+       + P             AL ++  + +      Q V
Sbjct  1228  LCEDIVSKGALQTLLRLVADCSTLALNPSKKETASESPLKIALFSLAKMCSNHQICRQFV  1287

Query  332   IDAGALAVFPSLLTNPKTNIQKEATWTMSNIT  363
               +    V   L  +P+ NI   A+  ++ ++
Sbjct  1288  KSSELFPVIARLKQSPEANIAHYASVIVAKVS  1319


 Score = 35.0 bits (79),  Expect = 2.4, Method: Composition-based stats.
 Identities = 20/113 (18%), Positives = 39/113 (35%), Gaps = 17/113 (15%)

Query  95    QATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFE--------------S  140
              A  A   L+ R      ++I+  G +   +  +   DCS +                 +
Sbjct  1213  NAAGALSNLV-RNSNKLCEDIVSKGALQTLLRLVA--DCSTLALNPSKKETASESPLKIA  1269

Query  141   AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDG  193
              ++L  + S      + V      P    L  SP A+I+  A   +  ++G+ 
Sbjct  1270  LFSLAKMCSNHQICRQFVKSSELFPVIARLKQSPEANIAHYASVIVAKVSGES  1322


> sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus 
tropicalis OX=8364 GN=trip12 PE=2 SV=1
Length=2056

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 90/228 (39%), Gaps = 15/228 (7%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
              +++G+ +++   QLQA     +LL    +  +       ++P  ++ L       I  
Sbjct  482  QQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMN  541

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSVFR  197
             +  ALT +       +  VVD  AIP F+  L       ++EQA+ AL  ++   S   
Sbjct  542  HACRALTYMMEALPRSSAVVVD--AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS---  596

Query  198  DLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLV  257
              +++ G +   L  L        +    RN     +N C++ +P      V   LP L 
Sbjct  597  KAILQAGGLADCLLYLEF-----FSINAQRNALAIAANCCQSISP-DEFHFVADSLPLLT  650

Query  258  RLLHHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLL  302
            + L H D + +  TC   + L D        +  V    ++  + +LL
Sbjct  651  QRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLL  698


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 75/223 (34%), Gaps = 11/223 (5%)

Query  256  LVRLLHHDDPEVLADTCWAISYLTD-GPNERIGMVVKTGVVPQLVKLLGASEL-PIVTPA  313
            L++ L   D          +  L   G  E +G      VVP L+ LL       I+  A
Sbjct  484  LLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHA  543

Query  314  LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV  373
             RA+  ++      + VV+DA        L      ++ ++A   +  +    +   + +
Sbjct  544  CRALTYMMEALPRSSAVVVDA-IPVFLEKLQVIQCIDVAEQALTALEML---SRRHSKAI  599

Query  374  VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            +  G +   +  L       Q+ A+    N     + ++  ++     +  L   LT +D
Sbjct  600  LQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADS--LPLLTQRLTHQD  657

Query  434  TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL  476
             K +           +  +     E L   +     L  I+ L
Sbjct  658  KKSVESTCLCF---ARLVDNFQHEENLLQQVASRDLLTNIQQL  697


> sp|O80742|PUB19_ARATH U-box domain-containing protein 19 OS=Arabidopsis 
thaliana OX=3702 GN=PUB19 PE=2 SV=1
Length=686

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 59/297 (20%), Positives = 116/297 (39%), Gaps = 27/297 (9%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA  118
            D    L      + T  +   +++KG    + E  ++A    R +L++        ++ A
Sbjct  361  DVAESLAAEEAGKLTAEFLAGELIKG----DEEEMVKALVEIR-ILTKTSTFYRSCLVEA  415

Query  119  GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAV-VDGGAIPAFISLLAS-PHA  176
            G++   +  L R+D   IQ  +   + N++   + +T+ V  DGG +   + +L      
Sbjct  416  GVVESLMKIL-RSDDPRIQENAMAGIMNLSKDIAGKTRIVGEDGGGLRLIVEVLNDGARR  474

Query  177  HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNL  236
               + A  AL  ++  G   R +     A+  L+ ++   D         RN    + +L
Sbjct  475  ESRQYAAAALFYLSSLGDYSRLIGEISDAIPGLVRIVKSCD---YGDSAKRNALIAIRSL  531

Query  237  CRNKNPAPPIDAVEQILPTLVRLLHHDDP--EVLADTCWAISYLTDGPNERIGMVVKTGV  294
              N+           I+P L+ L+  ++    V AD+   ++ + + P+  I  V++ G 
Sbjct  532  LMNQPDNHWRILAAGIVPVLLDLVKSEEISDGVTADSMAILAKMAEYPDGMIS-VLRRGG  590

Query  295  VPQLVKLLGASE--LPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKT  349
            +   VK+LG+SE         +  + N+              G   V  SL  NP  
Sbjct  591  LKLAVKILGSSEVSPATKQHCVALLLNLCHN-----------GGSDVVGSLAKNPSI  636


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 81/218 (37%), Gaps = 12/218 (6%)

Query  155  TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVI-KYGAVDPLLALL  213
               +V+ G + + + +L S    I E A+  + N++ D +    +V    G +  ++ +L
Sbjct  409  RSCLVEAGVVESLMKILRSDDPRIQENAMAGIMNLSKDIAGKTRIVGEDGGGLRLIVEVL  468

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDD--PEVLADT  271
                               L  L    + +  I  +   +P LVR++   D       + 
Sbjct  469  NDGARRESRQY----AAAALFYLSSLGDYSRLIGEISDAIPGLVRIVKSCDYGDSAKRNA  524

Query  272  CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP--IVTPALRAIGNIVTGTDEQTQ  329
              AI  L     +    ++  G+VP L+ L+ + E+   +   ++  +  +    D    
Sbjct  525  LIAIRSLLMNQPDNHWRILAAGIVPVLLDLVKSEEISDGVTADSMAILAKMAEYPDGMI-  583

Query  330  VVIDAGALAVFPSLLTNPKTN--IQKEATWTMSNITAG  365
             V+  G L +   +L + + +   ++     + N+   
Sbjct  584  SVLRRGGLKLAVKILGSSEVSPATKQHCVALLLNLCHN  621


 Score = 70.0 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/232 (20%), Positives = 92/232 (40%), Gaps = 11/232 (5%)

Query  254  PTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPA  313
              L   L   D E +      I  LT         +V+ GVV  L+K+L + +  I   A
Sbjct  377  EFLAGELIKGDEEEMVKALVEIRILTKTSTFYRSCLVEAGVVESLMKILRSDDPRIQENA  436

Query  314  LRAIGNIVTGTDEQTQVV-IDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGRQDQIQ  371
            +  I N+      +T++V  D G L +   +L +  +   ++ A   +  +++       
Sbjct  437  MAGIMNLSKDIAGKTRIVGEDGGGLRLIVEVLNDGARRESRQYAAAALFYLSSLGDYSRL  496

Query  372  QVVNHGLVPFLVSVLSKADF--KTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL  429
                   +P LV ++   D+    ++ A+ A+ +       +    ++  GI+  L++L+
Sbjct  497  IGEISDAIPGLVRIVKSCDYGDSAKRNALIAIRSLLMNQ-PDNHWRILAAGIVPVLLDLV  555

Query  430  TAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD-KIEALQNHE  480
             +   + I   + A S       K+ E     I +   GGL   ++ L + E
Sbjct  556  KS---EEISDGVTADS--MAILAKMAEYPDGMISVLRRGGLKLAVKILGSSE  602


 Score = 65.8 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 83/229 (36%), Gaps = 6/229 (3%)

Query  229  LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM  288
                +  L +             ++ +L+++L  DDP +  +    I  L+     +  +
Sbjct  394  ALVEIRILTKTSTFYRSCLVEAGVVESLMKILRSDDPRIQENAMAGIMNLSKDIAGKTRI  453

Query  289  VVK-TGVVPQLVKLLG-ASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTN  346
            V +  G +  +V++L   +       A  A+  + +  D    +   + A+     ++ +
Sbjct  454  VGEDGGGLRLIVEVLNDGARRESRQYAAAALFYLSSLGDYSRLIGEISDAIPGLVRIVKS  513

Query  347  PK--TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNY  404
                 + ++ A   + ++   + D   +++  G+VP L+ ++   +      A       
Sbjct  514  CDYGDSAKRNALIAIRSLLMNQPDNHWRILAAGIVPVLLDLVKSEEISDGVTADSMAILA  573

Query  405  TSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK--IILVILDAISNIFQAA  451
                  + ++ ++  G ++  + +L + +         +  + N+    
Sbjct  574  KMAEYPDGMISVLRRGGLKLAVKILGSSEVSPATKQHCVALLLNLCHNG  622


> sp|P25054|APC_HUMAN Adenomatous polyposis coli protein OS=Homo 
sapiens OX=9606 GN=APC PE=1 SV=2
Length=2843

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 100/274 (36%), Gaps = 18/274 (7%)

Query  134  SPIQFESAWALTNIASGTSEQTKAVVD-GGAIPAFISLLASPHAHISEQAVWALGNIA-G  191
              ++  +  ALTN+  G       +    G + A ++ L S    + +     L N++  
Sbjct  495  ITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWR  554

Query  192  DGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQ  251
                 +  + + G+V  L+         S     L +  W LS  C        I AV+ 
Sbjct  555  ADVNSKKTLREVGSVKALMECALEVKKESTLKSVL-SALWNLSAHCTENK--ADICAVDG  611

Query  252  ILPTLVRLL----HHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVPQLVKLLGA  304
             L  LV  L      +   ++      +  ++       +   ++ +   +  L++ L +
Sbjct  612  ALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKS  671

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
              L IV+ A   + N+     +  + + D GA+++  +L+ +    I   +   + N+ A
Sbjct  672  HSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMA  731

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAV  398
             R  + +   +  ++    S+        +K+  
Sbjct  732  NRPAKYK---DANIMSPGSSL---PSLHVRKQKA  759


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 50/282 (18%), Positives = 90/282 (32%), Gaps = 29/282 (10%)

Query  149  SGTSEQTKAVVDGGAIPAFISLLA-----------SPHAHISEQAVWALGNIA-GDGSVF  196
            S   E   A+ + G + A   LL                 +   A  AL N+  GD +  
Sbjct  457  SFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANK  516

Query  197  RDLVIKYGAVDPLLALLAVP--DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              L    G +  L+A L     D+  +    LRNL+W      R    +         + 
Sbjct  517  ATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSW------RADVNSKKTLREVGSVK  570

Query  255  TLVRL-LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGASELPIVTP  312
             L+   L       L     A+  L+    E    +    G +  LV  L          
Sbjct  571  ALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLA  630

Query  313  A-------LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
                    LR + +++   ++  Q++ +   L      L +    I   A  T+ N++A 
Sbjct  631  IIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSAR  690

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG  407
                 + + + G V  L +++          +  A+ N  + 
Sbjct  691  NPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  732


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 48/309 (16%), Positives = 98/309 (32%), Gaps = 49/309 (16%)

Query  50   RRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQ  109
            RR       + T     N+    ++   +  +V  + S + + Q       R L  R   
Sbjct  498  RRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADV  557

Query  110  PPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQT--KAVVDGGAIPAF  167
                 +   G +   +                 AL N+++  +E       VD GA+   
Sbjct  558  NSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVD-GALAFL  616

Query  168  ISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLR  227
            +                  G +          +I+ G                   G LR
Sbjct  617  V------------------GTLTYRSQTNTLAIIESGG------------------GILR  640

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG  287
            N++   S +  N++    I      L TL++ L      ++++ C  +  L+    +   
Sbjct  641  NVS---SLIATNED-HRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQE  696

Query  288  MVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNP  347
             +   G V  L  L+ +    I   +  A+ N++     + +   DA  ++   SL   P
Sbjct  697  ALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYK---DANIMSPGSSL---P  750

Query  348  KTNIQKEAT  356
              +++K+  
Sbjct  751  SLHVRKQKA  759


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 71/531 (13%), Positives = 160/531 (30%), Gaps = 88/531 (17%)

Query  22   KDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDI  81
            +D  +  +RRI    ++ K      +L+ R +            +N++  G+ +    + 
Sbjct  208  QDMEKRAQRRIARIQQIEKD-----ILRIRQLLQSQATEAERSSQNKHETGSHDAERQNE  262

Query  82   VKGINSSNVENQLQATQAARKL---------LSREKQPPIDNIIRAG----LIPKFVSFL  128
             +G+   N+        +  ++          S     P       G    ++   +S L
Sbjct  263  GQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSML  322

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH-----------  177
            G  D   +       L  ++S + +   ++   G +P  I LL                 
Sbjct  323  GTHDKDDMSRT----LLAMSS-SQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSK  377

Query  178  -ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL------------LAVPDMSSLACG  224
                +A  AL NI       +    +   +  L  +               P M      
Sbjct  378  EARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNP  437

Query  225  Y-------LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH-----------HDDPE  266
                    +      L  L  ++     ++ +   L  +  LL            H    
Sbjct  438  MPAPVEHQICPAVCVLMKLSFDEEHRHAMNEL-GGLQAIAELLQVDCEMYGLTNDHYSIT  496

Query  267  VLADTCWAISYLTDGPNERIGMVVKTGVV-PQLVKLLGASELPIVTPALRAIGNIVTGTD  325
            +      A++ LT G       +         LV  L +    +       + N+    D
Sbjct  497  LRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRAD  556

Query  326  EQTQVVI-DAGALAVFPSL-LTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLVPFL  382
              ++  + + G++       L   K +  K     + N++A   +    +    G + FL
Sbjct  557  VNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFL  616

Query  383  VSVLSKADFKTQKEAVWAV-------TNYTS--GGTVEQIVYLVHCGIIEPLMNLLTAKD  433
            V  L+   +++Q   +  +        N +S      +    L     ++ L+  L +  
Sbjct  617  VGTLT---YRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHS  673

Query  434  TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
              I+      + N+     K  E       + + G +  ++ L + +++ +
Sbjct  674  LTIVSNACGTLWNLSARNPKDQE------ALWDMGAVSMLKNLIHSKHKMI  718


> sp|Q9D3W1|RSP14_MOUSE Radial spoke head 14 homolog OS=Mus musculus 
OX=10090 GN=Rsph14 PE=2 SV=1
Length=341

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 73/337 (22%), Positives = 130/337 (39%), Gaps = 26/337 (8%)

Query  155  TKAVVDGG--AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLAL  212
            TKA +  G  A+      L S      ++A+ AL ++  D   +    I  G ++ L  L
Sbjct  17   TKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHD-PEYVYEAINIGCLESLKTL  75

Query  213  LAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC  272
            L   D            T  L  +  +          + I+  L  LL         +  
Sbjct  76   LQDDDNLVRIKT-----TEVLYIMATHYVGRVGFLKHD-IIQALSLLLSDHQTLCRENLH  129

Query  273  WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVI  332
             A  +L   P +    +V++G++P LV+ L   E  I    L  +        E     +
Sbjct  130  QAYKHLAQLP-KGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTL---ALCLQEDATEAL  185

Query  333  DAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFK  392
            ++ A+      L +  + I+ +A   +  I+    D   QV  + ++P LV++LS  D +
Sbjct  186  ESQAVPCLKEKLLSQNSEIRSKAARALIAISI-PLDGKNQVWKNKVIPILVTLLSDTDEE  244

Query  393  TQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLL-TAKDTKIILVILDAISNIFQAA  451
             +  A  A+ + T   T E     +    IEPL+ LL T   TK+ L    A++      
Sbjct  245  VKANAAGALMHATV--TTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALT------  296

Query  452  EKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS  488
              L E  +   ++     +     L  H+NE++ +A+
Sbjct  297  -MLAEAPEGRKLLLSH--VPIFRYLLAHKNEAIQRAA  330


 Score = 70.4 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 76/208 (37%), Gaps = 14/208 (7%)

Query  156  KAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV  215
            + +V  G IP+ +  L     HI E  +  L     + +      ++  AV  L   L  
Sbjct  143  QGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDAT---EALESQAVPCLKEKLLS  199

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
             +    +          +S     KN         +++P LV LL   D EV A+   A+
Sbjct  200  QNSEIRSKAA--RALIAISIPLDGKN----QVWKNKVIPILVTLLSDTDEEVKANAAGAL  253

Query  276  SYLTDGPNERIGMVVKTGVVPQLVKLLGA-SELPIVTPALRAIGNIVTGTDEQTQVVIDA  334
             + T    E     +    +  L++LL    +  +   A +A+  +    + +  ++   
Sbjct  254  MHATV-TTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLLLSH-  311

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNI  362
              + +F  LL +    IQ+ A   +  I
Sbjct  312  --VPIFRYLLAHKNEAIQRAAEVAIKVI  337


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 58/255 (23%), Positives = 100/255 (39%), Gaps = 23/255 (9%)

Query  72   GTVNWSVDDIVKGIN---SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL  128
            G V +   DI++ ++   S +     +    A K L++        I+++GLIP  V  L
Sbjct  100  GRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLP-KGAQGIVQSGLIPSLVRKL  158

Query  129  GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN  188
             + +    +      L  +A    E     ++  A+P     L S ++ I  +A  AL  
Sbjct  159  QKEEDHIQEI----ILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARAL--  212

Query  189  IAGDGS-VFRDLVIKYGAVDPLLALLAVPD--MSSLACGYLRNLTWTLSNLCRNKNPAPP  245
            IA       ++ V K   +  L+ LL+  D  + + A G L + T T       K  A  
Sbjct  213  IAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTT----EGKYAALD  268

Query  246  IDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS  305
             +A+E +L  L     +   ++  +   A++ L + P  R  ++     VP    LL   
Sbjct  269  ANAIEPLLELLS---TNPKTKLCLNATKALTMLAEAPEGRKLLLSH---VPIFRYLLAHK  322

Query  306  ELPIVTPALRAIGNI  320
               I   A  AI  I
Sbjct  323  NEAIQRAAEVAIKVI  337


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/195 (19%), Positives = 82/195 (42%), Gaps = 11/195 (6%)

Query  38   LRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQAT  97
            +RK +K++      ++     D  +   +    +   + +V  + + + S N E + +A 
Sbjct  155  VRKLQKEED-----HIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAA  209

Query  98   QAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKA  157
            +A   +         + + +  +IP  V+ L  TD   ++  +A AL + A+ T+E   A
Sbjct  210  RAL--IAISIPLDGKNQVWKNKVIPILVTLLSDTD-EEVKANAAGALMH-ATVTTEGKYA  265

Query  158  VVDGGAIPAFISLLAS-PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVP  216
             +D  AI   + LL++ P   +   A  AL  +A +    R L++ +  +   L      
Sbjct  266  ALDANAIEPLLELLSTNPKTKLCLNATKALTMLA-EAPEGRKLLLSHVPIFRYLLAHKNE  324

Query  217  DMSSLACGYLRNLTW  231
             +   A   ++ + W
Sbjct  325  AIQRAAEVAIKVIEW  339


> sp|P52306|GDS1_HUMAN Rap1 GTPase-GDP dissociation stimulator 
1 OS=Homo sapiens OX=9606 GN=RAP1GDS1 PE=1 SV=3
Length=607

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 66/374 (18%), Positives = 132/374 (35%), Gaps = 33/374 (9%)

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ-  154
                  + L++      + I  +G++  F S L        +      + NI +  ++  
Sbjct  26   CLDCLLQALAQNNTETSEKIQASGILQLFASLLTPQSSCKAK------VANIIAEVAKNE  79

Query  155  --TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA----VDP  208
                  VD G I   + LL S    +  Q   ALGNI  D    R  V + G     +D 
Sbjct  80   FMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH  139

Query  209  LLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPE-V  267
            L +L ++ D ++     +      L N     +          ++PTLV+LL        
Sbjct  140  LRSLCSITDPANEKLLTVFCGM--LMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAA  197

Query  268  LADTCW-AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDE  326
            L + C  A   L +           T +  +LVKL            +  +   +   D 
Sbjct  198  LTEMCLVAFGNLAEL-ESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDA  256

Query  327  QTQVVIDAGALAVFPSLLTNPKTNIQK------EATWTMSNITAGRQDQIQQVVNHG---  377
                +++AG +     ++     + ++      +    +  +     + +Q++   G   
Sbjct  257  IKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGS  316

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT----AKD  433
            +   ++S +   + + Q     A+ N+         +++V  GI+E LM+LL       +
Sbjct  317  VFQRVLSWIPSNNHQLQLAGALAIANFARNDA--NCIHMVDNGIVEKLMDLLDRHVEDGN  374

Query  434  TKIILVILDAISNI  447
              +    L A+ N+
Sbjct  375  VTVQHAALSALRNL  388


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 67/417 (16%), Positives = 132/417 (32%), Gaps = 63/417 (15%)

Query  78   VDDIVKGINSSNVENQLQATQAARKLL--SREKQPPIDNIIRAGLIPKFVSFL---GRTD  132
            +  +V+ +NS + E  LQ  +A   +   S E +  +D    A ++   +  L       
Sbjct  91   ISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHLRSLCSITDPA  150

Query  133  CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL--ASPHAHISEQAVWALGNIA  190
               +       L N ++        +++ G IP  + LL     +A ++E  + A GN+A
Sbjct  151  NEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLA  210

Query  191  GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLC-------------  237
               S            + L+ L                L     N               
Sbjct  211  ELESSKEQFA-STNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVEC  269

Query  238  --------RNKNPAPPIDAVEQILPTLVRLLH-------------------------HDD  264
                     + +    I  ++     +V LL                           ++
Sbjct  270  LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNN  329

Query  265  PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL----GASELPIVTPALRAIGNI  320
             ++      AI+         I MV   G+V +L+ LL        + +   AL A+ N+
Sbjct  330  HQLQLAGALAIANFARNDANCIHMV-DNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNL  388

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNHGLV  379
                      ++ AG        L +    +Q +   T+  +   + +  +Q+  N  LV
Sbjct  389  AI-PVINKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNVKLV  447

Query  380  PFLVSVLSKADF-KTQKEAVWAVTNYTSGG-TVEQIVYLVHCGIIEPLMNLLTAKDT  434
              LV      D      E+   ++       + + I  +V  G I+ L+ + T++  
Sbjct  448  ERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHV  504


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/203 (18%), Positives = 67/203 (33%), Gaps = 45/203 (22%)

Query  131  TDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL----ASPHAHISEQAVWAL  186
            ++   +Q   A A+ N A         +VD G +   + LL       +  +   A+ AL
Sbjct  327  SNNHQLQLAGALAIANFAR-NDANCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSAL  385

Query  187  GNIAGDGSVFRDLVIKYGAVDPLLALLAV--PDMSSLACGYLRNLTWT------------  232
             N+A    + +  ++  G  + +L  L    P +     G LR L               
Sbjct  386  RNLAI-PVINKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNV  444

Query  233  -----LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIG  287
                 L   C  K+ A  +    ++L  L+R     D                     I 
Sbjct  445  KLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDV--------------------IK  484

Query  288  MVVKTGVVPQLVKLLGASELPIV  310
             +V++G +  LV +  +  + + 
Sbjct  485  TIVQSGGIKHLVTMATSEHVIMQ  507


 Score = 41.9 bits (97),  Expect = 0.014, Method: Composition-based stats.
 Identities = 23/128 (18%), Positives = 54/128 (42%), Gaps = 17/128 (13%)

Query  357  WTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYL  416
              +  +     +  +++   G++    S+L+      Q      V N  +     + + +
Sbjct  29   CLLQALAQNNTETSEKIQASGILQLFASLLTP-----QSSCKAKVANIIAEVAKNEFMRI  83

Query  417  --VHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG----L  470
              V  G+I PL+ LL +KD +++L    A+ NI        ++ +    +++ GG    +
Sbjct  84   PCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICY------DSHEGRSAVDQAGGAQIVI  137

Query  471  DKIEALQN  478
            D + +L +
Sbjct  138  DHLRSLCS  145


> sp|Q5PPZ9|GDS1B_XENLA Rap1 GTPase-GDP dissociation stimulator 
1-B OS=Xenopus laevis OX=8355 GN=rap1gds1-b PE=2 SV=1
Length=607

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 64/383 (17%), Positives = 127/383 (33%), Gaps = 33/383 (9%)

Query  96   ATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQ-  154
                  + L        + I ++G++  F S L        Q   A  + +I +  ++  
Sbjct  26   CLDCLLQALGHNNTESSEKIQQSGILQLFASILNS------QSSCASKVAHIVAEIAKNE  79

Query  155  --TKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGA----VDP  208
                  V+   IP  + LL S    +  Q   ALGNI  D    R  V + G     VD 
Sbjct  80   LMRIPCVEADLIPPLVQLLHSKDQEVLLQTGRALGNICYDNHEGRRTVDQEGGAQIVVDH  139

Query  209  LLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLL--HHDDPE  266
            L +   + D SS     +      L N     +          ++P LV LL  H  +  
Sbjct  140  LRSRCTLTDPSSEKLMTVFCGM--LMNYSSENDSLQTQLIQMGVIPILVDLLAVHSQNTA  197

Query  267  VLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDE  326
            +      A   L +           T V   +VKL            +  +   +   D 
Sbjct  198  LTEMCLVAFGNLAEL-ESSKEQFAATNVAEVIVKLFKKQTEHEKREVIFEVLAPLAENDA  256

Query  327  QTQVVIDAGALAVFPSLLTNPKTNIQK------EATWTMSNITAGRQDQIQQVVNHG---  377
                +++AG +     ++     + +       + +  +  +     + +Q++   G   
Sbjct  257  IKMQLVEAGLVECLLDIVQQTVNSEKDDDVAELKTSSDLMVLLLLGDESMQKLFEGGKGS  316

Query  378  LVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT----AKD  433
            +   ++S L   + + Q     A+ N+         +++V   I++ L++LL       +
Sbjct  317  VFQRVLSWLPSNNHQLQLAGALAIANFARNDG--NCIHMVDSEIVQKLLDLLDRHVEDGN  374

Query  434  TKIILVILDAISNIFQAAEKLGE  456
              +    L A+ N+        +
Sbjct  375  VTVQHAALSALRNLAIPVVNKAK  397


 Score = 80.4 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 74/427 (17%), Positives = 153/427 (36%), Gaps = 38/427 (9%)

Query  91   ENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG  150
            E  L A     +L S ++Q    N+    +I K        +   + FE    L    + 
Sbjct  200  EMCLVAFGNLAELESSKEQFAATNVAE--VIVKLFKKQTEHEKREVIFEVLAPL----AE  253

Query  151  TSEQTKAVVDGGAIPAFISLL-----ASPHAHISEQAVWA---LGNIAGDGSVFRDLVIK  202
                   +V+ G +   + ++     +     ++E    +   +  + GD S+ +     
Sbjct  254  NDAIKMQLVEAGLVECLLDIVQQTVNSEKDDDVAELKTSSDLMVLLLLGDESMQKLFEGG  313

Query  203  YGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPI---DAVEQILPTLVRL  259
             G+V   +      +   L           ++N  RN      +   + V+++L  L R 
Sbjct  314  KGSVFQRVLSWLPSNNHQLQLAG----ALAIANFARNDGNCIHMVDSEIVQKLLDLLDRH  369

Query  260  LHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN  319
            +   +  V      A+  L   P      ++  GV  +++K L +   P+    L  +  
Sbjct  370  VEDGNVTVQHAALSALRNLAI-PVVNKAKMLSAGVTEEVLKFLPSEMPPVQFKLLGTLRM  428

Query  320  IVTGTDEQTQVVIDAGALAVFPSLL-----TNPKTNIQKEATWTMSNITAGRQ--DQIQQ  372
            ++   D Q +     G        L           +  E+   +S +    +  D I+ 
Sbjct  429  LI---DAQAEAAEQLGKNEKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIRT  485

Query  373  VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK  432
             V  G +  LV++ +      Q EA+ A+    +         L    ++E L  LL+ +
Sbjct  486  TVQSGGIKHLVTMATSEHVIMQNEALVALGLIAALELQAAERDLESAKLVEVLHRLLSDE  545

Query  433  DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI  492
                     +   N       +  +E L   +++   LD +  L++HEN++V + + SL 
Sbjct  546  -----RSAPEIKYNSMVLICAVMGSEPLHKEVQKLAFLDVVSKLRSHENKTVAQQA-SLT  599

Query  493  EKYFSVE  499
            E+ F+V+
Sbjct  600  EQKFTVQ  606


> sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis 
thaliana OX=3702 GN=PUB41 PE=2 SV=1
Length=559

 Score = 86.6 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 48/281 (17%), Positives = 106/281 (38%), Gaps = 16/281 (6%)

Query  79   DDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQF  138
            ++I   +  +++ +  Q     RK+ +R  +    ++    ++    S L  +  + +Q 
Sbjct  237  EEIFNKLRGTDIFDHEQGLILLRKM-TRSSEDLRVSLCTDRILSFLRSLLV-SRYNLVQT  294

Query  139  ESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRD  198
             +A ++ N++    +    +V  G +P  I +L S      E    AL ++A +    + 
Sbjct  295  NAAASVVNLSLEK-QNKVKIVRSGFVPLLIDVLKSGTTEAQEHVAGALFSLALEDEN-KM  352

Query  199  LVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVR  258
            ++   GAV+PLL  L   +         ++    L +L    +    +      +PTL+ 
Sbjct  353  VIGVLGAVEPLLHALRSSESERAR----QDAALALYHLSLIPSNRTRLVR-AGAVPTLLS  407

Query  259  LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLL----GASELPIVTPAL  314
            ++   D    +     +  L   P+   G ++    V  LV  L    G          +
Sbjct  408  MVRSGDST--SRILLVLCNLAACPD-GKGAMLDGNAVAILVGKLREVGGGDSEAARENCV  464

Query  315  RAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
              +  +  G      +  +AGA  V   +  N    ++++A
Sbjct  465  AVLLTLCQGNLRFRGLASEAGAEEVLMEVEENGNERVKEKA  505


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/265 (15%), Positives = 103/265 (39%), Gaps = 18/265 (7%)

Query  233  LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT  292
            L  + R+          ++IL  L  LL      V  +   ++  L+     ++  +V++
Sbjct  258  LRKMTRSSEDLRVSLCTDRILSFLRSLLVSRYNLVQTNAAASVVNLSLEKQNKVK-IVRS  316

Query  293  GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS-LLTNPKTNI  351
            G VP L+ +L +           A+ ++    DE   V+   GA+      L ++     
Sbjct  317  GFVPLLIDVLKSGTTEAQEHVAGALFSLAL-EDENKMVIGVLGAVEPLLHALRSSESERA  375

Query  352  QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVE  411
            +++A   + +++    ++ + +V  G VP L+S++   D  ++   +  + N  +    +
Sbjct  376  RQDAALALYHLSLIPSNRTR-LVRAGAVPTLLSMVRSGDSTSRI--LLVLCNLAAC--PD  430

Query  412  QIVYLVHCGIIEPLMNLLT---AKDTKII-LVILDAISNIFQAAEKLGETEKLSIMIEEC  467
                ++    +  L+  L      D++      +  +  + Q         +   +  E 
Sbjct  431  GKGAMLDGNAVAILVGKLREVGGGDSEAARENCVAVLLTLCQG------NLRFRGLASEA  484

Query  468  GGLDKIEALQNHENESVYKASLSLI  492
            G  + +  ++ + NE V + +  ++
Sbjct  485  GAEEVLMEVEENGNERVKEKASKIL  509


> sp|Q28161|PKP1_BOVIN Plakophilin-1 OS=Bos taurus OX=9913 GN=PKP1 
PE=2 SV=1
Length=727

 Score = 86.2 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 69/392 (18%), Positives = 128/392 (33%), Gaps = 62/392 (16%)

Query  105  SREKQPPIDNIIRAGL--IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGG  162
            SR         I      IPK V +L   D    Q   A+ + +         + V   G
Sbjct  230  SRASSKICSEDIECSGLTIPKAVQYLSSQD-EKCQAIGAYYIQHTCFQDESAKQQVYQLG  288

Query  163  AIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA  222
             I   + LL SP+ ++ + A  AL N+    +  +    +   +   ++LL     + + 
Sbjct  289  GICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGSTEIQ  348

Query  223  CGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTL---------------VRLLHHD-DPE  266
               L  L W LS            + + + LP L                 L     DPE
Sbjct  349  -KQLTGLLWNLS-----STDELKEELIAEALPVLADRVIIPFSGWCDGNSNLSREPVDPE  402

Query  267  VLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA------SELPIVTPALRAIGNI  320
            V  +    +  L+     R  M   TG++  L+  +         +   V   +  + N+
Sbjct  403  VFFNATGCLRNLSSADVGRQTMRNYTGLIDSLMAYVQNCVAANRCDDKSVENCMCVLHNL  462

Query  321  VTGTDEQTQVVIDAGALAVFPSLLTN-PKTNIQKEATWTMSN----ITAGRQDQ------  369
                       +DA     +  L  N       K +T   SN    +T    D       
Sbjct  463  SYR--------LDAEVPTRYRQLEYNARNAYTDKSSTGCFSNKSDRMTNNNYDCPLPEEE  514

Query  370  -----IQQVVNHGLVPFLVSVLSKADFKTQKEAVW-AVTNYTS-----GGTVEQIVYLVH  418
                    + +   V   ++++ K+      EA   A+ N T+        + Q++ L  
Sbjct  515  PNPKGSSWLYHSDAVRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKE  574

Query  419  CGIIEPLMNLLTAKDTKIILVILDAISNIFQA  450
             G +  +  LL + ++ ++      +SN+ + 
Sbjct  575  KG-LPHIARLLQSGNSDVVRSGASLLSNMSRH  605


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 64/389 (16%), Positives = 129/389 (33%), Gaps = 60/389 (15%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKF  124
             E+   Q      +  +V  + S N   Q  A  A R L+ R     ++   + G I + 
Sbjct  277  DESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNG-IREA  335

Query  125  VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI---------------S  169
            VS L RT  + IQ +    L N++S T E  + ++   A+P                  +
Sbjct  336  VSLLRRTGSTEIQKQLTGLLWNLSS-TDELKEELI-AEALPVLADRVIIPFSGWCDGNSN  393

Query  170  LLASP-HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-AVPDMSSLACGYLR  227
            L   P    +   A   L N++      + +    G +D L+A +      +      + 
Sbjct  394  LSREPVDPEVFFNATGCLRNLSSADVGRQTMRNYTGLIDSLMAYVQNCVAANRCDDKSVE  453

Query  228  NLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD--TCWAISYLTDG----  281
            N    L NL            ++  +PT  R L ++      D  +    S  +D     
Sbjct  454  NCMCVLHNLSY---------RLDAEVPTRYRQLEYNARNAYTDKSSTGCFSNKSDRMTNN  504

Query  282  -----------PNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRAIGNIVTG----TD  325
                         +    +  +  V   + L+G + +   +     A+ N+       + 
Sbjct  505  NYDCPLPEEEPNPKGSSWLYHSDAVRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSS  564

Query  326  EQTQVV-IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS  384
              +Q++ +    L     LL +  +++ +     +SN++         V+   + P +  
Sbjct  565  GMSQLIGLKEKGLPHIARLLQSGNSDVVRSGASLLSNMSRHPALHR--VMGTQVFPEVTR  622

Query  385  VL------SKADFKTQKEAVWAVTNYTSG  407
            +L      +         A + V N  + 
Sbjct  623  LLTSHTGNTSNSEDILASACYTVRNLMAS  651


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 70/202 (35%), Gaps = 19/202 (9%)

Query  160  DGGAIPAFISLL-ASPHAHISEQAVWALGNIAGD----GSVFRDLV-IKYGAVDPLLALL  213
               A+  +++L+  S      E    AL N+        S    L+ +K   +  +  LL
Sbjct  525  HSDAVRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPHIARLL  584

Query  214  AVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDD------PEV  267
               +        +R+    LSN+ R+  PA       Q+ P + RLL           ++
Sbjct  585  QSGNSD-----VVRSGASLLSNMSRH--PALHRVMGTQVFPEVTRLLTSHTGNTSNSEDI  637

Query  268  LADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQ  327
            LA  C+ +  L             + +V  ++ L  +S  P    A R + + +  + E 
Sbjct  638  LASACYTVRNLMASLPGMAKQHFSSSMVNNIINLCRSSTSPKAAEAARLLLSDMWSSREL  697

Query  328  TQVVIDAGALAVFPSLLTNPKT  349
              ++   G        L    +
Sbjct  698  QGLLRQQGFDRSMLGTLAGANS  719


 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 48/301 (16%), Positives = 99/301 (33%), Gaps = 49/301 (16%)

Query  89   NVENQLQATQAARKLLSREKQPPIDNIIR-AGLIPKFVSF------LGRTDCSPIQFESA  141
            + E    AT   R L S +       +    GLI   +++        R D   ++    
Sbjct  400  DPEVFFNATGCLRNLSSADV--GRQTMRNYTGLIDSLMAYVQNCVAANRCDDKSVE-NCM  456

Query  142  WALTNIASGTSEQTKAVVDGGAIPAFISLL--ASPHAHISEQAVWALGN-----------  188
              L N++     +         +P     L   + +A+  + +     N           
Sbjct  457  CVLHNLSYRLDAE---------VPTRYRQLEYNARNAYTDKSSTGCFSNKSDRMTNNNYD  507

Query  189  --IAGDGSVFR--DLVIKYGAVDPLLALLAVPDMS---SLACGYLRNLTWTLSNLCRNKN  241
              +  +    +    +    AV   L L+             G L+NLT +   +     
Sbjct  508  CPLPEEEPNPKGSSWLYHSDAVRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSG--  565

Query  242  PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL  301
             +  I   E+ LP + RLL   + +V+      +S ++  P   +  V+ T V P++ +L
Sbjct  566  MSQLIGLKEKGLPHIARLLQSGNSDVVRSGASLLSNMSRHP--ALHRVMGTQVFPEVTRL  623

Query  302  L------GASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEA  355
            L       ++   I+  A   + N++       +    +  +    +L  +  +    EA
Sbjct  624  LTSHTGNTSNSEDILASACYTVRNLMASLPGMAKQHFSSSMVNNIINLCRSSTSPKAAEA  683

Query  356  T  356
             
Sbjct  684  A  684


 Score = 43.1 bits (100),  Expect = 0.007, Method: Composition-based stats.
 Identities = 29/199 (15%), Positives = 72/199 (36%), Gaps = 9/199 (5%)

Query  103  LLSREKQPPIDN-IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASG----TSEQTKA  157
            L   E  P   + +  +  +  +++ +G++         A AL N+ +     +S  ++ 
Sbjct  510  LPEEEPNPKGSSWLYHSDAVRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQL  569

Query  158  V-VDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-AV  215
            + +    +P    LL S ++ +       L N++   ++ R  V+       +  LL + 
Sbjct  570  IGLKEKGLPHIARLLQSGNSDVVRSGASLLSNMSRHPALHR--VMGTQVFPEVTRLLTSH  627

Query  216  PDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI  275
               +S +   L +  +T+ NL  +            ++  ++ L         A+    +
Sbjct  628  TGNTSNSEDILASACYTVRNLMASLPGMAKQHFSSSMVNNIINLCRSSTSPKAAEAARLL  687

Query  276  SYLTDGPNERIGMVVKTGV  294
                    E  G++ + G 
Sbjct  688  LSDMWSSRELQGLLRQQGF  706


> sp|P70039|APC_XENLA Adenomatous polyposis coli homolog OS=Xenopus 
laevis OX=8355 GN=apc PE=1 SV=2
Length=2829

 Score = 85.4 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/282 (17%), Positives = 89/282 (32%), Gaps = 29/282 (10%)

Query  149  SGTSEQTKAVVDGGAIPAFISLLA-----------SPHAHISEQAVWALGNIA-GDGSVF  196
            S   E   A+ + G + A   LL                 +   A  AL N+  GD +  
Sbjct  459  SFDEEHRHAMNELGGLQAIAELLQVDCEMYGLINDHYSVTLRRYAGMALTNLTFGDVANK  518

Query  197  RDLVIKYGAVDPLLALLAVP--DMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILP  254
              L      +  L+A L     D+  +    LRNL+W      R    +         + 
Sbjct  519  ATLCSMKSCMRALVAQLKSESEDLQQVIASVLRNLSW------RADVNSKKTLREVGSVK  572

Query  255  TLVRL-LHHDDPEVLADTCWAISYLTDGPNERIGMVVKT-GVVPQLVKLLGASELPIVTP  312
             L+   L       L     A+  L+    E    +    G +  LV  L          
Sbjct  573  ALMECALDVKKESTLKSVLSALWNLSAHCTENKADICSVDGALAFLVSTLTYRSQTNTLA  632

Query  313  A-------LRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG  365
                    LR + +++   ++  Q++ +   L      L +    I   A  T+ N++A 
Sbjct  633  IIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSAR  692

Query  366  RQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSG  407
                 + + + G V  L +++          +  A+ N  + 
Sbjct  693  NAKDQEGLWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMAN  734


 Score = 83.9 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/265 (15%), Positives = 96/265 (36%), Gaps = 15/265 (6%)

Query  126  SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA-IPAFISLLASPHAHISEQAVW  184
              +       ++  +  ALTN+  G       +    + + A ++ L S    + +    
Sbjct  489  GLINDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKSCMRALVAQLKSESEDLQQVIAS  548

Query  185  ALGNIA-GDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA  243
             L N++       +  + + G+V  L+         S     L +  W LS  C      
Sbjct  549  VLRNLSWRADVNSKKTLREVGSVKALMECALDVKKESTLKSVL-SALWNLSAHCTENK--  605

Query  244  PPIDAVEQILPTLVRLL----HHDDPEVLADTCWAISYLTD---GPNERIGMVVKTGVVP  296
              I +V+  L  LV  L      +   ++      +  ++       +   ++ +   + 
Sbjct  606  ADICSVDGALAFLVSTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQ  665

Query  297  QLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEAT  356
             L++ L +  L IV+ A   + N+     +  + + D GA+++  +L+ +    I   + 
Sbjct  666  TLLQHLKSHSLTIVSNACGTLWNLSARNAKDQEGLWDMGAVSMLKNLIHSKHKMIAMGSA  725

Query  357  WTMSNITAGRQDQIQQVVNHGLVPF  381
              + N+ A R  + +   +  ++  
Sbjct  726  AALRNLMANRPAKYK---DANIMSP  747


 Score = 67.3 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/266 (17%), Positives = 97/266 (36%), Gaps = 16/266 (6%)

Query  73   TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD  132
             V+  +  ++    S  V  +  A  A   L   +             +   V+ L +++
Sbjct  482  QVDCEMYGLINDHYS--VTLRRYAGMALTNLTFGDVANKATLCSMKSCMRALVAQL-KSE  538

Query  133  CSPIQFESAWALTNIA-SGTSEQTKAVVDGGAIPAFISL-LASPHAHISEQAVWALGNIA  190
               +Q   A  L N++        K + + G++ A +   L        +  + AL N++
Sbjct  539  SEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALDVKKESTLKSVLSALWNLS  598

Query  191  GDGSVFR-DLVIKYGAVDPLLALLAVPDMS------SLACGYLRNLTWTLSNLCRNKNPA  243
               +  + D+    GA+  L++ L     +          G LRN++   S +  N++  
Sbjct  599  AHCTENKADICSVDGALAFLVSTLTYRSQTNTLAIIESGGGILRNVS---SLIATNED-H  654

Query  244  PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLG  303
              I      L TL++ L      ++++ C  +  L+    +    +   G V  L  L+ 
Sbjct  655  RQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNAKDQEGLWDMGAVSMLKNLIH  714

Query  304  ASELPIVTPALRAIGNIVTGTDEQTQ  329
            +    I   +  A+ N++     + +
Sbjct  715  SKHKMIAMGSAAALRNLMANRPAKYK  740


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 59/417 (14%), Positives = 128/417 (31%), Gaps = 72/417 (17%)

Query  124  FVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAH------  177
             +S LG  D   +       L  ++S + +   A+   G +P  I LL            
Sbjct  320  LLSMLGTHDKDDMSRT----LLAMSS-SQDSCIAMRQSGCLPLLIQLLHGNDKDSVLLGN  374

Query  178  ------ISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALL-----------------A  214
                         AL NI       +    +   +  LL  +                  
Sbjct  375  SRGSKEARASGSAALDNIIHSQPDDKRGRREIRVL-HLLEQIRAYCETCWEWQEAHEQGM  433

Query  215  VPDMSSLACGY---LRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLH----------  261
              D + +       +      L  L  ++     ++ +   L  +  LL           
Sbjct  434  DQDKNPMPAPVDHQICPAVCVLMKLSFDEEHRHAMNEL-GGLQAIAELLQVDCEMYGLIN  492

Query  262  -HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVV-PQLVKLLGASELPIVTPALRAIGN  319
             H    +      A++ LT G       +         LV  L +    +       + N
Sbjct  493  DHYSVTLRRYAGMALTNLTFGDVANKATLCSMKSCMRALVAQLKSESEDLQQVIASVLRN  552

Query  320  IVTGTDEQTQVVI-DAGALAVFPSL-LTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH-  376
            +    D  ++  + + G++       L   K +  K     + N++A   +    + +  
Sbjct  553  LSWRADVNSKKTLREVGSVKALMECALDVKKESTLKSVLSALWNLSAHCTENKADICSVD  612

Query  377  GLVPFLVSVLSKADFKTQKEAVWAV-------TNYTS--GGTVEQIVYLVHCGIIEPLMN  427
            G + FLVS L+   +++Q   +  +        N +S      +    L     ++ L+ 
Sbjct  613  GALAFLVSTLT---YRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQ  669

Query  428  LLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESV  484
             L +    I+      + N+  +A    + E L     + G +  ++ L + +++ +
Sbjct  670  HLKSHSLTIVSNACGTLWNL--SARNAKDQEGLW----DMGAVSMLKNLIHSKHKMI  720


> sp|F4IIM1|CSI1_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 1 
OS=Arabidopsis thaliana OX=3702 GN=CSI1 PE=1 SV=1
Length=2150

 Score = 85.4 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 53/358 (15%), Positives = 120/358 (34%), Gaps = 16/358 (4%)

Query  98   QAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKA  157
            +    L S      +   +      + +  L     + +Q E   AL  + +      +A
Sbjct  429  RTIEALASLYGNSILSVKLSNSDAKRLLVGLITMAVNEVQDELVKALLMLCNHEGSLWQA  488

Query  158  VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPD  217
            +     I   ISLL        E AV  L  ++ +    +  +   G + PL+ +L    
Sbjct  489  LQGREGIQLLISLLGLSSEQQQECAVALLCLLSNENDESKWAITAAGGIPPLVQILETGS  548

Query  218  MSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISY  277
              +            L NLC +             +P L+ LL +  P         +++
Sbjct  549  AKAREDS-----ATILRNLCNHSEDIRACVESADAVPALLWLLKNGSPNGKEIAAKTLNH  603

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP---ALRAIGNIVTGTDEQTQVVIDA  334
            L    +           + QL  LL +           AL+++ ++V   D   +     
Sbjct  604  LIHKSDTAT--------ISQLTALLTSDLPESKIYVLDALKSMLSVVPFNDMLREGSASN  655

Query  335  GALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ  394
             A+     L+++ K   Q  +   ++ I   R+D  +  +    +   + +L+    +  
Sbjct  656  DAIETMIKLMSSGKEETQANSASALAAIFQSRKDLRESALALKTLLSAIKLLNVDSERIL  715

Query  395  KEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE  452
             E+   +          + V +     +  +++L  +   ++    + A++N+   +E
Sbjct  716  VESCRCLAAILLSIKENRDVAISAREALPTIVSLANSSVLEVAEQGMCALANLILDSE  773


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 49/263 (19%), Positives = 99/263 (38%), Gaps = 15/263 (6%)

Query  160  DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS  219
               A+P  +SLL S    +  QA   LG++    +  R  V+  G + PLL LL    + 
Sbjct  104  HSQAVPVLVSLLRSGSVGVKIQAATVLGSL-CKENELRVKVLLGGCIPPLLGLLKSSSVE  162

Query  220  SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC--WAISY  277
                       + +S      +    I + E ++P L   L   + +   D     A+  
Sbjct  163  GQIAAAKT--IYAVSEGGVKDHVGSKIFSTEGVVPVLWDQLRSGNKKGEVDGLLTGALKN  220

Query  278  LTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGAL  337
            L+          ++ G V  LVKLL + +   ++     +  ++         V+ A   
Sbjct  221  LSSTTEGFWSETIRAGGVDVLVKLLTSGQSSTLSNVCFLLACMMMEDASVCSSVLTADIT  280

Query  338  AVFPSLLTNPKTN-IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFK----  392
                 LL +     ++ EA   + +++A  ++  +++ N   +P L++       +    
Sbjct  281  KQLLKLLGSGNEAPVRAEAAAALKSLSAQSKEAKREIANSNGIPVLINATIAPSKEFMQG  340

Query  393  -----TQKEAVWAVTNYTSGGTV  410
                  Q+ A+ A+ N + G + 
Sbjct  341  EYAQALQENAMCALANISGGLSY  363


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 63/374 (17%), Positives = 119/374 (32%), Gaps = 43/374 (11%)

Query  115   IIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP  174
             ++ +G +     +L        Q E+A  L  I   ++E  +     GA+   +++L   
Sbjct  1236  MVESGALEGLSKYLSLGPQDE-QEEAATGLLGILFSSAEIRRHESAFGAVSQLVAVLRLG  1294

Query  175   HAHISEQAVWALGNI-----AGDGSVFRDLVI-------------KYGAVDPLLALLAVP  216
                    A  AL ++       +    R  V              ++ A+  L+ LL+  
Sbjct  1295  GRGARYSAAKALDSLFTADHIRNAESSRQAVQPLVEILNTGSEREQHAAIAALVRLLSDN  1354

Query  217   DMSSLACGYLR-NLTWTL----------------SNLCR---NKNPAPPIDAVEQILPTL  256
                +LA   +  N    L                + LC             A  + +  L
Sbjct  1355  PSRALAVADVEMNAVDVLCRILSSNYTMELKGDAAELCYVLFANTRIRSTVAAARCVEPL  1414

Query  257   VRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRA  316
             V LL  +          A+  L D   +   +V   G V  LV LL      +     RA
Sbjct  1415  VSLLVTEFSPAQHSVVRALDKLVD-DEQLAELVAAHGAVVPLVGLLYGKNYVLHEAISRA  1473

Query  317   IGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  376
             +  +          ++ AG +     +L      +   A   +  I        +     
Sbjct  1474  LVKLGKDRPACKLEMVKAGVIDCVLDILHEAPDFL-CAAFSELLRILTNNATIAKGQSAA  1532

Query  377   GLVPFLVSVLSKADF--KTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDT  434
              +V  L  +L++ +F    Q  A+  + N            L    +IEPL+ LL +   
Sbjct  1533  KVVEPLFHLLTRLEFGADGQHSALQVLVNILEHPQCRADYTLTPHQVIEPLIPLLESPSP  1592

Query  435   KIILVILDAISNIF  448
              +  +  + +S++ 
Sbjct  1593  AVQQLAAELLSHLL  1606


 Score = 78.9 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 69/403 (17%), Positives = 141/403 (35%), Gaps = 17/403 (4%)

Query  66    ENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNI-IRAGLIPKF  124
             ++  N  +   +V  +V+ +N+ +   Q  A  A  +LLS      +    +    +   
Sbjct  1313  DHIRNAESSRQAVQPLVEILNTGSEREQHAAIAALVRLLSDNPSRALAVADVEMNAVDVL  1372

Query  125   VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVW  184
                L       ++ ++A  L  +    +     V     +   +SLL +  +      V 
Sbjct  1373  CRILSSNYTMELKGDAA-ELCYVLFANTRIRSTVAAARCVEPLVSLLVTEFSPAQHSVVR  1431

Query  185   ALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAP  244
             AL  +  D     +LV  +GAV PL+ LL   +           ++  L  L +++    
Sbjct  1432  ALDKL-VDDEQLAELVAAHGAVVPLVGLLYGKNYVLHEA-----ISRALVKLGKDRPACK  1485

Query  245   PIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
                    ++  ++ +LH     + A     +  LT+      G      VV  L  LL  
Sbjct  1486  LEMVKAGVIDCVLDILHEAPDFLCAAFSELLRILTNNATIAKGQSA-AKVVEPLFHLLTR  1544

Query  305   SE--LPIVTPALRAIGNIVTGTDEQTQVVID-AGALAVFPSLLTNPKTNIQKEATWTMSN  361
              E        AL+ + NI+     +    +     +     LL +P   +Q+ A   +S+
Sbjct  1545  LEFGADGQHSALQVLVNILEHPQCRADYTLTPHQVIEPLIPLLESPSPAVQQLAAELLSH  1604

Query  362   ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGI  421
             +      Q   +     +  L+ VL       Q+ AV A+ +       E    +   G 
Sbjct  1605  LLYEEHLQKDPLTQL-AIGPLIHVLGSGIHLLQQRAVKALVSIALTWPNE----IAKEGG  1659

Query  422   IEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMI  464
             +  L  ++   D  +  V+ ++ ++I     +      L + +
Sbjct  1660  VSELSKVILQADPSLSNVLWESAASILVIILQFSSEFYLEVPV  1702


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 56/316 (18%), Positives = 108/316 (34%), Gaps = 26/316 (8%)

Query  53    VSSFPDDATSPL--QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP  110
             V     +  S L  +E+         ++  ++  + S     Q +A +A   +       
Sbjct  1594  VQQLAAELLSHLLYEEHLQKDPLTQLAIGPLIHVLGSGIHLLQQRAVKALVSIALTWPN-  1652

Query  111   PIDNIIRAGLIPKF--VSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI  168
                 I + G + +   V        S + +ESA ++  I    S +    V    +   +
Sbjct  1653  ---EIAKEGGVSELSKVILQADPSLSNVLWESAASILVIILQFSSEFYLEVP---VAVLV  1706

Query  169   SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRN  228
              LL S   +    A+ AL  +  D     + + + GA++ LL LL        A   L  
Sbjct  1707  RLLRSASENTVVGALNALLVLESDDGTSAESMAESGAIEALLDLLRSHQCEDTAARLLEV  1766

Query  229   LTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGM  288
             L         N        A +  +  L + L   DP+  A     ++ L  G   +   
Sbjct  1767  LL--------NNVKIRDSKATKTAILPLSQYLL--DPQTQAQQARLLATLALGDLFQNEA  1816

Query  289   VVK----TGVVPQLVKLLGA-SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSL  343
             + +          LV +L       +   A+ A+ N+V  +    + V +AG + V   L
Sbjct  1817  LARSTDAASACRALVNVLEEQPTEEMKVVAICALQNLVMYSRSNKRAVAEAGGVQVVLDL  1876

Query  344   LTNPKTNIQKEATWTM  359
             +++       +A   +
Sbjct  1877  ISSSDPETSVQAAMFV  1892


 Score = 75.0 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 69/447 (15%), Positives = 147/447 (33%), Gaps = 63/447 (14%)

Query  107  EKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPA  166
            E      +++ A +  + +  LG  + +P++ E+A AL ++++ + E  + + +   IP 
Sbjct  266  EDASVCSSVLTADITKQLLKLLGSGNEAPVRAEAAAALKSLSAQSKEAKREIANSNGIPV  325

Query  167  FISLLASPHAH---------ISEQAVWALGNIAG-----------DGSVFRDLVIKYGAV  206
             I+   +P            + E A+ AL NI+G                         +
Sbjct  326  LINATIAPSKEFMQGEYAQALQENAMCALANISGGLSYVISSLGQSLESCSSPAQTADTL  385

Query  207  DPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPT-----------  255
              L + L + D  +       +       L +   P  P    E+ +             
Sbjct  386  GALASALMIYDGKAETTRA-SDPLVVEQTLLKQFKPRLPFLVQERTIEALASLYGNSILS  444

Query  256  -----------LVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGA  304
                       LV L+     EV  +   A+  L +        +     +  L+ LLG 
Sbjct  445  VKLSNSDAKRLLVGLITMAVNEVQDELVKALLMLCNHEGSLWQALQGREGIQLLISLLGL  504

Query  305  SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA  364
            S       A+  +  +    DE    +  AG +     +L       ++++   + N+  
Sbjct  505  SSEQQQECAVALLCLLSNENDESKWAITAAGGIPPLVQILETGSAKAREDSATILRNLCN  564

Query  365  GRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEP  424
              +D    V +   VP L+ +L       ++ A   + +                  I  
Sbjct  565  HSEDIRACVESADAVPALLWLLKNGSPNGKEIAAKTLNHLIHKS---------DTATISQ  615

Query  425  LMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEE----CGGLDKIEALQNHE  480
            L  LLT+   +  + +LDA+ ++             + M+ E       ++ +  L +  
Sbjct  616  LTALLTSDLPESKIYVLDALKSMLSVV-------PFNDMLREGSASNDAIETMIKLMSSG  668

Query  481  NESVYKASLSLIEKYFSVEEEEDQNVV  507
             E     S S +   F   ++  ++ +
Sbjct  669  KEETQANSASALAAIFQSRKDLRESAL  695


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 71/421 (17%), Positives = 151/421 (36%), Gaps = 26/421 (6%)

Query  59   DATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA  118
            D T+ +++      +V   ++ + +G  SS+ + +    +    L+   +         +
Sbjct  48   DRTTSMEDPDGTLASVAQCIEQLRQG--SSSAQEREYCLKQLLDLIEMRENAFSAVGSHS  105

Query  119  GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI  178
              +P  VS L R+    ++ ++A  L ++      + K ++ GG IP  + LL S     
Sbjct  106  QAVPVLVSLL-RSGSVGVKIQAATVLGSLCKENELRVKVLL-GGCIPPLLGLLKSSSVEG  163

Query  179  SEQAVWALGNIAGDGSVFRDLVIK-----YGAVDPLLALLAVPDMSSLACGYLRNLTWTL  233
               A   +   A      +D V        G V  L   L   +      G L   T  L
Sbjct  164  QIAAAKTIY--AVSEGGVKDHVGSKIFSTEGVVPVLWDQLRSGNKKGEVDGLL---TGAL  218

Query  234  SNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTG  293
             NL                +  LV+LL       L++ C+ ++ +          V+   
Sbjct  219  KNLSSTTEGFWSETIRAGGVDVLVKLLTSGQSSTLSNVCFLLACMMMEDASVCSSVLTAD  278

Query  294  VVPQLVKLLGA-SELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN--  350
            +  QL+KLLG+ +E P+   A  A+ ++   + E  + + ++  + V  +    P     
Sbjct  279  ITKQLLKLLGSGNEAPVRAEAAAALKSLSAQSKEAKREIANSNGIPVLINATIAPSKEFM  338

Query  351  -------IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN  403
                   +Q+ A   ++NI+ G    I  +     +    S    AD      +   + +
Sbjct  339  QGEYAQALQENAMCALANISGGLSYVISSLGQS--LESCSSPAQTADTLGALASALMIYD  396

Query  404  YTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIM  463
              +  T      +V   +++     L     +  +  L ++      + KL  ++   ++
Sbjct  397  GKAETTRASDPLVVEQTLLKQFKPRLPFLVQERTIEALASLYGNSILSVKLSNSDAKRLL  456

Query  464  I  464
            +
Sbjct  457  V  457


 Score = 73.1 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 68/419 (16%), Positives = 138/419 (33%), Gaps = 35/419 (8%)

Query  90    VENQLQATQAARKLLSREKQPPIDNIIRAG-LIPKFVSFLGRTDC-SPIQFESAWALTNI  147
              +    A     ++L+      I     A  ++      L R +  +  Q  +   L NI
Sbjct  1505  PDFLCAAFSELLRILT--NNATIAKGQSAAKVVEPLFHLLTRLEFGADGQHSALQVLVNI  1562

Query  148   ASGTSEQTKA---VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYG  204
                   Q +A   +     I   I LL SP   + + A   L ++  +  + +D + +  
Sbjct  1563  LEH--PQCRADYTLTPHQVIEPLIPLLESPSPAVQQLAAELLSHLLYEEHLQKDPLTQL-  1619

Query  205   AVDPLLALLAVP--DMSSLACGYLRNLTWTLSN-LCRNKNPAPPIDAVEQILPTLVRLLH  261
             A+ PL+ +L      +   A   L ++  T  N + +    +     + Q  P+L  +L 
Sbjct  1620  AIGPLIHVLGSGIHLLQQRAVKALVSIALTWPNEIAKEGGVSELSKVILQADPSLSNVLW  1679

Query  262   HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIV  321
                          +  +    +E    V     V  LV+LL ++    V  AL A+  + 
Sbjct  1680  ES-------AASILVIILQFSSEFYLEV----PVAVLVRLLRSASENTVVGALNALLVLE  1728

Query  322   TGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT-MSNITAGRQDQIQQVVNHGLVP  380
             +      + + ++GA+     LL +     Q E T   +  +                + 
Sbjct  1729  SDDGTSAESMAESGAIEALLDLLRSH----QCEDTAARLLEVLLNNVKIRDSKATKTAIL  1784

Query  381   FLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH-CGIIEPLMNLLTAKDTKIILV  439
              L   L     + Q+  + A          E +            L+N+L  + T+ + V
Sbjct  1785  PLSQYLLDPQTQAQQARLLATLALGDLFQNEALARSTDAASACRALVNVLEEQPTEEMKV  1844

Query  440   ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSV  498
             +      I      +  +      + E GG+  +  L +  +      +   ++  FS 
Sbjct  1845  VA-----ICALQNLVMYSRSNKRAVAEAGGVQVVLDLISSSDPETSVQAAMFVKLLFSN  1898


 Score = 70.8 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 61/436 (14%), Positives = 141/436 (32%), Gaps = 46/436 (11%)

Query  65   QENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA--GLIP  122
            +     +  +   +  ++  + SS+VE Q+ A +    +     +  + + I +  G++P
Sbjct  136  ENELRVKVLLGGCIPPLLGLLKSSSVEGQIAAAKTIYAVSEGGVKDHVGSKIFSTEGVVP  195

Query  123  KFVSFLGRTDCS-PIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ  181
                 L   +    +      AL N++S T       +  G +   + LL S  +     
Sbjct  196  VLWDQLRSGNKKGEVDGLLTGALKNLSSTTEGFWSETIRAGGVDVLVKLLTSGQSSTLSN  255

Query  182  AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN  241
              + L  +  + +     V+       LL LL   + + +       L    +     K 
Sbjct  256  VCFLLACMMMEDASVCSSVLTADITKQLLKLLGSGNEAPVRAEAAAALKSLSAQSKEAKR  315

Query  242  PAPPIDAVEQILPTLV----RLLHHDDPE-VLADTCWAISYLTDGPNERIGMVVK-----  291
                 + +  ++   +      +  +  + +  +   A++ ++ G +  I  + +     
Sbjct  316  EIANSNGIPVLINATIAPSKEFMQGEYAQALQENAMCALANISGGLSYVISSLGQSLESC  375

Query  292  ------TGVVPQLVKLLG----------ASELPIVTPAL--------------RAIGNIV  321
                     +  L   L           AS+  +V   L              R I  + 
Sbjct  376  SSPAQTADTLGALASALMIYDGKAETTRASDPLVVEQTLLKQFKPRLPFLVQERTIEALA  435

Query  322  T--GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV  379
            +  G    +  + ++ A  +   L+T     +Q E    +  +        Q +     +
Sbjct  436  SLYGNSILSVKLSNSDAKRLLVGLITMAVNEVQDELVKALLMLCNHEGSLWQALQGREGI  495

Query  380  PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV  439
              L+S+L  +  + Q+E   A+    S    E    +   G I PL+ +L     K    
Sbjct  496  QLLISLLGLSSEQ-QQECAVALLCLLSNENDESKWAITAAGGIPPLVQILETGSAKARED  554

Query  440  ILDAISNIFQAAEKLG  455
                + N+   +E + 
Sbjct  555  SATILRNLCNHSEDIR  570


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 62/322 (19%), Positives = 110/322 (34%), Gaps = 16/322 (5%)

Query  126   SFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA  185
              FL   +           L  I     E T+A     A+P   +L+ S        A  A
Sbjct  1063  RFLQADNGEDANIWVCALLLAILFQDREITRAHATMKAVPVLSNLVKSEEYADRYFAAQA  1122

Query  186   LGNIAGDGSVFRDL-VIKYGAVDPLLALLAVPDMSSLACGYLRNLTW--------TLSNL  236
             L ++  +GS    L V   GA    ++LL   D        L              L  L
Sbjct  1123  LASLVCNGSRGTLLSVANSGAAAGFISLLGCSDDDIKELLQLSQEFTLVRYPDQVALERL  1182

Query  237   CRNKNPAPPIDAVEQILPTLVRLLH--HDDPEVLADTCWAISYLTDGPNERIGMVVKTGV  294
              R ++         + +P LV LL    D P     +   ++ L     + + ++V++G 
Sbjct  1183  FRVED-IRVGATSRKAIPLLVELLKPIPDRPGAPLLSLNLLTQLAGDCPQNMIVMVESGA  1241

Query  295   VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE  354
             +  L K L          A   +  I+  + E  +     GA++   ++L       +  
Sbjct  1242  LEGLSKYLSLGPQDEQEEAATGLLGILFSSAEIRRHESAFGAVSQLVAVLRLGGRGARYS  1301

Query  355   ATWTM-SNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAV-TNYTSGGTVEQ  412
             A   + S  TA      +   +   V  LV +L+    + Q  A+ A+    +   +   
Sbjct  1302  AAKALDSLFTADHIRNAES--SRQAVQPLVEILNTGSEREQHAAIAALVRLLSDNPSRAL  1359

Query  413   IVYLVHCGIIEPLMNLLTAKDT  434
              V  V    ++ L  +L++  T
Sbjct  1360  AVADVEMNAVDVLCRILSSNYT  1381


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 41/243 (17%), Positives = 88/243 (36%), Gaps = 33/243 (14%)

Query  238  RNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQ  297
             +  P  P    +  L      +   D   LA     I  L  G +       +   + Q
Sbjct  31   HDSEPPTPHSTTKMSLRDRTTSMEDPD-GTLASVAQCIEQLRQGSSSAQE---REYCLKQ  86

Query  298  LVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATW  357
            L+ L+      +   A  A+G+              + A+ V  SLL +    ++ +A  
Sbjct  87   LLDLI-----EMRENAFSAVGS-------------HSQAVPVLVSLLRSGSVGVKIQAAT  128

Query  358  TMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQI--VY  415
             + ++    + +++ V+  G +P L+ +L  +  + Q  A   +   + GG  + +    
Sbjct  129  VLGSLCKENELRVK-VLLGGCIPPLLGLLKSSSVEGQIAAAKTIYAVSEGGVKDHVGSKI  187

Query  416  LVHCGIIEPLMNLLTAKD--TKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI  473
                G++  L + L + +   ++  ++  A+ N+         TE         GG+D +
Sbjct  188  FSTEGVVPVLWDQLRSGNKKGEVDGLLTGALKNL------SSTTEGFWSETIRAGGVDVL  241

Query  474  EAL  476
              L
Sbjct  242  VKL  244


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 68/372 (18%), Positives = 122/372 (33%), Gaps = 40/372 (11%)

Query  120   LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-DGGAIPAFISLLASPHAHI  178
              +P   + +   + +  ++ +A AL ++    S  T   V + GA   FISLL      I
Sbjct  1100  AVPVLSNLVKSEEYAD-RYFAAQALASLVCNGSRGTLLSVANSGAAAGFISLLGCSDDDI  1158

Query  179   SEQ----------------AVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLA  222
              E                 A+  L  +       R       A+  L+ LL        A
Sbjct  1159  KELLQLSQEFTLVRYPDQVALERLFRV----EDIRVGATSRKAIPLLVELLKPIPDRPGA  1214

Query  223   CGYLRNLTWTLSNLCRNKNPAPPIDAVE-QILPTLVRLLHHDDPEVLADTCWAISYLTDG  281
                  NL   L+  C    P   I  VE   L  L + L     +   +    +  +   
Sbjct  1215  PLLSLNLLTQLAGDC----PQNMIVMVESGALEGLSKYLSLGPQDEQEEAATGLLGILFS  1270

Query  282   PNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP  341
               E        G V QLV +L          A +A+ ++ T    +        A+    
Sbjct  1271  SAEIRRHESAFGAVSQLVAVLRLGGRGARYSAAKALDSLFTADHIRNAE-SSRQAVQPLV  1329

Query  342   SLLTNPKTNIQKEATWTMSNITAGRQDQ