PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= YP_009724392.1 envelope protein [Severe acute respiratory syndrome
coronavirus 2]

Length=75
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTC4|VEMP_SARS2 Envelope small membrane protein OS=Severe ...   144    1e-44
  sp|P59637|VEMP_CVHSA Envelope small membrane protein OS=Human S...   134    1e-40
  sp|Q3I5J3|VEMP_BCRP3 Envelope small membrane protein OS=Bat cor...   134    1e-40
  sp|Q3LZW9|VEMP_BCHK3 Envelope small membrane protein OS=Bat cor...   134    1e-40
  sp|Q0Q473|VEMP_BC279 Envelope small membrane protein OS=Bat cor...   132    5e-40
  sp|Q0Q4E8|VEMP_BC133 Envelope small membrane protein OS=Bat cor...  56.6    1e-10
  sp|A3EX99|VEMP_BCHK4 Envelope small membrane protein OS=Bat cor...  56.2    2e-10
  sp|K9N5R3|VEMP_MERS1 Envelope small membrane protein OS=Middle ...  45.1    2e-06
  sp|A3EXD5|VEMP_BCHK5 Envelope small membrane protein OS=Bat cor...  42.7    1e-05
  sp|Q0ZME5|VEMP_CVHN5 Envelope small membrane protein OS=Human c...  40.8    7e-05
  sp|Q14EA8|VEMP_CVHN2 Envelope small membrane protein OS=Human c...  40.8    7e-05
  sp|Q9IKC8|VEMP_CVRSD Envelope small membrane protein OS=Rat cor...  34.7    0.010
  sp|P0C2R0|VEMP_CVMA5 Envelope small membrane protein OS=Murine ...  33.5    0.027
  sp|Q5MQC8|VEMP_CVHN1 Envelope small membrane protein OS=Human c...  32.7    0.056
  sp|P29076|VEMP_CVMS Envelope small membrane protein OS=Murine c...  32.0    0.096
  sp|P06591|VEMP_CVMJH Envelope small membrane protein OS=Murine ...  31.2    0.21 
  sp|P0C2Q7|VEMP_CVBQ Envelope small membrane protein OS=Bovine c...  29.6    0.70 
  sp|P0C2Q6|VEMP_CVBON Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P0C2Q5|VEMP_CVBOK Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P0C2Q4|VEMP_CVBLY Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P0C2Q3|VEMP_CVBLU Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P0C2Q2|VEMP_CVBLS Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P15775|VEMP_CVBF Envelope small membrane protein OS=Bovine c...  29.6    0.70 
  sp|P0C2Q1|VEMP_CVBEN Envelope small membrane protein OS=Bovine ...  29.6    0.70 
  sp|P0C2Q9|VEMP_CVPIA Envelope small membrane protein OS=Porcine...  29.6    0.79 
  sp|P0C2Q8|VEMP_CVP67 Envelope small membrane protein OS=Porcine...  29.6    0.79 
  sp|Q04854|VEMP_CVHOC Envelope small membrane protein OS=Human c...  29.3    1.2  
  sp|P15779|VEMP_CVBM Envelope small membrane protein OS=Bovine c...  28.9    1.9  
  sp|P19741|VEMP_CVH22 Envelope small membrane protein OS=Human c...  27.7    3.7  
  sp|A3EXG8|VEMP_BCHK9 Envelope small membrane protein OS=Bat cor...  27.7    4.0  
  sp|P36696|VEMP_CVCAI Envelope small membrane protein OS=Canine ...  26.9    7.7  


> sp|P0DTC4|VEMP_SARS2 Envelope small membrane protein OS=Severe 
acute respiratory syndrome coronavirus 2 OX=2697049 GN=E PE=3 
SV=1
Length=75

 Score =  144 bits (362),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60

Query  61  RVKNLNSSRVPDLLV  75
           RVKNLNSSRVPDLLV
Sbjct  61  RVKNLNSSRVPDLLV  75


> sp|P59637|VEMP_CVHSA Envelope small membrane protein OS=Human 
SARS coronavirus OX=694009 GN=E PE=1 SV=1
Length=76

 Score =  134 bits (336),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q3I5J3|VEMP_BCRP3 Envelope small membrane protein OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=E PE=3 SV=1
Length=76

 Score =  134 bits (336),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q3LZW9|VEMP_BCHK3 Envelope small membrane protein OS=Bat coronavirus 
HKU3 OX=442736 GN=E PE=3 SV=1
Length=76

 Score =  134 bits (336),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q0Q473|VEMP_BC279 Envelope small membrane protein OS=Bat coronavirus 
279/2005 OX=389167 GN=E PE=3 SV=1
Length=76

 Score =  132 bits (332),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 72/76 (95%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLF AFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q0Q4E8|VEMP_BC133 Envelope small membrane protein OS=Bat coronavirus 
133/2005 OX=389230 GN=E PE=3 SV=1
Length=82

 Score = 56.6 bits (135),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ GT+IVN  +L +   + LLV LA+LTA+RLC  C + VN  L  P+FY+Y+
Sbjct  1   MLPFVHEQIGTIIVNFFILTVVCAITLLVCLAVLTAIRLCVQCASGVNTLLFVPAFYIYN  60

Query  61  RVKN----LNSSRVP  71
             +N       +R P
Sbjct  61  TGRNAYFKFQENRPP  75


> sp|A3EX99|VEMP_BCHK4 Envelope small membrane protein OS=Bat coronavirus 
HKU4 OX=694007 GN=E PE=3 SV=1
Length=82

 Score = 56.2 bits (134),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ GT+IVN  +L +   + L+V LAILTA+RLC  C + VN  L  P+FY+Y+
Sbjct  1   MLPFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYIYN  60

Query  61  RVKN----LNSSRVP  71
             +N       +R P
Sbjct  61  TGRNAYFKFQENRPP  75


> sp|K9N5R3|VEMP_MERS1 Envelope small membrane protein OS=Middle 
East respiratory syndrome-related coronavirus (isolate United 
Kingdom/H123990006/2012) OX=1263720 GN=E PE=1 SV=1
Length=82

 Score = 45.1 bits (105),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (51%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E  G  IVN  +  +   + LLV +A LTA RLC  C    N  LV+P+ Y+Y+
Sbjct  1   MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYN  60

Query  61  RVKN----LNSSRVP  71
             ++       S+ P
Sbjct  61  TGRSVYVKFQDSKPP  75


> sp|A3EXD5|VEMP_BCHK5 Envelope small membrane protein OS=Bat coronavirus 
HKU5 OX=694008 GN=E PE=3 SV=1
Length=82

 Score = 42.7 bits (99),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ G  IVN  +L +   V L+V LAILTA+RLC  C +  +  +  P+ ++Y+
Sbjct  1   MLPFVQEQIGAFIVNFFILSVVCAVTLVVCLAILTAIRLCVQCVSGCHTLVFLPAVHIYN  60


> sp|Q0ZME5|VEMP_CVHN5 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N5) OX=443241 GN=E PE=3 SV=1
Length=82

 Score = 40.8 bits (94),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 34/61 (56%), Gaps = 0/61 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +     L L+ V+FL+  +A+L  ++LC   C   N+ ++ PS YVY+R + L  
Sbjct  8   DTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYVYNRGRQLYK  67

Query  68  S  68
           S
Sbjct  68  S  68


> sp|Q14EA8|VEMP_CVHN2 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N2) OX=443240 GN=E PE=3 SV=1
Length=82

 Score = 40.8 bits (94),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 34/61 (56%), Gaps = 0/61 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +     L L+ V+FL+  +A+L  ++LC   C   N+ ++ PS YVY+R + L  
Sbjct  8   DTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYVYNRGRQLYK  67

Query  68  S  68
           S
Sbjct  68  S  68


> sp|Q9IKC8|VEMP_CVRSD Envelope small membrane protein OS=Rat coronavirus 
(strain 681) OX=33740 GN=E PE=3 SV=1
Length=88

 Score = 34.7 bits (78),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 0/38 (0%)

Query  28  LVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++ +A L +++LC   C + N  L+ PS YVY+R K L
Sbjct  28  IIVVAFLASIKLCIQLCGLCNTLLLSPSIYVYNRSKQL  65


> sp|P0C2R0|VEMP_CVMA5 Envelope small membrane protein OS=Murine 
coronavirus (strain A59) OX=11142 GN=E PE=1 SV=1
Length=83

 Score = 33.5 bits (75),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (59%), Gaps = 3/46 (7%)

Query  23  FVVFLLVTL---AILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           F V L+VT+   A L +++LC   C + N  ++ PS Y+Y R K L
Sbjct  20  FAVCLMVTIIVVAFLASIKLCIQLCGLCNTLVLSPSIYLYDRSKQL  65


> sp|Q5MQC8|VEMP_CVHN1 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N1) OX=443239 GN=E PE=3 SV=1
Length=82

 Score = 32.7 bits (73),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 0/61 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   I   ++L L  ++ L+  +A L  ++LC   C   N  ++ PS YVY R   L  
Sbjct  8   DTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYVYKRGMQLYK  67

Query  68  S  68
           S
Sbjct  68  S  68


> sp|P29076|VEMP_CVMS Envelope small membrane protein OS=Murine 
coronavirus (strain S) OX=11145 GN=E PE=3 SV=1
Length=88

 Score = 32.0 bits (71),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  14  VNSVLLFLAFVVFLLVTL-AILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           V  ++  +A  + + +T+ A L +++LC   C + N  ++ PS Y+Y R K L
Sbjct  13  VGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYLYDRSKQL  65


> sp|P06591|VEMP_CVMJH Envelope small membrane protein OS=Murine 
coronavirus (strain JHM) OX=11144 GN=E PE=3 SV=1
Length=88

 Score = 31.2 bits (69),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (61%), Gaps = 0/38 (0%)

Query  28  LVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++ +A L +++ C   C + N  L+ PS Y+Y+R K L
Sbjct  28  IIVVAFLASIKRCIQLCGLCNTLLLSPSIYLYNRSKQL  65


> sp|P0C2Q7|VEMP_CVBQ Envelope small membrane protein OS=Bovine 
coronavirus (strain Quebec) OX=11133 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q6|VEMP_CVBON Envelope small membrane protein OS=Bovine 
coronavirus (strain Ontario) OX=231422 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q5|VEMP_CVBOK Envelope small membrane protein OS=Bovine 
coronavirus (strain OK-0514) OX=231432 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q4|VEMP_CVBLY Envelope small membrane protein OS=Bovine 
coronavirus (strain LY-138) OX=11131 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q3|VEMP_CVBLU Envelope small membrane protein OS=Bovine 
coronavirus (strain 98TXSF-110-LUN) OX=233264 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q2|VEMP_CVBLS Envelope small membrane protein OS=Bovine 
coronavirus (strain LSU-94LSS-051) OX=233261 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P15775|VEMP_CVBF Envelope small membrane protein OS=Bovine 
coronavirus (strain F15) OX=11129 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q1|VEMP_CVBEN Envelope small membrane protein OS=Bovine 
coronavirus (strain 98TXSF-110-ENT) OX=233262 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q9|VEMP_CVPIA Envelope small membrane protein OS=Porcine 
hemagglutinating encephalomyelitis virus (strain IAF-404) 
OX=230236 GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P0C2Q8|VEMP_CVP67 Envelope small membrane protein OS=Porcine 
hemagglutinating encephalomyelitis virus (strain 67N) OX=230237 
GN=E PE=3 SV=1
Length=84

 Score = 29.6 bits (65),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|Q04854|VEMP_CVHOC Envelope small membrane protein OS=Human 
coronavirus OC43 OX=31631 GN=E PE=3 SV=1
Length=84

 Score = 29.3 bits (64),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 21/38 (55%), Gaps = 0/38 (0%)

Query  28  LVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           +V +A L   +LC   C + N  ++ PS YV++R +  
Sbjct  30  IVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQF  67


> sp|P15779|VEMP_CVBM Envelope small membrane protein OS=Bovine 
coronavirus (strain Mebus) OX=11132 GN=E PE=3 SV=1
Length=84

 Score = 28.9 bits (63),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  27  LLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL  65
           ++V +A L   +LC   C + N   + PS YV++R +  
Sbjct  29  IIVVVAFLATFKLCIQLCGMCNTLGLSPSIYVFNRGRQF  67


> sp|P19741|VEMP_CVH22 Envelope small membrane protein OS=Human 
coronavirus 229E OX=11137 GN=E PE=3 SV=1
Length=77

 Score = 27.7 bits (60),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYC---CNIVNVSLVKPSFYVYSRVKN  64
           +   L+VN +L  +  +V LLV + I+  ++LC  C   CN      +K  +++Y    +
Sbjct  7   DDHALVVNVLLWCVVLIVILLVCITIIKLIKLCFTCHMFCNRTVYGPIKNVYHIYQSYMH  66

Query  65  LN--SSRVPD  72
           ++    RV D
Sbjct  67  IDPFPKRVID  76


> sp|A3EXG8|VEMP_BCHK9 Envelope small membrane protein OS=Bat coronavirus 
HKU9 OX=694006 GN=E PE=3 SV=1
Length=79

 Score = 27.7 bits (60),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 0/64 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MY  V      LI N ++L +  ++ ++V  A+L  L+     C  V   + KP+  VY+
Sbjct  1   MYDIVGTNNSILIANVLVLIIICLLVVIVGCALLLILQFVFGVCGFVFKFVCKPTILVYN  60

Query  61  RVKN  64
           + +N
Sbjct  61  KFRN  64


> sp|P36696|VEMP_CVCAI Envelope small membrane protein OS=Canine 
coronavirus (strain Insavc-1) OX=36391 GN=E PE=3 SV=1
Length=82

 Score = 26.9 bits (58),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query  37  LRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRV--PD  72
           ++LC  CCN+    ++ P+ + Y   KN    R   PD
Sbjct  40  IKLCMVCCNLGRTVIIVPARHAYDAYKNFMQIRAYNPD  77



Lambda      K        H        a         alpha
   0.331    0.142    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5130021526
Results from round 2


Query= YP_009724392.1 envelope protein [Severe acute respiratory syndrome
coronavirus 2]

Length=75
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|Q0Q4E8|VEMP_BC133 Envelope small membrane protein OS=Bat cor...  77.3    2e-18
  sp|A3EX99|VEMP_BCHK4 Envelope small membrane protein OS=Bat cor...  77.3    2e-18
  sp|A3EXD5|VEMP_BCHK5 Envelope small membrane protein OS=Bat cor...  74.9    1e-17
  sp|K9N5R3|VEMP_MERS1 Envelope small membrane protein OS=Middle ...  74.6    2e-17
  sp|P0DTC4|VEMP_SARS2 Envelope small membrane protein OS=Severe ...  70.7    6e-16
  sp|P59637|VEMP_CVHSA Envelope small membrane protein OS=Human S...  66.5    3e-14
  sp|Q3I5J3|VEMP_BCRP3 Envelope small membrane protein OS=Bat cor...  66.5    3e-14
  sp|Q3LZW9|VEMP_BCHK3 Envelope small membrane protein OS=Bat cor...  66.5    3e-14
  sp|Q0Q473|VEMP_BC279 Envelope small membrane protein OS=Bat cor...  65.7    5e-14
  sp|Q0ZME5|VEMP_CVHN5 Envelope small membrane protein OS=Human c...  62.6    7e-13
  sp|Q14EA8|VEMP_CVHN2 Envelope small membrane protein OS=Human c...  62.6    7e-13

Sequences not found previously or not previously below threshold:

  sp|Q5MQC8|VEMP_CVHN1 Envelope small membrane protein OS=Human c...  53.8    2e-09
  sp|P0C2Q9|VEMP_CVPIA Envelope small membrane protein OS=Porcine...  51.1    1e-08
  sp|P0C2Q8|VEMP_CVP67 Envelope small membrane protein OS=Porcine...  51.1    1e-08
  sp|P0C2Q7|VEMP_CVBQ Envelope small membrane protein OS=Bovine c...  51.1    2e-08
  sp|P0C2Q6|VEMP_CVBON Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P0C2Q5|VEMP_CVBOK Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P0C2Q4|VEMP_CVBLY Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P0C2Q3|VEMP_CVBLU Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P0C2Q2|VEMP_CVBLS Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P15775|VEMP_CVBF Envelope small membrane protein OS=Bovine c...  51.1    2e-08
  sp|P0C2Q1|VEMP_CVBEN Envelope small membrane protein OS=Bovine ...  51.1    2e-08
  sp|P15779|VEMP_CVBM Envelope small membrane protein OS=Bovine c...  51.1    2e-08
  sp|Q04854|VEMP_CVHOC Envelope small membrane protein OS=Human c...  50.7    2e-08
  sp|P06591|VEMP_CVMJH Envelope small membrane protein OS=Murine ...  50.7    2e-08
  sp|Q9IKC8|VEMP_CVRSD Envelope small membrane protein OS=Rat cor...  49.9    4e-08
  sp|P0C2R0|VEMP_CVMA5 Envelope small membrane protein OS=Murine ...  49.5    6e-08
  sp|P29076|VEMP_CVMS Envelope small membrane protein OS=Murine c...  49.1    7e-08
  sp|A3EXG8|VEMP_BCHK9 Envelope small membrane protein OS=Bat cor...  28.7    1.7  
  sp|P19741|VEMP_CVH22 Envelope small membrane protein OS=Human c...  28.3    2.4  
  sp|Q52PA5|VEMP_FIPV Envelope small membrane protein OS=Feline c...  27.6    4.9  
  sp|Q10426|RIK1_SCHPO Chromatin modification-related protein rik...  28.7    5.0  


> sp|Q0Q4E8|VEMP_BC133 Envelope small membrane protein OS=Bat coronavirus 
133/2005 OX=389230 GN=E PE=3 SV=1
Length=82

 Score = 77.3 bits (189),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ GT+IVN  +L +   + LLV LA+LTA+RLC  C + VN  L  P+FY+Y+
Sbjct  1   MLPFVHEQIGTIIVNFFILTVVCAITLLVCLAVLTAIRLCVQCASGVNTLLFVPAFYIYN  60

Query  61  RVKN----LNSSRVP  71
             +N       +R P
Sbjct  61  TGRNAYFKFQENRPP  75


> sp|A3EX99|VEMP_BCHK4 Envelope small membrane protein OS=Bat coronavirus 
HKU4 OX=694007 GN=E PE=3 SV=1
Length=82

 Score = 77.3 bits (189),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ GT+IVN  +L +   + L+V LAILTA+RLC  C + VN  L  P+FY+Y+
Sbjct  1   MLPFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYIYN  60

Query  61  RVKN----LNSSRVP  71
             +N       +R P
Sbjct  61  TGRNAYFKFQENRPP  75


> sp|A3EXD5|VEMP_BCHK5 Envelope small membrane protein OS=Bat coronavirus 
HKU5 OX=694008 GN=E PE=3 SV=1
Length=82

 Score = 74.9 bits (183),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E+ G  IVN  +L +   V L+V LAILTA+RLC  C +  +  +  P+ ++Y+
Sbjct  1   MLPFVQEQIGAFIVNFFILSVVCAVTLVVCLAILTAIRLCVQCVSGCHTLVFLPAVHIYN  60

Query  61  RVK----NLNSSRVP  71
             +        S  P
Sbjct  61  TGRAAYVKFQESHPP  75


> sp|K9N5R3|VEMP_MERS1 Envelope small membrane protein OS=Middle 
East respiratory syndrome-related coronavirus (isolate United 
Kingdom/H123990006/2012) OX=1263720 GN=E PE=1 SV=1
Length=82

 Score = 74.6 bits (182),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 38/75 (51%), Gaps = 4/75 (5%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M  FV E  G  IVN  +  +   + LLV +A LTA RLC  C    N  LV+P+ Y+Y+
Sbjct  1   MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYN  60

Query  61  RVKN----LNSSRVP  71
             ++       S+ P
Sbjct  61  TGRSVYVKFQDSKPP  75


> sp|P0DTC4|VEMP_SARS2 Envelope small membrane protein OS=Severe 
acute respiratory syndrome coronavirus 2 OX=2697049 GN=E PE=3 
SV=1
Length=75

 Score = 70.7 bits (172),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60

Query  61  RVKNLNSSRVPDLLV  75
           RVKNLNSSRVPDLLV
Sbjct  61  RVKNLNSSRVPDLLV  75


> sp|P59637|VEMP_CVHSA Envelope small membrane protein OS=Human 
SARS coronavirus OX=694009 GN=E PE=1 SV=1
Length=76

 Score = 66.5 bits (161),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q3I5J3|VEMP_BCRP3 Envelope small membrane protein OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=E PE=3 SV=1
Length=76

 Score = 66.5 bits (161),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q3LZW9|VEMP_BCHK3 Envelope small membrane protein OS=Bat coronavirus 
HKU3 OX=442736 GN=E PE=3 SV=1
Length=76

 Score = 66.5 bits (161),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 72/76 (95%), Positives = 73/76 (96%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q0Q473|VEMP_BC279 Envelope small membrane protein OS=Bat coronavirus 
279/2005 OX=389167 GN=E PE=3 SV=1
Length=76

 Score = 65.7 bits (159),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 71/76 (93%), Positives = 72/76 (95%), Gaps = 1/76 (1%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MYSFVSEETGTLIVNSVLLF AFVVFLLVTLAILTALRLCAYCCNIVNVSLVKP+ YVYS
Sbjct  1   MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS  60

Query  61  RVKNLNSSR-VPDLLV  75
           RVKNLNSS  VPDLLV
Sbjct  61  RVKNLNSSEGVPDLLV  76


> sp|Q0ZME5|VEMP_CVHN5 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N5) OX=443241 GN=E PE=3 SV=1
Length=82

 Score = 62.6 bits (151),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 20/61 (33%), Positives = 34/61 (56%), Gaps = 0/61 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +     L L+ V+FL+  +A+L  ++LC   C   N+ ++ PS YVY+R + L  
Sbjct  8   DTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYVYNRGRQLYK  67

Query  68  S  68
           S
Sbjct  68  S  68


> sp|Q14EA8|VEMP_CVHN2 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N2) OX=443240 GN=E PE=3 SV=1
Length=82

 Score = 62.6 bits (151),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 20/61 (33%), Positives = 34/61 (56%), Gaps = 0/61 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +     L L+ V+FL+  +A+L  ++LC   C   N+ ++ PS YVY+R + L  
Sbjct  8   DTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYVYNRGRQLYK  67

Query  68  S  68
           S
Sbjct  68  S  68


> sp|Q5MQC8|VEMP_CVHN1 Envelope small membrane protein OS=Human 
coronavirus HKU1 (isolate N1) OX=443239 GN=E PE=3 SV=1
Length=82

 Score = 53.8 bits (128),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 31/68 (46%), Gaps = 0/68 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M      +T   I   ++L L  ++ L+  +A L  ++LC   C   N  ++ PS YVY 
Sbjct  1   MVDLFFNDTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYVYK  60

Query  61  RVKNLNSS  68
           R   L  S
Sbjct  61  RGMQLYKS  68


> sp|P0C2Q9|VEMP_CVPIA Envelope small membrane protein OS=Porcine 
hemagglutinating encephalomyelitis virus (strain IAF-404) 
OX=230236 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q8|VEMP_CVP67 Envelope small membrane protein OS=Porcine 
hemagglutinating encephalomyelitis virus (strain 67N) OX=230237 
GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q7|VEMP_CVBQ Envelope small membrane protein OS=Bovine 
coronavirus (strain Quebec) OX=11133 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q6|VEMP_CVBON Envelope small membrane protein OS=Bovine 
coronavirus (strain Ontario) OX=231422 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q5|VEMP_CVBOK Envelope small membrane protein OS=Bovine 
coronavirus (strain OK-0514) OX=231432 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q4|VEMP_CVBLY Envelope small membrane protein OS=Bovine 
coronavirus (strain LY-138) OX=11131 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q3|VEMP_CVBLU Envelope small membrane protein OS=Bovine 
coronavirus (strain 98TXSF-110-LUN) OX=233264 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q2|VEMP_CVBLS Envelope small membrane protein OS=Bovine 
coronavirus (strain LSU-94LSS-051) OX=233261 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P15775|VEMP_CVBF Envelope small membrane protein OS=Bovine 
coronavirus (strain F15) OX=11129 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P0C2Q1|VEMP_CVBEN Envelope small membrane protein OS=Bovine 
coronavirus (strain 98TXSF-110-ENT) OX=233262 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P15779|VEMP_CVBM Envelope small membrane protein OS=Bovine 
coronavirus (strain Mebus) OX=11132 GN=E PE=3 SV=1
Length=84

 Score = 51.1 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++ ++V +A L   +LC   C + N   + PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLGLSPSIYVFNRGRQFYE  69


> sp|Q04854|VEMP_CVHOC Envelope small membrane protein OS=Human 
coronavirus OC43 OX=31631 GN=E PE=3 SV=1
Length=84

 Score = 50.7 bits (120),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 13/60 (22%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  8   ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNS  67
           +T   +   + +    ++  +V +A L   +LC   C + N  ++ PS YV++R +    
Sbjct  10  DTVWYVGQIIFIVAICLLVTIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYE  69


> sp|P06591|VEMP_CVMJH Envelope small membrane protein OS=Murine 
coronavirus (strain JHM) OX=11144 GN=E PE=3 SV=1
Length=88

 Score = 50.7 bits (120),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M++    +T   +   + +    ++  ++ +A L +++ C   C + N  L+ PS Y+Y+
Sbjct  1   MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTLLLSPSIYLYN  60

Query  61  RVKNLNS  67
           R K L  
Sbjct  61  RSKQLYK  67


> sp|Q9IKC8|VEMP_CVRSD Envelope small membrane protein OS=Rat coronavirus 
(strain 681) OX=33740 GN=E PE=3 SV=1
Length=88

 Score = 49.9 bits (118),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M++    +T   +   + +    ++  ++ +A L +++LC   C + N  L+ PS YVY+
Sbjct  1   MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTLLLSPSIYVYN  60

Query  61  RVKNLNS  67
           R K L  
Sbjct  61  RSKQLYK  67


> sp|P0C2R0|VEMP_CVMA5 Envelope small membrane protein OS=Murine 
coronavirus (strain A59) OX=11142 GN=E PE=1 SV=1
Length=83

 Score = 49.5 bits (117),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 16/67 (24%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M++    +T   +   + +F   ++  ++ +A L +++LC   C + N  ++ PS Y+Y 
Sbjct  1   MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD  60

Query  61  RVKNLNS  67
           R K L  
Sbjct  61  RSKQLYK  67


> sp|P29076|VEMP_CVMS Envelope small membrane protein OS=Murine 
coronavirus (strain S) OX=11145 GN=E PE=3 SV=1
Length=88

 Score = 49.1 bits (116),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 32/67 (48%), Gaps = 0/67 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           M++    +T   +   + +    ++  +  +A L +++LC   C + N  ++ PS Y+Y 
Sbjct  1   MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD  60

Query  61  RVKNLNS  67
           R K L  
Sbjct  61  RSKQLYK  67


> sp|A3EXG8|VEMP_BCHK9 Envelope small membrane protein OS=Bat coronavirus 
HKU9 OX=694006 GN=E PE=3 SV=1
Length=79

 Score = 28.7 bits (63),  Expect = 1.7, Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 0/64 (0%)

Query  1   MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS  60
           MY  V      LI N ++L +  ++ ++V  A+L  L+     C  V   + KP+  VY+
Sbjct  1   MYDIVGTNNSILIANVLVLIIICLLVVIVGCALLLILQFVFGVCGFVFKFVCKPTILVYN  60

Query  61  RVKN  64
           + +N
Sbjct  61  KFRN  64


> sp|P19741|VEMP_CVH22 Envelope small membrane protein OS=Human 
coronavirus 229E OX=11137 GN=E PE=3 SV=1
Length=77

 Score = 28.3 bits (62),  Expect = 2.4, Method: Composition-based stats.
 Identities = 16/60 (27%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  11  TLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRV  70
            L+VN +L  +  +V LLV + I+  ++LC  C    N ++  P   VY   ++      
Sbjct  10  ALVVNVLLWCVVLIVILLVCITIIKLIKLCFTCHMFCNRTVYGPIKNVYHIYQSYMHIDP  69


> sp|Q52PA5|VEMP_FIPV Envelope small membrane protein OS=Feline 
coronavirus (strain FIPV WSU-79/1146) OX=33734 GN=E PE=3 SV=1
Length=82

 Score = 27.6 bits (60),  Expect = 4.9, Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  12  LIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSR  69
           ++V+     L  ++ +L ++A+L  ++LC  CCN+    +V P+ + Y   K    ++
Sbjct  15  MVVSVFFWLLLIIILILFSIALLNVIKLCMVCCNLGKTIIVLPARHAYDAYKTFMQTK  72


> sp|Q10426|RIK1_SCHPO Chromatin modification-related protein rik1 
OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 
GN=rik1 PE=1 SV=2
Length=1040

 Score = 28.7 bits (63),  Expect = 5.0, Method: Composition-based stats.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 0/44 (0%)

Query  30  TLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDL  73
            L +L AL++  Y C+ V+      S  ++S VK++   R P L
Sbjct  27  CLVLLQALKINIYLCSEVHGLQFFTSIPLFSTVKHIRPYRPPGL  70



Lambda      K        H        a         alpha
   0.335    0.149    0.446    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0457    0.140     1.90     42.6     43.6 

Effective search space used: 5130021526


  Database: uniprot_sprot.fasta
    Posted date:  Aug 19, 2020  9:15 PM
  Number of letters in database: 202,799,066
  Number of sequences in database:  563,082



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40