PSIBLAST 2.2.27+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           563,082 sequences; 202,799,066 total letters

Results from round 1


Query= YP_009725311.1 2'-O-ribose methyltransferase [Severe acute
respiratory syndrome coronavirus 2]

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ...   627    0.0   
  sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co...   598    0.0   
  sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir...   597    0.0   
  sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir...   595    0.0   
  sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir...   592    0.0   
  sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East r...   434    3e-136
  sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir...   428    3e-134
  sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir...   427    3e-134
  sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir...   426    1e-133
  sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona...   413    5e-129
  sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona...   413    5e-129
  sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav...   412    1e-128
  sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav...   410    3e-128
  sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir...   404    5e-126
  sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav...   398    5e-124
  sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona...   397    1e-123
  sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona...   395    5e-123
  sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav...   395    7e-123
  sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav...   393    4e-122
  sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav...   393    5e-122
  sp|P18457|R1AB_CVPFS Replicase polyprotein 1ab (Fragment) OS=Po...   355    1e-117
  sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav...   365    2e-112
  sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans...   356    2e-109
  sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav...   355    5e-109
  sp|P12723|R1AB_IBVK Replicase polyprotein 1ab (Fragment) OS=Avi...   328    2e-107
  sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir...   345    1e-105
  sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide...   341    5e-104
  sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav...   340    9e-104
  sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio...   328    2e-99 
  sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti...   326    6e-99 
  sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio...   326    6e-99 
  sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav...   275    3e-81 
  sp|P36697|R1AB_CVCAI Replicase polyprotein 1ab (Fragment) OS=Ca...   183    3e-55 
  sp|Q04158|R1AB_CVPR8 Replicase polyprotein 1ab (Fragment) OS=Po...   125    1e-33 
  sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream v...  71.6    2e-12 
  sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=...  69.7    7e-12 
  sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 ...  65.1    3e-10 
  sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransfer...  36.6    0.16  
  sp|C4K7E6|KHSE_HAMD5 Homoserine kinase OS=Hamiltonella defensa ...  32.0    5.7   


> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score =  627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6799  SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  6858

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6859  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6918

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL
Sbjct  6919  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  6978

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS
Sbjct  6979  YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  7038

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
Sbjct  7039  SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  7096


> sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS 
coronavirus OX=694009 GN=rep PE=1 SV=1
Length=7073

 Score =  598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/298 (93%), Positives = 292/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6776  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6835

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6836  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6895

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDP+TK+VTKENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADL
Sbjct  6896  ANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADL  6955

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6956  YKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7015

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7016  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7073


> sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=rep PE=3 SV=1
Length=7071

 Score =  597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/298 (93%), Positives = 291/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6774  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6833

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6834  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6893

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLI+SDMYDPK K+VTKENDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6894  ANKWDLIVSDMYDPKAKHVTKENDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6953

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6954  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7013

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7014  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7071


> sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU3 OX=442736 GN=rep PE=3 SV=1
Length=7067

 Score =  595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/298 (93%), Positives = 291/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6770  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6829

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6830  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6889

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTK+V K+NDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6890  ANKWDLIISDMYDPKTKHVLKDNDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6949

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6950  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7009

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7010  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7067


> sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus 
279/2005 OX=389167 GN=rep PE=3 SV=1
Length=7079

 Score =  592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/298 (93%), Positives = 289/298 (97%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6782  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6841

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTG LLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6842  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGALLVDSDLNDFVSDADSTLIGDCATVHT  6901

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTK+VTKENDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6902  ANKWDLIISDMYDPKTKHVTKENDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6961

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGK REQIDGY MHANYIFWRNTNPIQLS
Sbjct  6962  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKLREQIDGYTMHANYIFWRNTNPIQLS  7021

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL  GRLIIRENNRVV+SSD+LVNN
Sbjct  7022  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLENGRLIIRENNRVVVSSDILVNN  7079


> sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East 
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=rep PE=1 SV=1
Length=7078

 Score =  434 bits (1115),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +S  W+PG AMP+L+K+Q + LE+C+L NY  S  +P+G+ MN+AKY QLCQYLNT TLA
Sbjct  6776  ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA  6835

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAGSDKG+APGT+VLRQWLPT  +++D+DLN+FVSDAD TL GDC TV  
Sbjct  6836  VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV  6895

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TKNVT  N+SK  FFTY+C  I   LALGGSVAIKITEHSW+ +L
Sbjct  6896  GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL  6955

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y+LMG FAWWT F TN NASSSE FL+G NYLG  +E IDG  MHANYIFWRN+ P+ LS
Sbjct  6956  YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS  7015

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN
Sbjct  7016  TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLVN  7072


> sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU4 OX=694007 GN=rep PE=1 SV=1
Length=7119

 Score =  428 bits (1100),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 244/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG+ MP+L+K+Q+M LE C L NY  S  +P G+ MNVAKY QLCQYLNT TLA
Sbjct  6818  ATNDWKPGLTMPSLFKVQQMNLEPCLLANYKQSIPMPNGVHMNVAKYMQLCQYLNTCTLA  6877

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAG +KGVAPGT+VLRQWLP   +L+D+DLN+FVSDAD T+ GDC TVH 
Sbjct  6878  VPANMRVIHFGAGCEKGVAPGTSVLRQWLPLDAVLIDNDLNEFVSDADITIFGDCVTVHV  6937

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TK V + N +K  FF Y+C FI+  LALGGSVAIKITEHSW+ADL
Sbjct  6938  GQQVDLLISDMYDPCTKAVGEVNQTKALFFVYLCNFIKNNLALGGSVAIKITEHSWSADL  6997

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YK+MG FA+WT F TN NASSSE FLIG N+LG+ +E+IDG VMHANYIFWRN+ P+ LS
Sbjct  6998  YKIMGRFAYWTVFCTNANASSSEGFLIGINFLGELKEEIDGNVMHANYIFWRNSTPMNLS  7057

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN
Sbjct  7058  TYSLFDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLNVSTDVLVN  7114


> sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus 
133/2005 OX=389230 GN=rep PE=3 SV=1
Length=7126

 Score =  427 bits (1099),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 244/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG+ MP+L+K+Q+M LE C L NY  S  +P G+ MNVAKY QLCQYLNT TLA
Sbjct  6825  ATNDWKPGLTMPSLFKVQQMNLEPCLLANYKQSIPMPNGVHMNVAKYMQLCQYLNTCTLA  6884

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAG +KGVAPGT+VLRQWLP   +L+D+DLN+FVSDAD T+ GDC TVH 
Sbjct  6885  VPANMRVIHFGAGCEKGVAPGTSVLRQWLPLDAVLIDNDLNEFVSDADITIFGDCVTVHV  6944

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TK V + N +K  FF Y+C FI+  LALGGSVAIKITEHSW+ADL
Sbjct  6945  GQQVDLLISDMYDPCTKAVGEVNQTKALFFVYLCNFIKNNLALGGSVAIKITEHSWSADL  7004

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YK+MG FA+WT F TN NASSSE FLIG N+LG+ +E+IDG VMHANYIFWRN+ P+ LS
Sbjct  7005  YKIMGRFAYWTVFCTNANASSSEGFLIGINFLGELKEEIDGNVMHANYIFWRNSTPMNLS  7064

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN
Sbjct  7065  TYSLFDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLNVSTDVLVN  7121


> sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU5 OX=694008 GN=rep PE=3 SV=1
Length=7182

 Score =  426 bits (1095),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 242/293 (83%), Gaps = 0/293 (0%)

Query  5     WQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYN  64
             W+PG+AMP+L+K+Q   LE C L NY  S  +P+G+ MN+AKY QLCQYLNT T+AVP N
Sbjct  6879  WKPGLAMPSLFKVQNSNLEPCMLPNYKQSIPMPQGVHMNIAKYMQLCQYLNTCTIAVPAN  6938

Query  65    MRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKW  124
             MRV+HFGAGSDKGVAPG++VLRQWLPT  +L+D+DLN++VSDAD TL GDC TV    + 
Sbjct  6939  MRVMHFGAGSDKGVAPGSSVLRQWLPTDAILIDNDLNEYVSDADITLFGDCVTVRVGQQV  6998

Query  125   DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
             DL+ISDMYDP TK V + N++K  FF Y+C FI+  LALGGSVAIKITEHSW+A+LY+LM
Sbjct  6999  DLLISDMYDPSTKVVGETNEAKALFFVYLCNFIKNNLALGGSVAIKITEHSWSAELYELM  7058

Query  185   GHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSL  244
             G FAWWT F TN NASSSE FLIG NYLG+ +E IDG VMHANYIFWRNT  + LS+YSL
Sbjct  7059  GRFAWWTVFCTNANASSSEGFLIGINYLGELKEVIDGNVMHANYIFWRNTTLMNLSTYSL  7118

Query  245   FDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             FD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+LIIR+N+ + +S+DVLVN
Sbjct  7119  FDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLIIRDNDTLSVSTDVLVN  7171


> sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1
Length=7094

 Score =  413 bits (1061),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D LVN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSLVN  7092


> sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1
Length=7094

 Score =  413 bits (1061),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D LVN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSLVN  7092


> sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=rep PE=3 SV=1
Length=7094

 Score =  412 bits (1058),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D +VN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSMVN  7092


> sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus 
OC43 OX=31631 GN=rep PE=3 SV=1
Length=7095

 Score =  410 bits (1055),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 233/297 (78%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6797  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6856

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6857  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6916

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6917  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6976

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYL KP+ +IDG VMHANY+FWRN+      
Sbjct  6977  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLCKPKVEIDGNVMHANYLFWRNSTVWNGG  7036

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L+IR+ N+ V   D LVN
Sbjct  7037  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLIRDTNKEVFVGDSLVN  7093


> sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU9 OX=694006 GN=rep PE=1 SV=1
Length=6930

 Score =  404 bits (1038),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 227/284 (80%), Gaps = 1/284 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             + Q W+PG +MP LYK+Q  +LE C L NYG +A LP G +MNVAKYTQLCQYLNT +LA
Sbjct  6634  AKQDWKPGYSMPALYKVQNAVLEPCLLHNYGQAARLPSGTLMNVAKYTQLCQYLNTCSLA  6693

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP  MRV+HFGAGSDKGV PGTAVL+QWLP    LVD+DL    SDADST +G C T  +
Sbjct  6694  VPAKMRVMHFGAGSDKGVCPGTAVLKQWLPADAYLVDNDLCYCASDADSTYVGSCETFFS  6753

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
              NKWD I SDMYD +TKN + +N SKEGFFTY+ GFI+ KLALGGS+AIKITEHSW+ADL
Sbjct  6754  VNKWDFIFSDMYDARTKNTSGDNTSKEGFFTYLTGFIRSKLALGGSIAIKITEHSWSADL  6813

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y +MGHF WWT F T+VN+SSSEAFLIG NY+G     +DG+ MHANY+FWRN+  +QLS
Sbjct  6814  YAIMGHFNWWTCFCTSVNSSSSEAFLIGVNYIGV-GALLDGWQMHANYVFWRNSTVMQLS  6872

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRE  284
             SYSL+D+ +FPL+L+GT VMSLKE Q+N+++L+L+  GRLI+R+
Sbjct  6873  SYSLYDLQRFPLRLKGTPVMSLKEDQLNELVLNLIRAGRLIVRD  6916


> sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain 2) OX=76344 GN=rep PE=3 SV=1
Length=7124

 Score =  398 bits (1023),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 190/293 (65%), Positives = 229/293 (78%), Gaps = 0/293 (0%)

Query  5     WQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYN  64
             W+PG  MP LYK     LE+ +L NYG   TLP G +MNVAKYTQLCQYLNT TLAVP N
Sbjct  6830  WKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCLMNVAKYTQLCQYLNTTTLAVPAN  6889

Query  65    MRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKW  124
             MRV+H GAGSDK VAPG+AVLRQWLP G++LVD+D+N FVSD+ ++  G+C T+  A +W
Sbjct  6890  MRVLHLGAGSDKDVAPGSAVLRQWLPAGSILVDNDINPFVSDSVASYYGNCITLPIACQW  6949

Query  125   DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
             DLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+LY LM
Sbjct  6950  DLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAELYSLM  7009

Query  185   GHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSL  244
             G FA+WT F TNVNASSSE FLIG N+L + R +IDG  MHANY+FWRN+      +YSL
Sbjct  7010  GKFAFWTIFCTNVNASSSEGFLIGINWLNRTRTEIDGKTMHANYLFWRNSTMWNGGAYSL  7069

Query  245   FDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             FDMSKFPLK+ GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7070  FDMSKFPLKVAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7122


> sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain A59) OX=11142 GN=rep PE=1 SV=1
Length=7176

 Score =  397 bits (1021),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 228/293 (78%), Gaps = 0/293 (0%)

Query  5     WQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYN  64
             W+PG  MP LYK     LE+ +L NYG   TLP G MMNVAKYTQLCQYL+T TLAVP N
Sbjct  6882  WKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPAN  6941

Query  65    MRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKW  124
             MRV+H GAGSDKGVAPG+AVLRQWLP G++LVD+D+N FVSD+ ++  G+C T+    +W
Sbjct  6942  MRVLHLGAGSDKGVAPGSAVLRQWLPAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQW  7001

Query  125   DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
             DLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+LY LM
Sbjct  7002  DLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAELYSLM  7061

Query  185   GHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSL  244
             G FA+WT F TNVNASSSE FLIG N+L K R +IDG  MHANY+FWRN+      +YSL
Sbjct  7062  GKFAFWTIFCTNVNASSSEGFLIGINWLNKTRTEIDGKTMHANYLFWRNSTMWNGGAYSL  7121

Query  245   FDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             FDMSKFPLK  GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7122  FDMSKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7174


> sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus 
(strain JHM) OX=11144 GN=rep PE=1 SV=1
Length=7180

 Score =  395 bits (1016),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 229/293 (78%), Gaps = 0/293 (0%)

Query  5     WQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYN  64
             W+PG  MP LYK     +E+ +L NYG   TLP G MMNVAKYTQLCQYL+T TLAVP N
Sbjct  6886  WKPGYVMPVLYKYLESPMERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPAN  6945

Query  65    MRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKW  124
             MRV+H GAGSDKGVAPG+AVLRQWLP+G++LVD+D+N FVSD+ ++  G+C T+    +W
Sbjct  6946  MRVLHLGAGSDKGVAPGSAVLRQWLPSGSILVDNDMNPFVSDSVASYYGNCITLPFDCQW  7005

Query  125   DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
             DLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+LY LM
Sbjct  7006  DLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAELYSLM  7065

Query  185   GHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSL  244
             G FA+WT F TNVNASSSE FLIG N+L + R +IDG  MHANY+FWRN+      +YSL
Sbjct  7066  GKFAFWTIFCTNVNASSSEGFLIGINWLNRTRNEIDGKTMHANYLFWRNSTMWNGGAYSL  7125

Query  245   FDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             FDM+KFPLK  GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7126  FDMTKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7178


> sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1
Length=7152

 Score =  395 bits (1015),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 229/297 (77%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG +  LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6854  ATSDWKPGYSMPVLYKYLNVPLERVSLWNYGKAINLPTGCMMNVAKYTQLCQYLNTTTLA  6913

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6914  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  6973

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  6974  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICYLIRDKLSLGGSVAIKITEFSWNADL  7033

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM +FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7034  YKLMSYFAFWTVFCTNVNASSSEGFLIGINYLGKSCFEIDGNVMHANYLFWRNSTTWNGG  7093

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDMSKF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN
Sbjct  7094  AYSLFDMSKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVN  7150


> sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1
Length=7132

 Score =  393 bits (1009),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 227/297 (76%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG    LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6834  ATNDWKPGYSMPVLYKYLNVPLERVSLWNYGKPINLPTGCMMNVAKYTQLCQYLNTTTLA  6893

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6894  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  6953

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  6954  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICHLIRDKLSLGGSVAIKITEFSWNADL  7013

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM  FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7014  YKLMSCFAFWTVFCTNVNASSSEGFLIGINYLGKSSFEIDGNVMHANYLFWRNSTTWNGG  7073

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN
Sbjct  7074  AYSLFDMTKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVN  7130


> sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1
Length=7182

 Score =  393 bits (1009),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 227/297 (76%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG    LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6884  ATNDWKPGYSMPVLYKYLNVPLERVSLWNYGKPINLPTGCMMNVAKYTQLCQYLNTTTLA  6943

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6944  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  7003

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  7004  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICHLIRDKLSLGGSVAIKITEFSWNADL  7063

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM  FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7064  YKLMSCFAFWTVFCTNVNASSSEGFLIGINYLGKSSFEIDGNVMHANYLFWRNSTTWNGG  7123

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN
Sbjct  7124  AYSLFDMTKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVN  7180


> sp|P18457|R1AB_CVPFS Replicase polyprotein 1ab (Fragment) OS=Porcine 
transmissible gastroenteritis coronavirus (strain FS772/70) 
OX=11150 GN=rep PE=3 SV=1
Length=533

 Score =  355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 218/298 (73%), Gaps = 2/298 (1%)

Query  2    SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
            S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT TL V
Sbjct  234  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCV  293

Query  62   PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
            P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  294  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  353

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
            +K+DL++SD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGSVAIKITE SWN DLY
Sbjct  354  DKFDLLVSDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSVAIKITEFSWNKDLY  413

Query  182  KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
            +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  414  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  473

Query  240  SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
            S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   +  VN
Sbjct  474  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVN  531


> sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus 
NL63 OX=277944 GN=rep PE=1 SV=1
Length=6729

 Score =  365 bits (937),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/288 (59%), Positives = 221/288 (77%), Gaps = 2/288 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G AMP +YK+QRM LE C+L NYG    LP GIM+NV KYTQLCQYLN+ T+ V
Sbjct  6430  SAEWKCGYAMPQIYKLQRMCLEPCNLYNYGAGIKLPSGIMLNVVKYTQLCQYLNSTTMCV  6489

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+NMRV+H+GAGSDKGVAPGT VL++WLP   +++D+D+ND+VSDAD ++ GDCATV+  
Sbjct  6490  PHNMRVLHYGAGSDKGVAPGTTVLKRWLPPDAIIIDNDINDYVSDADFSITGDCATVYLE  6549

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD + K    EN SK+GFFTY+ G I++KLA+GGSVAIKITE+SWN  LY
Sbjct  6550  DKFDLLISDMYDGRIKFCDGENVSKDGFFTYLNGVIREKLAIGGSVAIKITEYSWNKYLY  6609

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  FA+WT F T+VN SSSEAFLIG NYLG   +   I G  +HANYIFWRN+  + L
Sbjct  6610  ELIQRFAFWTLFCTSVNTSSSEAFLIGINYLGDFIQGPFIAGNTVHANYIFWRNSTIMSL  6669

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNR  287
             S  S+ D+SKF  K + T V++LK+  +NDM+LSL+  GRL++R N R
Sbjct  6670  SYNSVLDLSKFECKHKATVVVTLKDSDVNDMVLSLIKSGRLLLRNNGR  6717


> sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=rep PE=1 SV=1
Length=6684

 Score =  356 bits (914),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 218/298 (73%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT TL V
Sbjct  6385  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCV  6444

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  6445  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  6504

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL++SD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGSVAIKITE SWN DLY
Sbjct  6505  DKFDLLVSDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSVAIKITEFSWNKDLY  6564

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  6565  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  6624

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   +  VN
Sbjct  6625  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVN  6682


> sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus 
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2
Length=6709

 Score =  355 bits (911),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 218/298 (73%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT T+ V
Sbjct  6410  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVRLPDGITTNVVKYTQLCQYLNTTTVCV  6469

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  6470  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  6529

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGS AIKITE SWN DLY
Sbjct  6530  DKFDLLISDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSAAIKITEFSWNKDLY  6589

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  6590  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  6649

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   + LVN
Sbjct  6650  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVVGLLRKGKLLIRNNGKLLNFGNHLVN  6707


> sp|P12723|R1AB_IBVK Replicase polyprotein 1ab (Fragment) OS=Avian 
infectious bronchitis virus (strain KB8523) OX=11126 GN=rep 
PE=3 SV=1
Length=521

 Score =  328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 211/298 (71%), Gaps = 5/298 (2%)

Query  4    AWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPY  63
            AW  G  MP LYK+Q  ++E C++ NYG   TLP GIMMNVAKYTQLCQYL+  T+ VP+
Sbjct  221  AWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGIMMNVAKYTQLCQYLSKTTVCVPH  280

Query  64   NMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK  123
            NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC    T +K
Sbjct  281  NMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDTDIVDYVSDAHVSVLSDCNKYKTEHK  340

Query  124  WDLIISDMY---DPKTKN-VTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
            +DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+  
Sbjct  341  FDLVISDMYTDNDSKRKHGGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKLTETSWHES  400

Query  180  LYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP-REQIDGYVMHANYIFWRNTNPIQ  238
            LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +Q
Sbjct  401  LYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASVKVKVSGKTLHANYIFWRNCNYLQ  460

Query  239  LSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
             S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  461  TSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  518


> sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus 
512/2005 OX=693999 GN=rep PE=3 SV=1
Length=6793

 Score =  345 bits (885),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 223/299 (75%), Gaps = 2/299 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G +MP++YK+QRM LE C+L NYG    LP GIM NV KYTQLCQYLN+ T+ V
Sbjct  6493  SAEWKCGYSMPSIYKIQRMCLEPCNLYNYGSGLKLPDGIMFNVVKYTQLCQYLNSTTMCV  6552

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P++MRV+H GAGSDKGVAPGTAVLR+WLP   ++VD+D+ND+VSDAD +  GDCA+++  
Sbjct  6553  PHHMRVLHLGAGSDKGVAPGTAVLRRWLPLDAVIVDNDVNDYVSDADFSYTGDCASMYLT  6612

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD +TK+   +N SKEGFF YI G I +KLALGG+VAIKITE SWN  LY
Sbjct  6613  DKFDLVISDMYDGRTKSCDGDNVSKEGFFPYINGVITEKLALGGTVAIKITEFSWNKKLY  6672

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLG--KPREQIDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSEAFLIG ++LG       IDG +MHANYIFWRN+  + +
Sbjct  6673  ELIQKFEYWTLFCTSVNTSSSEAFLIGVHFLGDFSTNAIIDGNIMHANYIFWRNSTIMTM  6732

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             S  S+ D+SKF  K + T V++LK+  + D++L LL  G+L+IR N  V   S+ LVN+
Sbjct  6733  SYNSVLDLSKFSCKHKATVVVNLKDSSVTDLVLGLLKNGKLLIRNNGVVCGFSNHLVNS  6791


> sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1
Length=6781

 Score =  341 bits (874),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 222/298 (74%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             +  W+ G +MP++YK+QRM LE C+L NYG    LP GIM NV KYTQLCQYLN+ T+ V
Sbjct  6481  ASEWKCGYSMPSIYKIQRMCLEPCNLYNYGAGVKLPDGIMFNVVKYTQLCQYLNSTTMCV  6540

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P++MRV+H GAGSDKGVAPGTAVLR+WLP   ++VD+D  D+VSDAD ++ GDC+T++ +
Sbjct  6541  PHHMRVLHLGAGSDKGVAPGTAVLRRWLPLDAIIVDNDSVDYVSDADYSVTGDCSTLYLS  6600

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD K K+   EN SKEGFF YI G I +KLALGG+VAIK+TE SWN  LY
Sbjct  6601  DKFDLVISDMYDGKIKSCDGENVSKEGFFPYINGVITEKLALGGTVAIKVTEFSWNKKLY  6660

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLG--KPREQIDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSEAFLIG +YLG       IDG  MHANYIFWRN+  + +
Sbjct  6661  ELIQKFEYWTMFCTSVNTSSSEAFLIGVHYLGDFASGAVIDGNTMHANYIFWRNSTIMTM  6720

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D+SKF  K + T V++LK+  I+D++L LL  G+L++R N+ +   S+ LVN
Sbjct  6721  SYNSVLDLSKFNCKHKATVVVNLKDSSISDVVLGLLKNGKLLVRNNDAICGFSNHLVN  6778


> sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 
229E OX=11137 GN=rep PE=1 SV=1
Length=6758

 Score =  340 bits (872),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 225/298 (76%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G +MP +YK QRM LE C+L NYG    LP GIM NV KYTQLCQY N+ TL V
Sbjct  6459  SAEWKCGYSMPGIYKTQRMCLEPCNLYNYGAGLKLPSGIMFNVVKYTQLCQYFNSTTLCV  6518

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+NMRV+H GAGSD GVAPGTAVL++WLP   ++VD+D+ D+VSDAD ++ GDCATV+  
Sbjct  6519  PHNMRVLHLGAGSDYGVAPGTAVLKRWLPHDAIVVDNDVVDYVSDADFSVTGDCATVYLE  6578

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD +TK +  EN SKEGFFTYI GFI +KLA+GGS+AIK+TE+SWN  LY
Sbjct  6579  DKFDLLISDMYDGRTKAIDGENVSKEGFFTYINGFICEKLAIGGSIAIKVTEYSWNKKLY  6638

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F++WT F T+VN SSSEAF++G NYLG   +   IDG ++HANY+FWRN+  + L
Sbjct  6639  ELVQRFSFWTMFCTSVNTSSSEAFVVGINYLGDFAQGPFIDGNIIHANYVFWRNSTVMSL  6698

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D+SKF  K + T V+ LK+  IN+M+LSL+  G+L++R N + +  S+ LV+
Sbjct  6699  SYNSVLDLSKFNCKHKATVVVQLKDSDINEMVLSLVRSGKLLVRGNGKCLSFSNHLVS  6756


> sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 
SV=1
Length=6629

 Score =  328 bits (840),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 212/298 (71%), Gaps = 5/298 (2%)

Query  4     AWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPY  63
             AW  G  MP LYK+Q  ++E C++ NYG   TLP GI+MNVAKYTQLCQYL+  T+ VP+
Sbjct  6329  AWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGILMNVAKYTQLCQYLSKTTICVPH  6388

Query  64    NMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK  123
             NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC   +T +K
Sbjct  6389  NMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYNTEHK  6448

Query  124   WDLIISDMY---DPKTKNV-TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
             +DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+  
Sbjct  6449  FDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHEV  6508

Query  180   LYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPRE-QIDGYVMHANYIFWRNTNPIQ  238
             LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +Q
Sbjct  6509  LYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASEKVKVSGKTLHANYIFWRNCNYLQ  6568

Query  239   LSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
              S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6569  TSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6626


> sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep 
PE=3 SV=1
Length=6629

 Score =  326 bits (836),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 211/298 (71%), Gaps = 5/298 (2%)

Query  4     AWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPY  63
             AW  G  MP LYK+Q  ++E C++ NYG   TLP GI+MNVAKYTQLCQYL   T+ VP+
Sbjct  6329  AWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGILMNVAKYTQLCQYLLKTTICVPH  6388

Query  64    NMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK  123
             NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC   +T +K
Sbjct  6389  NMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYNTEHK  6448

Query  124   WDLIISDMY---DPKTKNV-TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
             +DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+  
Sbjct  6449  FDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHEV  6508

Query  180   LYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPRE-QIDGYVMHANYIFWRNTNPIQ  238
             LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +Q
Sbjct  6509  LYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASEKVKVSGKTLHANYIFWRNCNYLQ  6568

Query  239   LSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
              S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6569  TSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6626


> sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1
Length=6631

 Score =  326 bits (836),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 210/298 (70%), Gaps = 5/298 (2%)

Query  4     AWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPY  63
             AW  G  MP LYK+Q  ++E C++ NYG    LP GIMMNVAKYTQLCQYL+  T+ VP+
Sbjct  6331  AWTCGYNMPELYKVQNCVMEPCNIPNYGVGIALPSGIMMNVAKYTQLCQYLSKTTMCVPH  6390

Query  64    NMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK  123
             NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC    T +K
Sbjct  6391  NMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYKTEHK  6450

Query  124   WDLIISDMY---DPKTKNV-TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
             +DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+  
Sbjct  6451  FDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHEV  6510

Query  180   LYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPRE-QIDGYVMHANYIFWRNTNPIQ  238
             LY +    AWWT F T VNASSSEAFL+G NYLG   + ++ G  +HANYIFWRN N +Q
Sbjct  6511  LYDIAQDCAWWTMFCTAVNASSSEAFLVGVNYLGASEKVKVSGKTLHANYIFWRNCNYLQ  6570

Query  239   LSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
              S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6571  TSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6628


> sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=rep PE=3 SV=1
Length=7059

 Score =  275 bits (703),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 168/241 (70%), Gaps = 16/241 (7%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAV----------LRQWLPTGTLLVDSDLNDFVSDADST  110
             VP N RV+H GAGS+KGVAPG+AV          LRQWLP GT+LV +DL  FVSD+ +T
Sbjct  6856  VPVNTRVLHLGAGSEKGVAPGSAVLRQWLPAGTILRQWLPAGTILVHNDLYPFVSDSVAT  6915

Query  111   LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYI-CGFIQQKLALGGSVAI  169
               GDC T+    +WDLIISDMYD     +  +        +YI C  I+ KLALGGSVAI
Sbjct  6916  YFGDCITLPFDCQWDLIISDMYD-----LLLDIGVHVVRCSYIHCHMIRDKLALGGSVAI  6970

Query  170   KITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYI  229
             KITE SWNA+LYKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHA   
Sbjct  6971  KITEFSWNAELYKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHAIIC  7030

Query  230   F  230
             F
Sbjct  7031  F  7031


> sp|P36697|R1AB_CVCAI Replicase polyprotein 1ab (Fragment) OS=Canine 
coronavirus (strain Insavc-1) OX=36391 GN=rep PE=4 SV=1
Length=168

 Score =  183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 2/166 (1%)

Query  134  PKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAF  193
            P TK++  EN SK+GFFTY+ GFI++KL+LGGS AIKITE SWN DLY+L+  F +WT F
Sbjct  1    PNTKSIDGENTSKDGFFTYVNGFIKEKLSLGGSAAIKITEFSWNKDLYELIQRFEYWTVF  60

Query  194  VTNVNASSSEAFLIGCNYLGK--PREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFP  251
             T+VN SSSE FLIG NYLG    R  +DG +MHANYIFWRN+  + LS  S+ D  KF 
Sbjct  61   CTSVNTSSSEGFLIGVNYLGPYCDRAIVDGNIMHANYIFWRNSTIMALSHNSVLDTPKFK  120

Query  252  LKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +     +++LKE ++N+M++ LL KG+L+IR N +++   + LVN
Sbjct  121  CRCNNALIVNLKEKELNEMVIGLLKKGKLLIRNNGKLLNFGNHLVN  166


> sp|Q04158|R1AB_CVPR8 Replicase polyprotein 1ab (Fragment) OS=Porcine 
respiratory coronavirus (strain 86/137004 / isolate 
British) OX=33736 GN=rep PE=4 SV=1
Length=131

 Score =  125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 87/129 (67%), Gaps = 2/129 (2%)

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANY  228
            ITE SWN  LY+L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANY
Sbjct  1    ITEFSWNKYLYELIQRFEYWTVFCTSVNTSSSEGFLIGVNYLGPYCDKAIVDGNIMHANY  60

Query  229  IFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRV  288
            IFWRN+  + LS  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N ++
Sbjct  61   IFWRNSTIMALSHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKL  120

Query  289  VISSDVLVN  297
            +   +  +N
Sbjct  121  LNFGNHFIN  129


> sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream 
virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 
GN=rep PE=1 SV=1
Length=6872

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 80/174 (46%), Gaps = 25/174 (14%)

Query  42    MNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN  101
             +N+ KY Q+C  L  + L +P    + H G   +K  +PG  VLRQ+     L    DL 
Sbjct  6650  INIQKYDQMCD-LFAIDLKIPVKGHIHHLGNAGNK-YSPGDVVLRQYFDQAHL-TSYDLR  6706

Query  102   DFVSDADSTLIGDCATVHTANKWD--LIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQ  159
             + VSD           +H  ++W    I+SD+Y P T            F +    ++Q 
Sbjct  6707  EVVSD--------IPVLHPNDEWKAHFILSDVYAPDT-----------DFTSLALEYMQN  6747

Query  160   KLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLG  213
              L LGGS+  K+TE S    + +++ +F  W A    VN SSSE FL    Y G
Sbjct  6748  HLRLGGSIMWKMTETSI-LQVNEIVKYFGSWKAVTFAVNYSSSETFLFCAGYTG  6800


> sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11156 
GN=rep PE=1 SV=1
Length=6857

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 24/184 (13%)

Query  26    DLQNYGDSAT-LPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAV  84
             DL+NYG + T +P+ +  N AKYTQ+C ++    + V  N  V H GA    G +PG  V
Sbjct  6614  DLKNYGQNPTFMPQPV--NFAKYTQICTFIQD-HVKVARNALVWHLGAAGVDGCSPGDIV  6670

Query  85    LRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKEND  144
             L  +     L+   D+ D+     STL+ D  +     + +LI+SD+Y+  + NV++  D
Sbjct  6671  LSSFF-KECLVYSWDIKDY-----STLL-DKHSYDCNFRPNLIVSDIYN-VSSNVSEVLD  6722

Query  145   SKEGFFTYICGFIQQKLALGGSVAIKITEHSW-NADLYKLMGHFAWWTAFVTNVNASSSE  203
                            +LALGG++  K TE S  +  L +   +F+    F   VN SSSE
Sbjct  6723  D-----------CVHRLALGGTIVFKTTESSRPDIQLSQFTKYFSAVQFFTAGVNTSSSE  6771

Query  204   AFLI  207
              F++
Sbjct  6772  VFVV  6775


> sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 
1 OX=360393 GN=rep PE=2 SV=1
Length=6733

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 91/188 (48%), Gaps = 32/188 (17%)

Query  26    DLQNYG-DSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAV  84
             DL+NYG D   +P+ +  N AKYTQ+C ++    + V  N  + H GA    G +PG  V
Sbjct  6490  DLKNYGQDPQFMPQPV--NFAKYTQICTFIQE-HVKVARNSLIWHVGAAGIDGCSPGDIV  6546

Query  85    LRQWLPTGTLLVDSDLNDFVSDADSTLIG----DCATVHTANKWDLIISDMYDPKTKNVT  140
             L  +     L+   D+ D+      TL+     DC       + +LI+SD+Y+  + NV+
Sbjct  6547  LSSFF-KECLVYSWDVKDY-----DTLLEKHNYDCNF-----RPNLIVSDVYN-VSSNVS  6594

Query  141   KENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSW-NADLYKLMGHFAWWTAFVTNVNA  199
             +  +               +LALGG++  K TE S  +  L K+  +FA    F   VN 
Sbjct  6595  EVLED-----------CVHRLALGGTIIFKTTESSRPDIQLSKVTKYFAAVHFFTAGVNT  6643

Query  200   SSSEAFLI  207
             SSSE F++
Sbjct  6644  SSSEVFVV  6651


> sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransferase 
E OS=Treponema denticola (strain ATCC 35405 / CIP 103919 
/ DSM 14222) OX=243275 GN=rlmE PE=3 SV=1
Length=199

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 60/156 (38%), Gaps = 20/156 (13%)

Query  75   DKGVAPGT---AVLR-----------QWLPTGTLLVDSDLNDFVSDA-DSTLIGDCATVH  119
            D G APG+    VLR              P  + + D  LN F  D  D  +I    +V 
Sbjct  47   DLGAAPGSWTVYVLRFLNKEGRVTAVDLKPLDSSVYDERLNFFQGDMFDKGII---KSVK  103

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS-WNA  178
                +D +I D     T N T +     G       + Q++L  GGS  +KI +      
Sbjct  104  ELGPYDAVICDAAPATTGNKTVDTARSSGLVELALYYAQEQLKQGGSFVVKIFQGGDQQI  163

Query  179  DLYKLMGHFAWWTAFVTNVNASSS-EAFLIGCNYLG  213
             L  L   F    AF      SSS E +LIG ++ G
Sbjct  164  HLNNLRKCFKTARAFKPEACRSSSFETYLIGLDFKG  199


> sp|C4K7E6|KHSE_HAMD5 Homoserine kinase OS=Hamiltonella defensa 
subsp. Acyrthosiphon pisum (strain 5AT) OX=572265 GN=thrB 
PE=3 SV=1
Length=309

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 0/40 (0%)

Query  104  VSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKEN  143
            +S  D TL+GDC ++  A ++DL I   +  K     K+N
Sbjct  24   ISPIDGTLLGDCLSIAPAEQFDLEIKGSFSDKLPKEPKKN  63



Lambda      K        H        a         alpha
   0.320    0.134    0.410    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 24782243432
Results from round 2


Query= YP_009725311.1 2'-O-ribose methyltransferase [Severe acute
respiratory syndrome coronavirus 2]

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

  sp|P18457|R1AB_CVPFS Replicase polyprotein 1ab (Fragment) OS=Po...   473    1e-163
  sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine corona...   501    1e-159
  sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine corona...   500    2e-159
  sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronav...   499    3e-159
  sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute ...   498    8e-159
  sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS co...   498    1e-158
  sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavir...   497    2e-158
  sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronav...   497    3e-158
  sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavir...   497    3e-158
  sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavir...   496    4e-158
  sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine corona...   490    7e-156
  sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine corona...   487    7e-155
  sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronav...   487    9e-155
  sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavir...   487    9e-155
  sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East r...   485    3e-154
  sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronav...   484    5e-154
  sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavir...   482    2e-153
  sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavir...   482    3e-153
  sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine trans...   482    4e-153
  sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronav...   481    1e-152
  sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronav...   481    1e-152
  sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronav...   479    5e-152
  sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronav...   475    9e-151
  sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavir...   466    1e-147
  sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epide...   463    2e-146
  sp|P12723|R1AB_IBVK Replicase polyprotein 1ab (Fragment) OS=Avi...   423    2e-144
  sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavir...   456    5e-144
  sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronav...   453    5e-143
  sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectio...   433    6e-136
  sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectio...   432    1e-135
  sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infecti...   430    3e-135
  sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronav...   348    1e-106
  sp|P36697|R1AB_CVCAI Replicase polyprotein 1ab (Fragment) OS=Ca...   254    4e-83 
  sp|Q04158|R1AB_CVPR8 Replicase polyprotein 1ab (Fragment) OS=Po...   201    4e-63 
  sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=...   176    3e-47 
  sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream v...   174    1e-46 
  sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 1 ...   171    1e-45 

Sequences not found previously or not previously below threshold:

  sp|Q5GS59|RLME_WOLTR Ribosomal RNA large subunit methyltransfer...  45.8    2e-04
  sp|Q73IS9|RLME_WOLPM Ribosomal RNA large subunit methyltransfer...  44.2    4e-04
  sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransfer...  43.1    0.001
  sp|Q5PAN0|RLME_ANAMM Ribosomal RNA large subunit methyltransfer...  40.8    0.006
  sp|B9KIP4|RLME_ANAMF Ribosomal RNA large subunit methyltransfer...  40.8    0.006
  sp|C3MGQ4|RLME_SINFN Ribosomal RNA large subunit methyltransfer...  38.8    0.036
  sp|Q0BT08|RLME_GRABC Ribosomal RNA large subunit methyltransfer...  38.1    0.054
  sp|Q3KI92|RLME_PSEPF Ribosomal RNA large subunit methyltransfer...  38.1    0.055
  sp|Q30YX3|RLME_DESAG Ribosomal RNA large subunit methyltransfer...  37.7    0.062
  sp|Q5NQH8|RLME_ZYMMO Ribosomal RNA large subunit methyltransfer...  37.7    0.066
  sp|Q8QZ73|POLN_MAYAB Polyprotein P1234 OS=Mayaro virus (strain ...  38.1    0.11 
  sp|Q2GB53|RLME_NOVAD Ribosomal RNA large subunit methyltransfer...  36.9    0.13 
  sp|Q7VQM8|RLME_BLOFL Ribosomal RNA large subunit methyltransfer...  36.9    0.14 
  sp|A1VC40|RLME_DESVV Ribosomal RNA large subunit methyltransfer...  36.5    0.14 
  sp|Q729T9|RLME_DESVH Ribosomal RNA large subunit methyltransfer...  36.5    0.14 
  sp|B8GG79|RLME_METPE Ribosomal RNA large subunit methyltransfer...  36.1    0.19 
  sp|Q1ML15|RLME_RHIL3 Ribosomal RNA large subunit methyltransfer...  36.5    0.19 
  sp|Q2KC36|RLME_RHIEC Ribosomal RNA large subunit methyltransfer...  36.1    0.25 
  sp|B3PQL4|RLME_RHIE6 Ribosomal RNA large subunit methyltransfer...  36.1    0.25 
  sp|A7HSA5|RLME_PARL1 Ribosomal RNA large subunit methyltransfer...  36.1    0.25 
  sp|B9J9U0|RLME_AGRRK Ribosomal RNA large subunit methyltransfer...  36.1    0.27 
  sp|B6END5|RLME_ALISL Ribosomal RNA large subunit methyltransfer...  35.8    0.28 
  sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-...  35.8    0.32 
  sp|A1ST38|RLME_PSYIN Ribosomal RNA large subunit methyltransfer...  35.4    0.38 
  sp|B2SZR9|RLME_PARPJ Ribosomal RNA large subunit methyltransfer...  35.0    0.49 
  sp|B5ZR94|RLME_RHILW Ribosomal RNA large subunit methyltransfer...  35.0    0.50 
  sp|Q9A7V4|RLME_CAUVC Ribosomal RNA large subunit methyltransfer...  35.0    0.53 
  sp|A7IDJ5|RLME_XANP2 Ribosomal RNA large subunit methyltransfer...  35.0    0.53 
  sp|Q8UHR0|RLME_AGRFC Ribosomal RNA large subunit methyltransfer...  35.0    0.57 
  sp|A1KT57|RLME_NEIMF Ribosomal RNA large subunit methyltransfer...  35.0    0.59 
  sp|Q5P1G0|RLME_AROAE Ribosomal RNA large subunit methyltransfer...  34.6    0.61 
  sp|C0QGP2|RLME_DESAH Ribosomal RNA large subunit methyltransfer...  34.6    0.76 
  sp|B0KHY6|RLME_PSEPG Ribosomal RNA large subunit methyltransfer...  34.6    0.77 
  sp|Q07LH9|RLME_RHOP5 Ribosomal RNA large subunit methyltransfer...  34.2    0.89 
  sp|B9JSD2|RLME_AGRVS Ribosomal RNA large subunit methyltransfer...  34.6    0.91 
  sp|Q88DV0|RLME_PSEPK Ribosomal RNA large subunit methyltransfer...  34.2    0.95 
  sp|A5W995|RLME_PSEP1 Ribosomal RNA large subunit methyltransfer...  34.2    0.95 
  sp|Q89N72|RLME_BRADU Ribosomal RNA large subunit methyltransfer...  34.2    0.97 
  sp|Q8FVY1|RLME_BRUSU Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|A9WYY2|RLME_BRUSI Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|A5VUZ8|RLME_BRUO2 Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|Q8YCD5|RLME_BRUME Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|C0RLJ5|RLME_BRUMB Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|A9MBW8|RLME_BRUC2 Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|Q578H4|RLME_BRUAB Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|Q2YKU4|RLME_BRUA2 Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|B2SAY0|RLME_BRUA1 Ribosomal RNA large subunit methyltransfer...  34.2    0.99 
  sp|Q1QKB6|RLME_NITHX Ribosomal RNA large subunit methyltransfer...  34.2    1.1  
  sp|Q212R3|RLME_RHOPB Ribosomal RNA large subunit methyltransfer...  34.2    1.1  
  sp|A5EHP2|RLME_BRASB Ribosomal RNA large subunit methyltransfer...  33.8    1.3  
  sp|Q2RXU5|RLME_RHORT Ribosomal RNA large subunit methyltransfer...  33.8    1.4  
  sp|Q2W0P2|RLME_MAGSA Ribosomal RNA large subunit methyltransfer...  33.8    1.4  
  sp|Q0C187|RLME_HYPNA Ribosomal RNA large subunit methyltransfer...  33.8    1.5  
  sp|A8H748|RLME_SHEPA Ribosomal RNA large subunit methyltransfer...  33.4    1.5  
  sp|B1J262|RLME_PSEPW Ribosomal RNA large subunit methyltransfer...  33.4    1.5  
  sp|A6X5L4|RLME_OCHA4 Ribosomal RNA large subunit methyltransfer...  33.8    1.5  
  sp|A4YSS3|RLME_BRASO Ribosomal RNA large subunit methyltransfer...  33.4    1.6  
  sp|Q138J5|RLME_RHOPS Ribosomal RNA large subunit methyltransfer...  33.4    1.7  
  sp|Q86AH1|MRM2_DICDI rRNA methyltransferase 2, mitochondrial OS...  34.2    1.7  
  sp|B0T8J6|RLME_CAUSK Ribosomal RNA large subunit methyltransfer...  33.4    2.0  
  sp|Q5RAS1|SPB1_PONAB pre-rRNA 2'-O-ribose RNA methyltransferase...  33.8    2.2  
  sp|C6C068|RLME_DESAD Ribosomal RNA large subunit methyltransfer...  33.1    2.2  
  sp|A1TQF0|RLME_ACIAC Ribosomal RNA large subunit methyltransfer...  33.1    2.4  
  sp|C5CKU4|RLME_VARPS Ribosomal RNA large subunit methyltransfer...  32.7    2.9  
  sp|Q13W47|RLME_PARXL Ribosomal RNA large subunit methyltransfer...  32.7    2.9  
  sp|Q1IF51|RLME_PSEE4 Ribosomal RNA large subunit methyltransfer...  32.7    2.9  
  sp|Q8IY81|SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase...  33.4    3.1  
  sp|Q21H48|RLME_SACD2 Ribosomal RNA large subunit methyltransfer...  32.7    3.3  
  sp|Q2SUW0|RLME_BURTA Ribosomal RNA large subunit methyltransfer...  32.7    3.3  
  sp|A4VNP3|RLME_PSEU5 Ribosomal RNA large subunit methyltransfer...  32.7    3.3  
  sp|B2JFN9|RLME_PARP8 Ribosomal RNA large subunit methyltransfer...  32.7    3.4  
  sp|A0KNF1|RLME_AERHH Ribosomal RNA large subunit methyltransfer...  32.3    3.4  
  sp|A8II77|RLME_AZOC5 Ribosomal RNA large subunit methyltransfer...  32.7    3.5  
  sp|Q7MI01|RLME_VIBVY Ribosomal RNA large subunit methyltransfer...  32.3    3.6  
  sp|Q8DBW7|RLME_VIBVU Ribosomal RNA large subunit methyltransfer...  32.3    3.6  
  sp|Q1QSY2|RLME_CHRSD Ribosomal RNA large subunit methyltransfer...  32.3    3.8  
  sp|Q7NRI3|RLME_CHRVO Ribosomal RNA large subunit methyltransfer...  32.3    4.0  
  sp|A2SF90|RLME_METPP Ribosomal RNA large subunit methyltransfer...  32.3    4.1  
  sp|Q32BF4|RLME_SHIDS Ribosomal RNA large subunit methyltransfer...  32.3    4.1  
  sp|Q5FNQ1|RLME_GLUOX Ribosomal RNA large subunit methyltransfer...  32.3    4.3  
  sp|Q7DDL2|RLME_NEIMB Ribosomal RNA large subunit methyltransfer...  32.3    4.4  
  sp|Q9JQX5|RLME_NEIMA Ribosomal RNA large subunit methyltransfer...  32.3    4.4  
  sp|A9M3N1|RLME_NEIM0 Ribosomal RNA large subunit methyltransfer...  32.3    4.4  
  sp|B4RK82|RLME_NEIG2 Ribosomal RNA large subunit methyltransfer...  32.3    4.4  
  sp|Q5F9L0|RLME_NEIG1 Ribosomal RNA large subunit methyltransfer...  32.3    4.4  
  sp|Q9CPY0|MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS...  32.3    4.6  
  sp|Q1GHF1|RLME_RUEST Ribosomal RNA large subunit methyltransfer...  32.3    4.8  
  sp|Q3J2Q5|RLME_RHOS4 Ribosomal RNA large subunit methyltransfer...  32.3    4.9  
  sp|A3PJK8|RLME_RHOS1 Ribosomal RNA large subunit methyltransfer...  32.3    4.9  
  sp|B7VJI4|RLME_VIBTL Ribosomal RNA large subunit methyltransfer...  31.9    5.1  
  sp|B5FA72|RLME_ALIFM Ribosomal RNA large subunit methyltransfer...  31.9    5.5  
  sp|Q5E7M3|RLME_ALIF1 Ribosomal RNA large subunit methyltransfer...  31.9    5.5  
  sp|Q5WT13|RLME_LEGPL Ribosomal RNA large subunit methyltransfer...  31.5    7.1  
  sp|A5IHX0|RLME_LEGPC Ribosomal RNA large subunit methyltransfer...  31.5    7.1  
  sp|P83543|TAMP_STRMB Transglutaminase-activating metalloproteas...  32.3    7.1  
  sp|Q6LUJ9|RLME_PHOPR Ribosomal RNA large subunit methyltransfer...  31.5    7.3  
  sp|Q5ZRT1|RLME_LEGPH Ribosomal RNA large subunit methyltransfer...  31.5    7.5  
  sp|Q5X1A0|RLME_LEGPA Ribosomal RNA large subunit methyltransfer...  31.5    7.5  
  sp|Q2N843|RLME_ERYLH Ribosomal RNA large subunit methyltransfer...  31.5    8.2  
  sp|Q63V86|RLME_BURPS Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|A3N853|RLME_BURP6 Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|Q3JTT5|RLME_BURP1 Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|A3NTW3|RLME_BURP0 Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|A1V319|RLME_BURMS Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|Q62L80|RLME_BURMA Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|A2S3Q7|RLME_BURM9 Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|A3MIQ3|RLME_BURM7 Ribosomal RNA large subunit methyltransfer...  31.5    8.3  
  sp|Q65TZ0|RLME_MANSM Ribosomal RNA large subunit methyltransfer...  31.1    8.8  
  sp|A4G4B0|RLME_HERAR Ribosomal RNA large subunit methyltransfer...  31.1    8.8  
  sp|Q87LZ4|RLME_VIBPA Ribosomal RNA large subunit methyltransfer...  31.1    9.8  


> sp|P18457|R1AB_CVPFS Replicase polyprotein 1ab (Fragment) OS=Porcine 
transmissible gastroenteritis coronavirus (strain FS772/70) 
OX=11150 GN=rep PE=3 SV=1
Length=533

 Score =  473 bits (1217),  Expect = 1e-163, Method: Composition-based stats.
 Identities = 165/299 (55%), Positives = 218/299 (73%), Gaps = 2/299 (1%)

Query  2    SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
            S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT TL V
Sbjct  234  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCV  293

Query  62   PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
            P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  294  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  353

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
            +K+DL++SD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGSVAIKITE SWN DLY
Sbjct  354  DKFDLLVSDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSVAIKITEFSWNKDLY  413

Query  182  KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
            +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  414  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  473

Query  240  SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
            S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   +  VN 
Sbjct  474  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVNT  532


> sp|P0C6W7|R1AB_CVBEN Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-ENT) OX=233262 GN=rep PE=3 SV=1
Length=7094

 Score =  501 bits (1289),  Expect = 1e-159, Method: Composition-based stats.
 Identities = 197/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D LVN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSLVN  7092


> sp|P0C6W8|R1AB_CVBLU Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain 98TXSF-110-LUN) OX=233264 GN=rep PE=3 SV=1
Length=7094

 Score =  500 bits (1288),  Expect = 2e-159, Method: Composition-based stats.
 Identities = 197/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D LVN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSLVN  7092


> sp|P0C6W9|R1AB_CVBM Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Mebus) OX=11132 GN=rep PE=3 SV=1
Length=7094

 Score =  499 bits (1286),  Expect = 3e-159, Method: Composition-based stats.
 Identities = 196/297 (66%), Positives = 234/297 (79%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6856  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6915

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6916  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6975

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHANY+FWRN+      
Sbjct  6976  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHANYLFWRNSTVWNGG  7035

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L++R+ N+ V   D +VN
Sbjct  7036  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLVRDTNKEVFVGDSMVN  7092


> sp|P0DTD1|R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute 
respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 
SV=1
Length=7096

 Score =  498 bits (1283),  Expect = 8e-159, Method: Composition-based stats.
 Identities = 298/298 (100%), Positives = 298/298 (100%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6799  SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  6858

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6859  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6918

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL
Sbjct  6919  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  6978

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS
Sbjct  6979  YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  7038

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
Sbjct  7039  SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  7096


> sp|P0C6X7|R1AB_CVHSA Replicase polyprotein 1ab OS=Human SARS 
coronavirus OX=694009 GN=rep PE=1 SV=1
Length=7073

 Score =  498 bits (1282),  Expect = 1e-158, Method: Composition-based stats.
 Identities = 278/298 (93%), Positives = 292/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6776  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6835

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6836  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6895

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDP+TK+VTKENDSKEGFFTY+CGFI+QKLALGGS+A+KITEHSWNADL
Sbjct  6896  ANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADL  6955

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6956  YKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7015

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7016  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7073


> sp|P0C6W2|R1AB_BCHK3 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU3 OX=442736 GN=rep PE=3 SV=1
Length=7067

 Score =  497 bits (1280),  Expect = 2e-158, Method: Composition-based stats.
 Identities = 278/298 (93%), Positives = 291/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6770  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6829

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6830  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6889

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTK+V K+NDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6890  ANKWDLIISDMYDPKTKHVLKDNDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6949

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6950  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7009

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7010  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7067


> sp|P0C6X6|R1AB_CVHOC Replicase polyprotein 1ab OS=Human coronavirus 
OC43 OX=31631 GN=rep PE=3 SV=1
Length=7095

 Score =  497 bits (1279),  Expect = 3e-158, Method: Composition-based stats.
 Identities = 197/297 (66%), Positives = 233/297 (78%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6797  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6856

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGS+KGVAPG+AVLRQWLP GT+LVD+DL  FVSD+ +T  GDC T+  
Sbjct  6857  VPVNMRVLHLGAGSEKGVAPGSAVLRQWLPAGTILVDNDLYPFVSDSVATYFGDCITLPF  6916

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTYIC  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6917  DCQWDLIISDMYDPITKNIGEYNVSKDGFFTYICHMIRDKLALGGSVAIKITEFSWNAEL  6976

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMG+FA+WT F TN NASSSE FLIG NYL KP+ +IDG VMHANY+FWRN+      
Sbjct  6977  YKLMGYFAFWTVFCTNANASSSEGFLIGINYLCKPKVEIDGNVMHANYLFWRNSTVWNGG  7036

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLKL GTAV++L+  QINDM+ SLL KG+L+IR+ N+ V   D LVN
Sbjct  7037  AYSLFDMAKFPLKLAGTAVINLRADQINDMVYSLLEKGKLLIRDTNKEVFVGDSLVN  7093


> sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus 
279/2005 OX=389167 GN=rep PE=3 SV=1
Length=7079

 Score =  497 bits (1279),  Expect = 3e-158, Method: Composition-based stats.
 Identities = 278/298 (93%), Positives = 289/298 (97%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6782  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6841

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTG LLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6842  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGALLVDSDLNDFVSDADSTLIGDCATVHT  6901

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLIISDMYDPKTK+VTKENDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6902  ANKWDLIISDMYDPKTKHVTKENDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6961

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGK REQIDGY MHANYIFWRNTNPIQLS
Sbjct  6962  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKLREQIDGYTMHANYIFWRNTNPIQLS  7021

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL  GRLIIRENNRVV+SSD+LVNN
Sbjct  7022  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLENGRLIIRENNRVVVSSDILVNN  7079


> sp|P0C6W6|R1AB_BCRP3 Replicase polyprotein 1ab OS=Bat coronavirus 
Rp3/2004 OX=349344 GN=rep PE=3 SV=1
Length=7071

 Score =  496 bits (1278),  Expect = 4e-158, Method: Composition-based stats.
 Identities = 278/298 (93%), Positives = 291/298 (98%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +SQAWQPGVAMPNLYKMQRMLLEKCDLQNYG++A +PKGIMMNVAKYTQLCQYLNTLTLA
Sbjct  6774  ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLA  6833

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT
Sbjct  6834  VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  6893

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             ANKWDLI+SDMYDPK K+VTKENDSKEGFFTY+CGFI+QKLALGGSVA+KITEHSWNADL
Sbjct  6894  ANKWDLIVSDMYDPKAKHVTKENDSKEGFFTYLCGFIKQKLALGGSVAVKITEHSWNADL  6953

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLMGHF+WWTAFVTNVNASSSEAFLIG NYLGKP+EQIDGY MHANYIFWRNTNPIQLS
Sbjct  6954  YKLMGHFSWWTAFVTNVNASSSEAFLIGVNYLGKPKEQIDGYTMHANYIFWRNTNPIQLS  7013

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             SYSLFDMSKFPLKLRGTAVMSLKE QINDMI SLL KGRLIIRENNRVV+SSD+LVNN
Sbjct  7014  SYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN  7071


> sp|P0C6X9|R1AB_CVMA5 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain A59) OX=11142 GN=rep PE=1 SV=1
Length=7176

 Score =  490 bits (1261),  Expect = 7e-156, Method: Composition-based stats.
 Identities = 191/297 (64%), Positives = 230/297 (77%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG  MP LYK     LE+ +L NYG   TLP G MMNVAKYTQLCQYL+T TLA
Sbjct  6878  AAADWKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLA  6937

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDKGVAPG+AVLRQWLP G++LVD+D+N FVSD+ ++  G+C T+  
Sbjct  6938  VPANMRVLHLGAGSDKGVAPGSAVLRQWLPAGSILVDNDVNPFVSDSVASYYGNCITLPF  6997

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6998  DCQWDLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAEL  7057

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y LMG FA+WT F TNVNASSSE FLIG N+L K R +IDG  MHANY+FWRN+      
Sbjct  7058  YSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNKTRTEIDGKTMHANYLFWRNSTMWNGG  7117

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDMSKFPLK  GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7118  AYSLFDMSKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7174


> sp|P0C6Y0|R1AB_CVMJH Replicase polyprotein 1ab OS=Murine coronavirus 
(strain JHM) OX=11144 GN=rep PE=1 SV=1
Length=7180

 Score =  487 bits (1254),  Expect = 7e-155, Method: Composition-based stats.
 Identities = 188/297 (63%), Positives = 231/297 (78%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG  MP LYK     +E+ +L NYG   TLP G MMNVAKYTQLCQYL+T TLA
Sbjct  6882  AAADWKPGYVMPVLYKYLESPMERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLA  6941

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDKGVAPG+AVLRQWLP+G++LVD+D+N FVSD+ ++  G+C T+  
Sbjct  6942  VPANMRVLHLGAGSDKGVAPGSAVLRQWLPSGSILVDNDMNPFVSDSVASYYGNCITLPF  7001

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               +WDLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+L
Sbjct  7002  DCQWDLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAEL  7061

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y LMG FA+WT F TNVNASSSE FLIG N+L + R +IDG  MHANY+FWRN+      
Sbjct  7062  YSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNRTRNEIDGKTMHANYLFWRNSTMWNGG  7121

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDM+KFPLK  GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7122  AYSLFDMTKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7178


> sp|P0C6X8|R1AB_CVM2 Replicase polyprotein 1ab OS=Murine coronavirus 
(strain 2) OX=76344 GN=rep PE=3 SV=1
Length=7124

 Score =  487 bits (1253),  Expect = 9e-155, Method: Composition-based stats.
 Identities = 190/297 (64%), Positives = 231/297 (78%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG  MP LYK     LE+ +L NYG   TLP G +MNVAKYTQLCQYLNT TLA
Sbjct  6826  AAADWKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCLMNVAKYTQLCQYLNTTTLA  6885

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP G++LVD+D+N FVSD+ ++  G+C T+  
Sbjct  6886  VPANMRVLHLGAGSDKDVAPGSAVLRQWLPAGSILVDNDINPFVSDSVASYYGNCITLPI  6945

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
             A +WDLIISDMYDP TKN+ + N SK+GFFTY+C  I+ KLALGGSVAIKITE SWNA+L
Sbjct  6946  ACQWDLIISDMYDPLTKNIGEYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAEL  7005

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y LMG FA+WT F TNVNASSSE FLIG N+L + R +IDG  MHANY+FWRN+      
Sbjct  7006  YSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNRTRTEIDGKTMHANYLFWRNSTMWNGG  7065

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFDMSKFPLK+ GTAV+SLK  QIND++LSL+ KG+L++R+  + V   D LVN
Sbjct  7066  AYSLFDMSKFPLKVAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN  7122


> sp|P0C6W4|R1AB_BCHK5 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU5 OX=694008 GN=rep PE=3 SV=1
Length=7182

 Score =  487 bits (1253),  Expect = 9e-155, Method: Composition-based stats.
 Identities = 195/297 (66%), Positives = 243/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +   W+PG+AMP+L+K+Q   LE C L NY  S  +P+G+ MN+AKY QLCQYLNT T+A
Sbjct  6875  AINDWKPGLAMPSLFKVQNSNLEPCMLPNYKQSIPMPQGVHMNIAKYMQLCQYLNTCTIA  6934

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+HFGAGSDKGVAPG++VLRQWLPT  +L+D+DLN++VSDAD TL GDC TV  
Sbjct  6935  VPANMRVMHFGAGSDKGVAPGSSVLRQWLPTDAILIDNDLNEYVSDADITLFGDCVTVRV  6994

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TK V + N++K  FF Y+C FI+  LALGGSVAIKITEHSW+A+L
Sbjct  6995  GQQVDLLISDMYDPSTKVVGETNEAKALFFVYLCNFIKNNLALGGSVAIKITEHSWSAEL  7054

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y+LMG FAWWT F TN NASSSE FLIG NYLG+ +E IDG VMHANYIFWRNT  + LS
Sbjct  7055  YELMGRFAWWTVFCTNANASSSEGFLIGINYLGELKEVIDGNVMHANYIFWRNTTLMNLS  7114

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+LIIR+N+ + +S+DVLVN
Sbjct  7115  TYSLFDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLIIRDNDTLSVSTDVLVN  7171


> sp|K9N7C7|R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East 
respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) 
OX=1263720 GN=rep PE=1 SV=1
Length=7078

 Score =  485 bits (1249),  Expect = 3e-154, Method: Composition-based stats.
 Identities = 197/298 (66%), Positives = 243/298 (82%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             +S  W+PG AMP+L+K+Q + LE+C+L NY  S  +P+G+ MN+AKY QLCQYLNT TLA
Sbjct  6776  ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA  6835

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAGSDKG+APGT+VLRQWLPT  +++D+DLN+FVSDAD TL GDC TV  
Sbjct  6836  VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV  6895

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TKNVT  N+SK  FFTY+C  I   LALGGSVAIKITEHSW+ +L
Sbjct  6896  GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL  6955

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y+LMG FAWWT F TN NASSSE FL+G NYLG  +E IDG  MHANYIFWRN+ P+ LS
Sbjct  6956  YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS  7015

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             +YSLFD+SKF LKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN 
Sbjct  7016  TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLVNT  7073


> sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N2) OX=443240 GN=rep PE=3 SV=1
Length=7152

 Score =  484 bits (1247),  Expect = 5e-154, Method: Composition-based stats.
 Identities = 190/298 (64%), Positives = 229/298 (77%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG +  LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6854  ATSDWKPGYSMPVLYKYLNVPLERVSLWNYGKAINLPTGCMMNVAKYTQLCQYLNTTTLA  6913

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6914  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  6973

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  6974  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICYLIRDKLSLGGSVAIKITEFSWNADL  7033

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM +FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7034  YKLMSYFAFWTVFCTNVNASSSEGFLIGINYLGKSCFEIDGNVMHANYLFWRNSTTWNGG  7093

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             +YSLFDMSKF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN 
Sbjct  7094  AYSLFDMSKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVNT  7151


> sp|P0C6W1|R1AB_BC133 Replicase polyprotein 1ab OS=Bat coronavirus 
133/2005 OX=389230 GN=rep PE=3 SV=1
Length=7126

 Score =  482 bits (1242),  Expect = 2e-153, Method: Composition-based stats.
 Identities = 195/297 (66%), Positives = 244/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG+ MP+L+K+Q+M LE C L NY  S  +P G+ MNVAKY QLCQYLNT TLA
Sbjct  6825  ATNDWKPGLTMPSLFKVQQMNLEPCLLANYKQSIPMPNGVHMNVAKYMQLCQYLNTCTLA  6884

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAG +KGVAPGT+VLRQWLP   +L+D+DLN+FVSDAD T+ GDC TVH 
Sbjct  6885  VPANMRVIHFGAGCEKGVAPGTSVLRQWLPLDAVLIDNDLNEFVSDADITIFGDCVTVHV  6944

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TK V + N +K  FF Y+C FI+  LALGGSVAIKITEHSW+ADL
Sbjct  6945  GQQVDLLISDMYDPCTKAVGEVNQTKALFFVYLCNFIKNNLALGGSVAIKITEHSWSADL  7004

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YK+MG FA+WT F TN NASSSE FLIG N+LG+ +E+IDG VMHANYIFWRN+ P+ LS
Sbjct  7005  YKIMGRFAYWTVFCTNANASSSEGFLIGINFLGELKEEIDGNVMHANYIFWRNSTPMNLS  7064

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN
Sbjct  7065  TYSLFDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLNVSTDVLVN  7121


> sp|P0C6W3|R1AB_BCHK4 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU4 OX=694007 GN=rep PE=1 SV=1
Length=7119

 Score =  482 bits (1242),  Expect = 3e-153, Method: Composition-based stats.
 Identities = 195/297 (66%), Positives = 244/297 (82%), Gaps = 0/297 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG+ MP+L+K+Q+M LE C L NY  S  +P G+ MNVAKY QLCQYLNT TLA
Sbjct  6818  ATNDWKPGLTMPSLFKVQQMNLEPCLLANYKQSIPMPNGVHMNVAKYMQLCQYLNTCTLA  6877

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRVIHFGAG +KGVAPGT+VLRQWLP   +L+D+DLN+FVSDAD T+ GDC TVH 
Sbjct  6878  VPANMRVIHFGAGCEKGVAPGTSVLRQWLPLDAVLIDNDLNEFVSDADITIFGDCVTVHV  6937

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
               + DL+ISDMYDP TK V + N +K  FF Y+C FI+  LALGGSVAIKITEHSW+ADL
Sbjct  6938  GQQVDLLISDMYDPCTKAVGEVNQTKALFFVYLCNFIKNNLALGGSVAIKITEHSWSADL  6997

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YK+MG FA+WT F TN NASSSE FLIG N+LG+ +E+IDG VMHANYIFWRN+ P+ LS
Sbjct  6998  YKIMGRFAYWTVFCTNANASSSEGFLIGINFLGELKEEIDGNVMHANYIFWRNSTPMNLS  7057

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +YSLFD+S+FPLKL+GT V+ LKE QIN++++SLLS+G+L+IR+N+ + +S+DVLVN
Sbjct  7058  TYSLFDLSRFPLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLNVSTDVLVN  7114


> sp|P0C6Y5|R1AB_CVPPU Replicase polyprotein 1ab OS=Porcine transmissible 
gastroenteritis coronavirus (strain Purdue) OX=11151 
GN=rep PE=1 SV=1
Length=6684

 Score =  482 bits (1241),  Expect = 4e-153, Method: Composition-based stats.
 Identities = 165/299 (55%), Positives = 218/299 (73%), Gaps = 2/299 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT TL V
Sbjct  6385  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCV  6444

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  6445  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  6504

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL++SD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGSVAIKITE SWN DLY
Sbjct  6505  DKFDLLVSDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSVAIKITEFSWNKDLY  6564

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  6565  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  6624

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   +  VN 
Sbjct  6625  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVNT  6683


> sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N1) OX=443239 GN=rep PE=3 SV=1
Length=7182

 Score =  481 bits (1238),  Expect = 1e-152, Method: Composition-based stats.
 Identities = 189/298 (63%), Positives = 227/298 (76%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG    LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6884  ATNDWKPGYSMPVLYKYLNVPLERVSLWNYGKPINLPTGCMMNVAKYTQLCQYLNTTTLA  6943

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6944  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  7003

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  7004  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICHLIRDKLSLGGSVAIKITEFSWNADL  7063

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM  FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7064  YKLMSCFAFWTVFCTNVNASSSEGFLIGINYLGKSSFEIDGNVMHANYLFWRNSTTWNGG  7123

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             +YSLFDM+KF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN 
Sbjct  7124  AYSLFDMTKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVNT  7181


> sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus 
HKU1 (isolate N5) OX=443241 GN=rep PE=3 SV=1
Length=7132

 Score =  481 bits (1237),  Expect = 1e-152, Method: Composition-based stats.
 Identities = 189/298 (63%), Positives = 227/298 (76%), Gaps = 0/298 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK   + LE+  L NYG    LP G MMNVAKYTQLCQYLNT TLA
Sbjct  6834  ATNDWKPGYSMPVLYKYLNVPLERVSLWNYGKPINLPTGCMMNVAKYTQLCQYLNTTTLA  6893

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP NMRV+H GAGSDK VAPG+AVLRQWLP+G++LVD+DLN FVSD+  T  GDC T+  
Sbjct  6894  VPVNMRVLHLGAGSDKEVAPGSAVLRQWLPSGSILVDNDLNPFVSDSLVTYFGDCMTLPF  6953

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
                WDLIISDMYDP TKN+   N SK+GFFTYIC  I+ KL+LGGSVAIKITE SWNADL
Sbjct  6954  DCHWDLIISDMYDPLTKNIGDYNVSKDGFFTYICHLIRDKLSLGGSVAIKITEFSWNADL  7013

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             YKLM  FA+WT F TNVNASSSE FLIG NYLGK   +IDG VMHANY+FWRN+      
Sbjct  7014  YKLMSCFAFWTVFCTNVNASSSEGFLIGINYLGKSSFEIDGNVMHANYLFWRNSTTWNGG  7073

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             +YSLFDM+KF LKL GTAV++L+  Q+ND++ SL+ +G+L++R+  + +   D LVN 
Sbjct  7074  AYSLFDMTKFSLKLAGTAVVNLRPDQLNDLVYSLIERGKLLVRDTRKEIFVGDSLVNT  7131


> sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus 
(strain FIPV WSU-79/1146) OX=33734 GN=rep PE=1 SV=2
Length=6709

 Score =  479 bits (1233),  Expect = 5e-152, Method: Composition-based stats.
 Identities = 165/298 (55%), Positives = 218/298 (73%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W PG +MP LYK+QRM LE+C+L NYG    LP GI  NV KYTQLCQYLNT T+ V
Sbjct  6410  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVRLPDGITTNVVKYTQLCQYLNTTTVCV  6469

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+ MRV+H GA    GVAPG+ VLR+WLP   +LVD+DL D+VSDAD ++ GDC +++  
Sbjct  6470  PHKMRVLHLGAAGASGVAPGSTVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIE  6529

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISD+YD  TK++  EN SK+GFFTYI GFI++KL+LGGS AIKITE SWN DLY
Sbjct  6530  DKFDLLISDLYDGSTKSIDGENTSKDGFFTYINGFIKEKLSLGGSAAIKITEFSWNKDLY  6589

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANYIFWRN+  + L
Sbjct  6590  ELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMAL  6649

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N +++   + LVN
Sbjct  6650  SHNSVLDTPKFKCRCNNALIVNLKEKELNEMVVGLLRKGKLLIRNNGKLLNFGNHLVN  6707


> sp|P0C6X5|R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus 
NL63 OX=277944 GN=rep PE=1 SV=1
Length=6729

 Score =  475 bits (1223),  Expect = 9e-151, Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 226/299 (76%), Gaps = 2/299 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G AMP +YK+QRM LE C+L NYG    LP GIM+NV KYTQLCQYLN+ T+ V
Sbjct  6430  SAEWKCGYAMPQIYKLQRMCLEPCNLYNYGAGIKLPSGIMLNVVKYTQLCQYLNSTTMCV  6489

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+NMRV+H+GAGSDKGVAPGT VL++WLP   +++D+D+ND+VSDAD ++ GDCATV+  
Sbjct  6490  PHNMRVLHYGAGSDKGVAPGTTVLKRWLPPDAIIIDNDINDYVSDADFSITGDCATVYLE  6549

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD + K    EN SK+GFFTY+ G I++KLA+GGSVAIKITE+SWN  LY
Sbjct  6550  DKFDLLISDMYDGRIKFCDGENVSKDGFFTYLNGVIREKLAIGGSVAIKITEYSWNKYLY  6609

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  FA+WT F T+VN SSSEAFLIG NYLG   +   I G  +HANYIFWRN+  + L
Sbjct  6610  ELIQRFAFWTLFCTSVNTSSSEAFLIGINYLGDFIQGPFIAGNTVHANYIFWRNSTIMSL  6669

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             S  S+ D+SKF  K + T V++LK+  +NDM+LSL+  GRL++R N R    S+ LV+ 
Sbjct  6670  SYNSVLDLSKFECKHKATVVVTLKDSDVNDMVLSLIKSGRLLLRNNGRFGGFSNHLVST  6728


> sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronavirus 
512/2005 OX=693999 GN=rep PE=3 SV=1
Length=6793

 Score =  466 bits (1200),  Expect = 1e-147, Method: Composition-based stats.
 Identities = 171/299 (57%), Positives = 223/299 (75%), Gaps = 2/299 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G +MP++YK+QRM LE C+L NYG    LP GIM NV KYTQLCQYLN+ T+ V
Sbjct  6493  SAEWKCGYSMPSIYKIQRMCLEPCNLYNYGSGLKLPDGIMFNVVKYTQLCQYLNSTTMCV  6552

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P++MRV+H GAGSDKGVAPGTAVLR+WLP   ++VD+D+ND+VSDAD +  GDCA+++  
Sbjct  6553  PHHMRVLHLGAGSDKGVAPGTAVLRRWLPLDAVIVDNDVNDYVSDADFSYTGDCASMYLT  6612

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD +TK+   +N SKEGFF YI G I +KLALGG+VAIKITE SWN  LY
Sbjct  6613  DKFDLVISDMYDGRTKSCDGDNVSKEGFFPYINGVITEKLALGGTVAIKITEFSWNKKLY  6672

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP--REQIDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSEAFLIG ++LG       IDG +MHANYIFWRN+  + +
Sbjct  6673  ELIQKFEYWTLFCTSVNTSSSEAFLIGVHFLGDFSTNAIIDGNIMHANYIFWRNSTIMTM  6732

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             S  S+ D+SKF  K + T V++LK+  + D++L LL  G+L+IR N  V   S+ LVN+
Sbjct  6733  SYNSVLDLSKFSCKHKATVVVNLKDSSVTDLVLGLLKNGKLLIRNNGVVCGFSNHLVNS  6791


> sp|P0C6Y4|R1AB_PEDV7 Replicase polyprotein 1ab OS=Porcine epidemic 
diarrhea virus (strain CV777) OX=229032 GN=rep PE=1 SV=1
Length=6781

 Score =  463 bits (1191),  Expect = 2e-146, Method: Composition-based stats.
 Identities = 169/298 (57%), Positives = 222/298 (74%), Gaps = 2/298 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             +  W+ G +MP++YK+QRM LE C+L NYG    LP GIM NV KYTQLCQYLN+ T+ V
Sbjct  6481  ASEWKCGYSMPSIYKIQRMCLEPCNLYNYGAGVKLPDGIMFNVVKYTQLCQYLNSTTMCV  6540

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P++MRV+H GAGSDKGVAPGTAVLR+WLP   ++VD+D  D+VSDAD ++ GDC+T++ +
Sbjct  6541  PHHMRVLHLGAGSDKGVAPGTAVLRRWLPLDAIIVDNDSVDYVSDADYSVTGDCSTLYLS  6600

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD K K+   EN SKEGFF YI G I +KLALGG+VAIK+TE SWN  LY
Sbjct  6601  DKFDLVISDMYDGKIKSCDGENVSKEGFFPYINGVITEKLALGGTVAIKVTEFSWNKKLY  6660

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP--REQIDGYVMHANYIFWRNTNPIQL  239
             +L+  F +WT F T+VN SSSEAFLIG +YLG       IDG  MHANYIFWRN+  + +
Sbjct  6661  ELIQKFEYWTMFCTSVNTSSSEAFLIGVHYLGDFASGAVIDGNTMHANYIFWRNSTIMTM  6720

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             S  S+ D+SKF  K + T V++LK+  I+D++L LL  G+L++R N+ +   S+ LVN
Sbjct  6721  SYNSVLDLSKFNCKHKATVVVNLKDSSISDVVLGLLKNGKLLVRNNDAICGFSNHLVN  6778


> sp|P12723|R1AB_IBVK Replicase polyprotein 1ab (Fragment) OS=Avian 
infectious bronchitis virus (strain KB8523) OX=11126 GN=rep 
PE=3 SV=1
Length=521

 Score =  423 bits (1088),  Expect = 2e-144, Method: Composition-based stats.
 Identities = 159/299 (53%), Positives = 211/299 (71%), Gaps = 5/299 (2%)

Query  3    QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP  62
             AW  G  MP LYK+Q  ++E C++ NYG   TLP GIMMNVAKYTQLCQYL+  T+ VP
Sbjct  220  SAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGIMMNVAKYTQLCQYLSKTTVCVP  279

Query  63   YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN  122
            +NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC    T +
Sbjct  280  HNMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDTDIVDYVSDAHVSVLSDCNKYKTEH  339

Query  123  KWDLIISDMY---DPKTKNVT-KENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
            K+DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+ 
Sbjct  340  KFDLVISDMYTDNDSKRKHGGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKLTETSWHE  399

Query  179  DLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP-REQIDGYVMHANYIFWRNTNPI  237
             LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +
Sbjct  400  SLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASVKVKVSGKTLHANYIFWRNCNYL  459

Query  238  QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
            Q S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  460  QTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  518


> sp|P0C6W5|R1AB_BCHK9 Replicase polyprotein 1ab OS=Bat coronavirus 
HKU9 OX=694006 GN=rep PE=1 SV=1
Length=6930

 Score =  456 bits (1173),  Expect = 5e-144, Method: Composition-based stats.
 Identities = 185/284 (65%), Positives = 227/284 (80%), Gaps = 1/284 (0%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             + Q W+PG +MP LYK+Q  +LE C L NYG +A LP G +MNVAKYTQLCQYLNT +LA
Sbjct  6634  AKQDWKPGYSMPALYKVQNAVLEPCLLHNYGQAARLPSGTLMNVAKYTQLCQYLNTCSLA  6693

Query  61    VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT  120
             VP  MRV+HFGAGSDKGV PGTAVL+QWLP    LVD+DL    SDADST +G C T  +
Sbjct  6694  VPAKMRVMHFGAGSDKGVCPGTAVLKQWLPADAYLVDNDLCYCASDADSTYVGSCETFFS  6753

Query  121   ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
              NKWD I SDMYD +TKN + +N SKEGFFTY+ GFI+ KLALGGS+AIKITEHSW+ADL
Sbjct  6754  VNKWDFIFSDMYDARTKNTSGDNTSKEGFFTYLTGFIRSKLALGGSIAIKITEHSWSADL  6813

Query  181   YKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS  240
             Y +MGHF WWT F T+VN+SSSEAFLIG NY+G     +DG+ MHANY+FWRN+  +QLS
Sbjct  6814  YAIMGHFNWWTCFCTSVNSSSSEAFLIGVNYIGV-GALLDGWQMHANYVFWRNSTVMQLS  6872

Query  241   SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRE  284
             SYSL+D+ +FPL+L+GT VMSLKE Q+N+++L+L+  GRLI+R+
Sbjct  6873  SYSLYDLQRFPLRLKGTPVMSLKEDQLNELVLNLIRAGRLIVRD  6916


> sp|P0C6X1|R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 
229E OX=11137 GN=rep PE=1 SV=1
Length=6758

 Score =  453 bits (1165),  Expect = 5e-143, Method: Composition-based stats.
 Identities = 170/299 (57%), Positives = 225/299 (75%), Gaps = 2/299 (1%)

Query  2     SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAV  61
             S  W+ G +MP +YK QRM LE C+L NYG    LP GIM NV KYTQLCQY N+ TL V
Sbjct  6459  SAEWKCGYSMPGIYKTQRMCLEPCNLYNYGAGLKLPSGIMFNVVKYTQLCQYFNSTTLCV  6518

Query  62    PYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTA  121
             P+NMRV+H GAGSD GVAPGTAVL++WLP   ++VD+D+ D+VSDAD ++ GDCATV+  
Sbjct  6519  PHNMRVLHLGAGSDYGVAPGTAVLKRWLPHDAIVVDNDVVDYVSDADFSVTGDCATVYLE  6578

Query  122   NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
             +K+DL+ISDMYD +TK +  EN SKEGFFTYI GFI +KLA+GGS+AIK+TE+SWN  LY
Sbjct  6579  DKFDLLISDMYDGRTKAIDGENVSKEGFFTYINGFICEKLAIGGSIAIKVTEYSWNKKLY  6638

Query  182   KLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANYIFWRNTNPIQL  239
             +L+  F++WT F T+VN SSSEAF++G NYLG   +   IDG ++HANY+FWRN+  + L
Sbjct  6639  ELVQRFSFWTMFCTSVNTSSSEAFVVGINYLGDFAQGPFIDGNIIHANYVFWRNSTVMSL  6698

Query  240   SSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN  298
             S  S+ D+SKF  K + T V+ LK+  IN+M+LSL+  G+L++R N + +  S+ LV+ 
Sbjct  6699  SYNSVLDLSKFNCKHKATVVVQLKDSDINEMVLSLVRSGKLLVRGNGKCLSFSNHLVST  6757


> sp|P0C6Y3|R1AB_IBVM Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain M41) OX=11127 GN=rep PE=1 SV=1
Length=6631

 Score =  433 bits (1113),  Expect = 6e-136, Method: Composition-based stats.
 Identities = 157/299 (53%), Positives = 210/299 (70%), Gaps = 5/299 (2%)

Query  3     QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP  62
              AW  G  MP LYK+Q  ++E C++ NYG    LP GIMMNVAKYTQLCQYL+  T+ VP
Sbjct  6330  SAWTCGYNMPELYKVQNCVMEPCNIPNYGVGIALPSGIMMNVAKYTQLCQYLSKTTMCVP  6389

Query  63    YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN  122
             +NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC    T +
Sbjct  6390  HNMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYKTEH  6449

Query  123   KWDLIISDMY---DPKTKN-VTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
             K+DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+ 
Sbjct  6450  KFDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHE  6509

Query  179   DLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP-REQIDGYVMHANYIFWRNTNPI  237
              LY +    AWWT F T VNASSSEAFL+G NYLG   + ++ G  +HANYIFWRN N +
Sbjct  6510  VLYDIAQDCAWWTMFCTAVNASSSEAFLVGVNYLGASEKVKVSGKTLHANYIFWRNCNYL  6569

Query  238   QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
             Q S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6570  QTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6628


> sp|P0C6Y1|R1AB_IBVB Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette) OX=11122 GN=rep PE=1 
SV=1
Length=6629

 Score =  432 bits (1111),  Expect = 1e-135, Method: Composition-based stats.
 Identities = 158/299 (53%), Positives = 212/299 (71%), Gaps = 5/299 (2%)

Query  3     QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP  62
              AW  G  MP LYK+Q  ++E C++ NYG   TLP GI+MNVAKYTQLCQYL+  T+ VP
Sbjct  6328  SAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGILMNVAKYTQLCQYLSKTTICVP  6387

Query  63    YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN  122
             +NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC   +T +
Sbjct  6388  HNMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYNTEH  6447

Query  123   KWDLIISDMY---DPKTKN-VTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
             K+DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+ 
Sbjct  6448  KFDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHE  6507

Query  179   DLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP-REQIDGYVMHANYIFWRNTNPI  237
              LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +
Sbjct  6508  VLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASEKVKVSGKTLHANYIFWRNCNYL  6567

Query  238   QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
             Q S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6568  QTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6626


> sp|P0C6Y2|R1AB_IBVBC Replicase polyprotein 1ab OS=Avian infectious 
bronchitis virus (strain Beaudette CK) OX=160235 GN=rep 
PE=3 SV=1
Length=6629

 Score =  430 bits (1107),  Expect = 3e-135, Method: Composition-based stats.
 Identities = 158/299 (53%), Positives = 211/299 (71%), Gaps = 5/299 (2%)

Query  3     QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVP  62
              AW  G  MP LYK+Q  ++E C++ NYG   TLP GI+MNVAKYTQLCQYL   T+ VP
Sbjct  6328  SAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGILMNVAKYTQLCQYLLKTTICVP  6387

Query  63    YNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTAN  122
             +NMRV+HFGAGSDKGVAPG+ VL+QWLP GTLLVD+D+ D+VSDA  +++ DC   +T +
Sbjct  6388  HNMRVMHFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYNTEH  6447

Query  123   KWDLIISDMY---DPKTKN-VTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
             K+DL+ISDMY   D K K+     N+  +  F Y+  F++  LALGGS A+K+TE SW+ 
Sbjct  6448  KFDLVISDMYTDNDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAVKVTETSWHE  6507

Query  179   DLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKP-REQIDGYVMHANYIFWRNTNPI  237
              LY +    AWWT F T VNASSSEAFLIG NYLG   + ++ G  +HANYIFWRN N +
Sbjct  6508  VLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGASEKVKVSGKTLHANYIFWRNCNYL  6567

Query  238   QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLV  296
             Q S+YS+FD++KF L+L+ T V++LK  Q  D++ +L+  G+L++R+      +SD  V
Sbjct  6568  QTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFV  6626


> sp|P0C6X0|R1AB_CVBQ Replicase polyprotein 1ab OS=Bovine coronavirus 
(strain Quebec) OX=11133 GN=rep PE=3 SV=1
Length=7059

 Score =  348 bits (893),  Expect = 1e-106, Method: Composition-based stats.
 Identities = 144/241 (60%), Positives = 168/241 (70%), Gaps = 16/241 (7%)

Query  1     SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLA  60
             ++  W+PG +MP LYK     +E+  L NYG   TLP G MMNVAKYTQLCQYLNT TLA
Sbjct  6796  AASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLA  6855

Query  61    VPYNMRVIHFGAGSDKGVAPGTAV----------LRQWLPTGTLLVDSDLNDFVSDADST  110
             VP N RV+H GAGS+KGVAPG+AV          LRQWLP GT+LV +DL  FVSD+ +T
Sbjct  6856  VPVNTRVLHLGAGSEKGVAPGSAVLRQWLPAGTILRQWLPAGTILVHNDLYPFVSDSVAT  6915

Query  111   LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYI-CGFIQQKLALGGSVAI  169
               GDC T+    +WDLIISDMYD     +  +        +YI C  I+ KLALGGSVAI
Sbjct  6916  YFGDCITLPFDCQWDLIISDMYD-----LLLDIGVHVVRCSYIHCHMIRDKLALGGSVAI  6970

Query  170   KITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYI  229
             KITE SWNA+LYKLMG+FA+WT F TN NASSSE FLIG NYLGKP+ +IDG VMHA   
Sbjct  6971  KITEFSWNAELYKLMGYFAFWTVFCTNANASSSEGFLIGINYLGKPKVEIDGNVMHAIIC  7030

Query  230   F  230
             F
Sbjct  7031  F  7031


> sp|P36697|R1AB_CVCAI Replicase polyprotein 1ab (Fragment) OS=Canine 
coronavirus (strain Insavc-1) OX=36391 GN=rep PE=4 SV=1
Length=168

 Score =  254 bits (649),  Expect = 4e-83, Method: Composition-based stats.
 Identities = 87/166 (52%), Positives = 118/166 (71%), Gaps = 2/166 (1%)

Query  134  PKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAF  193
            P TK++  EN SK+GFFTY+ GFI++KL+LGGS AIKITE SWN DLY+L+  F +WT F
Sbjct  1    PNTKSIDGENTSKDGFFTYVNGFIKEKLSLGGSAAIKITEFSWNKDLYELIQRFEYWTVF  60

Query  194  VTNVNASSSEAFLIGCNYLGKPR--EQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFP  251
             T+VN SSSE FLIG NYLG       +DG +MHANYIFWRN+  + LS  S+ D  KF 
Sbjct  61   CTSVNTSSSEGFLIGVNYLGPYCDRAIVDGNIMHANYIFWRNSTIMALSHNSVLDTPKFK  120

Query  252  LKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN  297
             +     +++LKE ++N+M++ LL KG+L+IR N +++   + LVN
Sbjct  121  CRCNNALIVNLKEKELNEMVIGLLKKGKLLIRNNGKLLNFGNHLVN  166


> sp|Q04158|R1AB_CVPR8 Replicase polyprotein 1ab (Fragment) OS=Porcine 
respiratory coronavirus (strain 86/137004 / isolate 
British) OX=33736 GN=rep PE=4 SV=1
Length=131

 Score =  201 bits (512),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 2/130 (2%)

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQ--IDGYVMHANY  228
            ITE SWN  LY+L+  F +WT F T+VN SSSE FLIG NYLG   ++  +DG +MHANY
Sbjct  1    ITEFSWNKYLYELIQRFEYWTVFCTSVNTSSSEGFLIGVNYLGPYCDKAIVDGNIMHANY  60

Query  229  IFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRV  288
            IFWRN+  + LS  S+ D  KF  +     +++LKE ++N+M++ LL KG+L+IR N ++
Sbjct  61   IFWRNSTIMALSHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKL  120

Query  289  VISSDVLVNN  298
            +   +  +N 
Sbjct  121  LNFGNHFINT  130


> sp|P0C6V7|R1AB_BEV Replicase polyprotein 1ab OS=Berne virus OX=11156 
GN=rep PE=1 SV=1
Length=6857

 Score =  176 bits (447),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 90/184 (49%), Gaps = 24/184 (13%)

Query  26    DLQNYGDSAT-LPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAV  84
             DL+NYG + T +P+ +  N AKYTQ+C ++    + V  N  V H GA    G +PG  V
Sbjct  6614  DLKNYGQNPTFMPQPV--NFAKYTQICTFIQD-HVKVARNALVWHLGAAGVDGCSPGDIV  6670

Query  85    LRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKEND  144
             L  +     L+   D+ D+      + + D  +     + +LI+SD+Y+  + NV++  D
Sbjct  6671  LSSFF-KECLVYSWDIKDY------STLLDKHSYDCNFRPNLIVSDIYN-VSSNVSEVLD  6722

Query  145   SKEGFFTYICGFIQQKLALGGSVAIKITEHSW-NADLYKLMGHFAWWTAFVTNVNASSSE  203
                            +LALGG++  K TE S  +  L +   +F+    F   VN SSSE
Sbjct  6723  D-----------CVHRLALGGTIVFKTTESSRPDIQLSQFTKYFSAVQFFTAGVNTSSSE  6771

Query  204   AFLI  207
              F++
Sbjct  6772  VFVV  6775


> sp|Q008X6|R1AB_WBV24 Replicase polyprotein 1ab OS=White bream 
virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 
GN=rep PE=1 SV=1
Length=6872

 Score =  174 bits (442),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 84/189 (44%), Gaps = 26/189 (14%)

Query  27    LQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLR  86
             + NY       +   +N+ KY Q+C  L  + L +P    + H G   +K  +PG  VLR
Sbjct  6636  IPNYNAPPK-NQTCNINIQKYDQMCD-LFAIDLKIPVKGHIHHLGNAGNK-YSPGDVVLR  6692

Query  87    QWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWD--LIISDMYDPKTKNVTKEND  144
             Q+     L    DL + VSD           +H  ++W    I+SD+Y P T        
Sbjct  6693  QYFDQAHL-TSYDLREVVSD--------IPVLHPNDEWKAHFILSDVYAPDT--------  6735

Query  145   SKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEA  204
                 F +    ++Q  L LGGS+  K+TE S    + +++ +F  W A    VN SSSE 
Sbjct  6736  ---DFTSLALEYMQNHLRLGGSIMWKMTETSI-LQVNEIVKYFGSWKAVTFAVNYSSSET  6791

Query  205   FLIGCNYLG  213
             FL    Y G
Sbjct  6792  FLFCAGYTG  6800


> sp|P0C6V8|R1AB_BRV1 Replicase polyprotein 1ab OS=Breda virus 
1 OX=360393 GN=rep PE=2 SV=1
Length=6733

 Score =  171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 24/184 (13%)

Query  26    DLQNYGD-SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAV  84
             DL+NYG     +P+ +  N AKYTQ+C ++    + V  N  + H GA    G +PG  V
Sbjct  6490  DLKNYGQDPQFMPQPV--NFAKYTQICTFIQE-HVKVARNSLIWHVGAAGIDGCSPGDIV  6546

Query  85    LRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKEND  144
             L  +     L+   D+ D+      TL+ +        + +LI+SD+Y+  + NV++  +
Sbjct  6547  LSSFF-KECLVYSWDVKDY-----DTLL-EKHNYDCNFRPNLIVSDVYN-VSSNVSEVLE  6598

Query  145   SKEGFFTYICGFIQQKLALGGSVAIKITEHSW-NADLYKLMGHFAWWTAFVTNVNASSSE  203
                            +LALGG++  K TE S  +  L K+  +FA    F   VN SSSE
Sbjct  6599  D-----------CVHRLALGGTIIFKTTESSRPDIQLSKVTKYFAAVHFFTAGVNTSSSE  6647

Query  204   AFLI  207
              F++
Sbjct  6648  VFVV  6651


> sp|Q5GS59|RLME_WOLTR Ribosomal RNA large subunit methyltransferase 
E OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) OX=292805 
GN=rlmE PE=3 SV=1
Length=216

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 58/152 (38%), Gaps = 14/152 (9%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIG-DCATVHT------ANKWD  125
            D G +PG  + V  Q    G  +V  D+    + +    I  D   + T        K+D
Sbjct  65   DLGASPGGWSQVASQ---KGVKVVAIDIKPVNTISGVKYIQYDINELETLRERFKDQKFD  121

Query  126  LIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY-KLM  184
            +I+SDM        + ++            F +  L  GG   +KI +   + D Y +L 
Sbjct  122  VILSDMAPESCGLKSLDHIRIMLLCEAALNFAKHFLNYGGKFVVKIFQGESDKDFYNELK  181

Query  185  GHFAWWTAFVTNVNAS-SSEAFLIGCNYLGKP  215
              F     F    + S S+E +L+G  ++   
Sbjct  182  KMFKIVKYFKPKSSRSESTEMYLVGLGFISNS  213


> sp|Q73IS9|RLME_WOLPM Ribosomal RNA large subunit methyltransferase 
E OS=Wolbachia pipientis wMel OX=163164 GN=rlmE PE=3 SV=1
Length=192

 Score = 44.2 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 56/152 (37%), Gaps = 15/152 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLN--------DFVSDADSTLIGDCATVHTANKW  124
            D G +PG  + V  Q    G  +V  D+         +F+                  K+
Sbjct  40   DLGASPGGWSQVASQ---KGANVVALDIKPMNAINGVEFIQCDIINEFEILREKFKDQKF  96

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL-YKL  183
            D+I+SDM        + ++            F +  L+ GG+  +KI +   + D   +L
Sbjct  97   DVILSDMAPESCGLKSLDHIRIMLLCEAALNFAKHFLSHGGTFVVKIFQGESDKDFCNEL  156

Query  184  MGHFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
               F     F    + S S+E +L+   ++G 
Sbjct  157  KKMFKTVKYFKPKSSRSESTEMYLVSLGFIGS  188


> sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransferase 
E OS=Treponema denticola (strain ATCC 35405 / CIP 103919 
/ DSM 14222) OX=243275 GN=rlmE PE=3 SV=1
Length=199

 Score = 43.1 bits (100),  Expect = 0.001, Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 60/164 (37%), Gaps = 20/164 (12%)

Query  64   NMRVIHFGAGSDKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLI---------  112
            N +V+  GA      APG  T  + ++L     +   DL    S      +         
Sbjct  42   NDKVLDLGA------APGSWTVYVLRFLNKEGRVTAVDLKPLDSSVYDERLNFFQGDMFD  95

Query  113  -GDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKI  171
             G   +V     +D +I D     T N T +     G       + Q++L  GGS  +KI
Sbjct  96   KGIIKSVKELGPYDAVICDAAPATTGNKTVDTARSSGLVELALYYAQEQLKQGGSFVVKI  155

Query  172  TE-HSWNADLYKLMGHFAWWTAFVTNVNASSS-EAFLIGCNYLG  213
             +       L  L   F    AF      SSS E +LIG ++ G
Sbjct  156  FQGGDQQIHLNNLRKCFKTARAFKPEACRSSSFETYLIGLDFKG  199


> sp|Q5PAN0|RLME_ANAMM Ribosomal RNA large subunit methyltransferase 
E OS=Anaplasma marginale (strain St. Maries) OX=234826 
GN=rlmE PE=3 SV=1
Length=201

 Score = 40.8 bits (94),  Expect = 0.006, Method: Composition-based stats.
 Identities = 21/96 (22%), Positives = 40/96 (42%), Gaps = 2/96 (2%)

Query  121  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
              K+D+++SDM      +   ++ +             + L  GGS   KI +  +  + 
Sbjct  92   DRKFDVVLSDMAPKSCGHRQVDHANIINLCEMALDLAVEFLRSGGSFVTKILQGEYEQEF  151

Query  181  YKLMG-HFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
             + +  +FA  T F    + S SSE +L+G  +   
Sbjct  152  RRSLQYYFASVTYFKPKSSRSESSEIYLVGTKFKNP  187


> sp|B9KIP4|RLME_ANAMF Ribosomal RNA large subunit methyltransferase 
E OS=Anaplasma marginale (strain Florida) OX=320483 GN=rlmE 
PE=3 SV=1
Length=201

 Score = 40.8 bits (94),  Expect = 0.006, Method: Composition-based stats.
 Identities = 21/96 (22%), Positives = 40/96 (42%), Gaps = 2/96 (2%)

Query  121  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL  180
              K+D+++SDM      +   ++ +             + L  GGS   KI +  +  + 
Sbjct  92   DRKFDVVLSDMAPKSCGHRQVDHANIINLCEMALDLAVEFLRSGGSFVTKILQGEYEQEF  151

Query  181  YKLMG-HFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
             + +  +FA  T F    + S SSE +L+G  +   
Sbjct  152  RRSLQYYFASVTYFKPKSSRSESSEIYLVGTKFKNP  187


> sp|C3MGQ4|RLME_SINFN Ribosomal RNA large subunit methyltransferase 
E OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) 
OX=394 GN=rlmE PE=3 SV=1
Length=245

 Score = 38.8 bits (89),  Expect = 0.036, Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 35/95 (37%), Gaps = 2/95 (2%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD-LYK  182
             DL++SDM  P T +   ++            F    LA GG    K  +     D L  
Sbjct  138  PDLVLSDMAAPTTGHRQTDHLRTMHLCEVAAHFAVDVLAKGGHFLAKTFQGGTERDLLNM  197

Query  183  LMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPR  216
            L  +F+        +    S E FL+   + G+ +
Sbjct  198  LKQNFSQVIHVKPASSRTESVEMFLLAKGFKGRRK  232


> sp|Q0BT08|RLME_GRABC Ribosomal RNA large subunit methyltransferase 
E OS=Granulibacter bethesdensis (strain ATCC BAA-1260 
/ CGDNIH1) OX=391165 GN=rlmE PE=3 SV=1
Length=230

 Score = 38.1 bits (87),  Expect = 0.054, Method: Composition-based stats.
 Identities = 37/162 (23%), Positives = 56/162 (35%), Gaps = 17/162 (10%)

Query  61   VPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCA---  116
            +    RVI  GA      APG            ++V  DL        +TLI GD     
Sbjct  68   ISKGSRVIDLGA------APGGWTQVAMKRGAAVVVGVDLLPVDPVPGATLIQGDFNDDD  121

Query  117  -----TVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKI  171
                 +     K DL++SDM    T +   ++            F    LA GG+   K+
Sbjct  122  MPARLSSLMGGKADLVMSDMAPNTTGHAATDHMRIIALTELALHFAFDALAPGGAFVAKV  181

Query  172  TEHSWNADLYKLM-GHFAWW-TAFVTNVNASSSEAFLIGCNY  211
             +      L + M   FA    A   +    SSE +++   +
Sbjct  182  FQGGSEKQLLEPMKQRFASVRHAKPASSRKESSELYVVAKGF  223


> sp|Q3KI92|RLME_PSEPF Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 
GN=rlmE PE=3 SV=1
Length=209

 Score = 38.1 bits (87),  Expect = 0.055, Method: Composition-based stats.
 Identities = 34/156 (22%), Positives = 60/156 (38%), Gaps = 16/156 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADST----------LIGDCATVHTAN  122
            D G APG  + V  + +     L+ SD+ +  S  D T          ++         +
Sbjct  54   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIPDVTFIQGDFTEDAVLAQILEAVGNS  113

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK-LALGGSVAIKITE-HSWNADL  180
            + DL+ISDM  P      + +  K  F   +   + ++ L  GG+  IKI +   ++  L
Sbjct  114  QVDLVISDM-APNMSGTPEVDMPKAMFLCELALDLAERILKPGGNFVIKIFQGEGFDTYL  172

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLGKP  215
                  F         +   SS E +++   Y G+ 
Sbjct  173  KDARKKFDKIQMIKPDSSRGSSREQYMLAWGYRGRS  208


> sp|Q30YX3|RLME_DESAG Ribosomal RNA large subunit methyltransferase 
E OS=Desulfovibrio alaskensis (strain G20) OX=207559 GN=rlmE 
PE=3 SV=1
Length=207

 Score = 37.7 bits (86),  Expect = 0.062, Method: Composition-based stats.
 Identities = 35/167 (21%), Positives = 57/167 (34%), Gaps = 23/167 (14%)

Query  65   MRVIHFGA-------GSDKGVAPGTAVL-------RQWLPTGTLLVDSDLNDFVSDADST  110
            MRV+  GA       G+ + + P   VL           P     +  D+ +  ++ +  
Sbjct  39   MRVLDLGAAPGSWSLGAAEKIGPSGRVLAADIQTTETVFPPNVTFMQEDVFERSAEFEQA  98

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            L            +D++ISDM    T +   +                  L  GGS  +K
Sbjct  99   LSETGP-------FDVVISDMAPKTTGHKFTDQARSSNLCFEALAVASLHLVEGGSFVVK  151

Query  171  I-TEHSWNADLYKLMGHFAWWTAFVTNVNASSS-EAFLIGCNYLGKP  215
            I       A + ++   F    +F    + S S E F IG  + G P
Sbjct  152  IFMGPDVEAYVKQMRTLFTAVKSFKPKSSRSESKETFYIGLGFKGLP  198


> sp|Q5NQH8|RLME_ZYMMO Ribosomal RNA large subunit methyltransferase 
E OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 
/ ZM4 / CP4) OX=264203 GN=rlmE PE=3 SV=1
Length=221

 Score = 37.7 bits (86),  Expect = 0.066, Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 57/153 (37%), Gaps = 14/153 (9%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK---------  123
            D G+APG  + V R+  P   + V  DL +       T+  +  T   A K         
Sbjct  66   DLGIAPGGWSQVARKKAPQAKI-VGIDLLEAAPIEGVTIFQNDFTDPEAQKKLIEALGGA  124

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL++SDM      +   ++            F  + L  GGS   K+     + DL  L
Sbjct  125  ADLVLSDMAANTIGHAQTDHLRTMALVEEAAVFASETLREGGSFVAKVLAGGADKDLVAL  184

Query  184  MGH-FAWW-TAFVTNVNASSSEAFLIGCNYLGK  214
            +   F     A        SSE ++I  N+ G+
Sbjct  185  LKRLFGQVKHAKPPASRRESSEWYVIAQNFRGE  217


> sp|Q8QZ73|POLN_MAYAB Polyprotein P1234 OS=Mayaro virus (strain 
Brazil) OX=374990 PE=1 SV=3
Length=2437

 Score = 38.1 bits (87),  Expect = 0.11, Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 46/119 (39%), Gaps = 3/119 (3%)

Query  96    VDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICG  155
             V       V+ AD T   D      A ++DL+  +M+ P   +  ++          + G
Sbjct  1186  VTWIAPPTVTGADLTYDLDLGLPPNAGRYDLVFVNMHTPYRLHHYQQCVDHAMKLQMLGG  1245

Query  156   FIQQKLALGGSVAIKI---TEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNY  211
                  L  GGS+ +      + +  A +  L   F+ + A       S++E FL+  N+
Sbjct  1246  DALYLLKPGGSLLLSTYAYADRTSEAVVTALARRFSSFRAVTVRCVTSNTEVFLLFTNF  1304


> sp|Q2GB53|RLME_NOVAD Ribosomal RNA large subunit methyltransferase 
E OS=Novosphingobium aromaticivorans (strain ATCC 700278 
/ DSM 12444 / CIP 105152 / NBRC 16084 / F199) OX=279238 GN=rlmE 
PE=3 SV=1
Length=222

 Score = 36.9 bits (84),  Expect = 0.13, Method: Composition-based stats.
 Identities = 35/155 (23%), Positives = 58/155 (37%), Gaps = 16/155 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIG---------DCATVHTANK  123
            D G+APG  + V+R+  P   + V  DL         T+           +         
Sbjct  69   DLGIAPGGWSQVVRKKAPAAKI-VGIDLLPTEPIEGVTIFEMDFMADEAPEALQSALDGP  127

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL++SDM      +   ++    G       F  Q LA GG+   K+     + +L  +
Sbjct  128  PDLVLSDMAANTVGHKQTDHLRTMGLVETAVDFAVQTLAPGGAFVAKVFAGGTDTELLAI  187

Query  184  MGHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKP  215
            +    + T       AS   SSE ++I   + G+P
Sbjct  188  LKK-NFTTVKHAKPPASRKDSSEWYVIAQGFKGRP  221


> sp|Q7VQM8|RLME_BLOFL Ribosomal RNA large subunit methyltransferase 
E OS=Blochmannia floridanus OX=203907 GN=rlmE PE=3 SV=1
Length=206

 Score = 36.9 bits (84),  Expect = 0.14, Method: Composition-based stats.
 Identities = 38/153 (25%), Positives = 66/153 (43%), Gaps = 18/153 (12%)

Query  75   DKGVAPG---TAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCATVHTANKWDL----  126
            D G  PG   + V++Q    GT+ V  D+      A    + GDC+ ++  N+ DL    
Sbjct  49   DLGSTPGGWSSYVIKQISNLGTI-VSCDILPMKKIAGVKFLQGDCSNINFLNEIDLKIKH  107

Query  127  -----IISDMYDPKTKNVTKENDSKEGFFTYI-CGFIQQKLALGGSVAIKITE-HSWNAD  179
                 ++SDM  P T  ++  +  K  +   I      + LA GGS  +KI +   ++  
Sbjct  108  KRAQVVLSDM-SPNTTGISTVDVCKSIYLGKIALNMCCRFLAPGGSFLVKIFQGDGFDQY  166

Query  180  LYKLMGHFAWWTAFVTNVNAS-SSEAFLIGCNY  211
            LY L   F        + + S S E +++  ++
Sbjct  167  LYNLKCLFHKVKVRKPSSSRSHSREVYIVSKDF  199


> sp|A1VC40|RLME_DESVV Ribosomal RNA large subunit methyltransferase 
E OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) 
OX=391774 GN=rlmE PE=3 SV=1
Length=204

 Score = 36.5 bits (83),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 4/100 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK-LALGGSVAIKITEHSWNADLYK  182
            +D++ISDM  P+T      + ++          +  + L  GGS  +KI       +L +
Sbjct  105  FDVVISDM-APRTTGTRFTDQARSLELCLEALAVADRCLIKGGSFVVKIFMGPDVQELVQ  163

Query  183  LM-GHFAWWTAFV-TNVNASSSEAFLIGCNYLGKPREQID  220
             M   F+   +F   +  A S E F +   Y G      D
Sbjct  164  AMRQRFSAVKSFKPKSSRAESKETFYVCLGYRGVETSDTD  203


> sp|Q729T9|RLME_DESVH Ribosomal RNA large subunit methyltransferase 
E OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 
29579 / DSM 644 / NCIMB 8303) OX=882 GN=rlmE PE=3 SV=1
Length=204

 Score = 36.5 bits (83),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 4/100 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK-LALGGSVAIKITEHSWNADLYK  182
            +D++ISDM  P+T      + ++          +  + L  GGS  +KI       +L +
Sbjct  105  FDVVISDM-APRTTGTRFTDQARSLELCLEALAVADRCLIKGGSFVVKIFMGPDVQELVQ  163

Query  183  LM-GHFAWWTAFV-TNVNASSSEAFLIGCNYLGKPREQID  220
             M   F+   +F   +  A S E F +   Y G      D
Sbjct  164  AMRQRFSAVKSFKPKSSRAESKETFYVCLGYRGVETSDTD  203


> sp|B8GG79|RLME_METPE Ribosomal RNA large subunit methyltransferase 
E OS=Methanosphaerula palustris (strain ATCC BAA-1556 
/ DSM 19958 / E1-9c) OX=521011 GN=rlmE PE=3 SV=1
Length=203

 Score = 36.1 bits (82),  Expect = 0.19, Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 66/164 (40%), Gaps = 21/164 (13%)

Query  75   DKGVAPGTAVLRQWLPTGTLLVDS-----DLNDFVS-DADSTLIGDCATVHTANKW----  124
            D G APG+     WL     L        DLN   S D   T++GD  T     +     
Sbjct  45   DLGAAPGS-----WLQVERTLTKGKVLGVDLNPIPSIDGVMTVVGDLTTSEVQQQVKDLV  99

Query  125  ---DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS-WNADL  180
               ++++ D     + +   +     G       F  + +  GG++A+K  +   ++  L
Sbjct  100  GVVNVVLCDASPKLSGHKCYDQARAIGLGEDALMFAARTMKQGGNMAMKSFQGEMFHELL  159

Query  181  YKLMGHFAWWTAF-VTNVNASSSEAFLIGCNYLGKPREQIDGYV  223
             ++  HF     F   +    S+E +++  N++G   + ++G++
Sbjct  160  EEVKKHFYVVKTFHTKSTRRGSTEIYIVAKNFIGSSGD-VEGHI  202


> sp|Q1ML15|RLME_RHIL3 Ribosomal RNA large subunit methyltransferase 
E OS=Rhizobium leguminosarum bv. viciae (strain 3841) 
OX=216596 GN=rlmE PE=3 SV=1
Length=239

 Score = 36.5 bits (83),  Expect = 0.19, Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 36/98 (37%), Gaps = 4/98 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL+ISDM  P T +   ++            F  + L  GG    K  +     +L  +
Sbjct  138  PDLVISDMAAPTTGHHRTDHLRTMHLCEVAAHFAVEVLGEGGHFLTKTFQGGTERELLAM  197

Query  184  MGHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPREQ  218
            +    +        N+S   S E FL+   + G+  E 
Sbjct  198  LKQ-NFRQVVHVKPNSSRAESVEMFLLAKGFKGRKAEG  234


> sp|Q2KC36|RLME_RHIEC Ribosomal RNA large subunit methyltransferase 
E OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 
GN=rlmE PE=3 SV=1
Length=239

 Score = 36.1 bits (82),  Expect = 0.25, Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 36/98 (37%), Gaps = 4/98 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL+ISDM  P T +   ++            F  + L  GG    K  +     DL  +
Sbjct  138  PDLVISDMAAPTTGHHRTDHLRTMHLCEVAAHFAIEVLGEGGHFLTKTFQGGTERDLLAM  197

Query  184  MGHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPREQ  218
            +    +        N+S   S E FL+   + G+  E 
Sbjct  198  LKQ-NFRQVVHVKPNSSRAESVEMFLLAKGFKGRKAEG  234


> sp|B3PQL4|RLME_RHIE6 Ribosomal RNA large subunit methyltransferase 
E OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=rlmE 
PE=3 SV=1
Length=239

 Score = 36.1 bits (82),  Expect = 0.25, Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 36/98 (37%), Gaps = 4/98 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL+ISDM  P T +   ++            F  + L  GG    K  +     DL  +
Sbjct  138  PDLVISDMAAPTTGHHRTDHLRTMHLCEVAAHFAIEVLGEGGHFLTKTFQGGTERDLLAM  197

Query  184  MGHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPREQ  218
            +    +        N+S   S E FL+   + G+  E 
Sbjct  198  LKQ-NFRQVVHVKPNSSRAESVEMFLLAKGFKGRKAEG  234


> sp|A7HSA5|RLME_PARL1 Ribosomal RNA large subunit methyltransferase 
E OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 
/ NCIMB 13966) OX=402881 GN=rlmE PE=3 SV=1
Length=254

 Score = 36.1 bits (82),  Expect = 0.25, Method: Composition-based stats.
 Identities = 24/101 (24%), Positives = 40/101 (40%), Gaps = 8/101 (8%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKI----TEHSWNADL  180
            D+++SDM  P T +   ++            F  + LA GG+   K+    TE   N  L
Sbjct  154  DVVLSDMAAPTTGHKQTDHMRIMSLCEIAAHFATEVLAPGGTFLAKVLRGGTE---NELL  210

Query  181  YKLMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPREQID  220
              L  HF            A S+E +++   + G+    +D
Sbjct  211  VLLKQHFKTVRHVKPKASRADSAEMYVLAQGFKGRSESPLD  251


> sp|B9J9U0|RLME_AGRRK Ribosomal RNA large subunit methyltransferase 
E OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) 
OX=311403 GN=rlmE PE=3 SV=1
Length=239

 Score = 36.1 bits (82),  Expect = 0.27, Method: Composition-based stats.
 Identities = 22/97 (23%), Positives = 34/97 (35%), Gaps = 2/97 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + DL++SDM  P T +   ++            F  + LA GG    K  +     D
Sbjct  134  VGGEPDLVMSDMAAPTTGHHRTDHLRTMHLCEVAAHFAIEVLAEGGHFLAKTFQGGTERD  193

Query  180  LYKLMG--HFAWWTAFVTNVNASSSEAFLIGCNYLGK  214
            L  L+                A S E FL+   + G+
Sbjct  194  LLNLLKQNFRQVVHVKPGASRAESVEMFLLAKGFKGR  230


> sp|B6END5|RLME_ALISL Ribosomal RNA large subunit methyltransferase 
E OS=Aliivibrio salmonicida (strain LFI1238) OX=316275 
GN=rlmE PE=3 SV=1
Length=209

 Score = 35.8 bits (81),  Expect = 0.28, Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 39/94 (41%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM    + N + +               +Q LA  GS  +K+ +  S++A L
Sbjct  116  DMVDVVMSDMAPNMSGNPSVDQPRSMYLVELALDMCRQVLAPNGSFTVKVFQGESFDAYL  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
             ++   F         +  A S E +++   Y G
Sbjct  176  QEVRKVFKVVKIRKPDSSRARSREVYIVATGYKG  209


> sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 
OS=Dictyostelium discoideum OX=44689 
GN=fsjA PE=3 SV=1
Length=270

 Score = 35.8 bits (81),  Expect = 0.32, Method: Composition-based stats.
 Identities = 33/152 (22%), Positives = 54/152 (36%), Gaps = 19/152 (13%)

Query  79   APGT--AVLRQWL-----PTGTLLVDSDLNDFVS-DADSTLIGDCATVHTANKW------  124
            APG+   VL + +          +V  DL +         + GD     T+ +       
Sbjct  51   APGSWSQVLSRRIYGDGKDPDVKIVAVDLQEMAPLKGVVQIKGDITKYETSKQIISHFDG  110

Query  125  ---DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLY  181
               DLIISD     T     +   +              L +GG+   K+ +    + +Y
Sbjct  111  SLADLIISDGAPDVTGLHDIDFYGQSQLILSALNITTHTLKIGGTFVAKMFKGDDMSLMY  170

Query  182  KLMGHFAWWTAFV--TNVNASSSEAFLIGCNY  211
              M  F    +FV  ++   SS E F++  NY
Sbjct  171  SQMKLFFEHVSFVKPSSSRESSLENFILCRNY  202


> sp|A1ST38|RLME_PSYIN Ribosomal RNA large subunit methyltransferase 
E OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=rlmE 
PE=3 SV=1
Length=217

 Score = 35.4 bits (80),  Expect = 0.38, Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 61/179 (34%), Gaps = 30/179 (17%)

Query  54   LNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQW----------------LPTGTLL-V  96
            +N     +   M V+  GA      APG+    QW                LP  ++  V
Sbjct  50   INKKDKLIRSGMTVVDLGA------APGS--WSQWAVDTVGLKGKVIACDILPMDSIAGV  101

Query  97   DSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGF  156
            D    DF  DA    +         +K D+++SDM    T  V  +              
Sbjct  102  DFLQGDFREDAVVNAL---LARIAGHKVDVVLSDMSPNMTGTVGIDQPKSMYLVELALEM  158

Query  157  IQQKLALGGSVAIKITEHS-WNADLYKLMGHFAWWTAFVTNVNAS-SSEAFLIGCNYLG  213
             ++ L   GS  +K+   S ++  + +    F        + + S S E +++   Y G
Sbjct  159  CKEVLVKEGSFVVKVFMGSEFDLFMSEARKCFKSVKTRKPDSSRSRSREVYVVATGYKG  217


> sp|B2SZR9|RLME_PARPJ Ribosomal RNA large subunit methyltransferase 
E OS=Paraburkholderia phytofirmans (strain DSM 17436 / 
LMG 22146 / PsJN) OX=398527 GN=rlmE PE=3 SV=1
Length=220

 Score = 35.0 bits (79),  Expect = 0.49, Method: Composition-based stats.
 Identities = 29/134 (22%), Positives = 50/134 (37%), Gaps = 8/134 (6%)

Query  81   GTAVLRQWLPTGTLLVDSDLNDFVSD-ADSTLIGDCATVHTANKWDLIISDMYDPKTKNV  139
            GT +    LP   +    D+     D  + T++G    +    + DL+ISDM    +   
Sbjct  86   GTIIALDILPMEPIA---DVTFIQGDFREDTVLGQLEELVGERQVDLVISDMAPNLSGVA  142

Query  140  TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNA  199
              +    E        F Q  L   G++ +K    S  + + +   H  +         A
Sbjct  143  VADAARIEHLCDLALEFSQNHLKQDGALLVKCFHGSGYSQIVEKFKH-QFKVVAARKPKA  201

Query  200  S---SSEAFLIGCN  210
            S   SSE F++G +
Sbjct  202  SRDKSSETFILGKH  215


> sp|B5ZR94|RLME_RHILW Ribosomal RNA large subunit methyltransferase 
E OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) 
OX=395492 GN=rlmE PE=3 SV=1
Length=239

 Score = 35.0 bits (79),  Expect = 0.50, Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 36/98 (37%), Gaps = 4/98 (4%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL+ISDM  P T +   ++            F  + L  GG    K  +     +L  +
Sbjct  138  PDLVISDMAAPTTGHHRTDHLRTMHLCEVAAQFAVEVLGEGGHFLTKTFQGGTERELLAM  197

Query  184  MGHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPREQ  218
            +    +        NAS   S E FL+   + G+  E 
Sbjct  198  LKQ-NFRQVVHVKPNASRAESVEMFLLAKGFKGRKVEG  234


> sp|Q9A7V4|RLME_CAUVC Ribosomal RNA large subunit methyltransferase 
E OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) 
OX=190650 GN=rlmE PE=3 SV=1
Length=226

 Score = 35.0 bits (79),  Expect = 0.53, Method: Composition-based stats.
 Identities = 23/97 (24%), Positives = 37/97 (38%), Gaps = 2/97 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + DL++SDM      +   ++    G       F    L  GG+   K  +    A+
Sbjct  130  LGGEPDLVMSDMAPNTVGHRETDHLRIVGLIEIAAEFAIDVLKPGGAFVAKAFQGGETAE  189

Query  180  LY-KLMGHFAWWTAFVTNVN-ASSSEAFLIGCNYLGK  214
            +  KL  HF     F    +   SSE FL+   + G+
Sbjct  190  IIGKLKRHFDKVQHFKPKASRQDSSEVFLVATGFKGR  226


> sp|A7IDJ5|RLME_XANP2 Ribosomal RNA large subunit methyltransferase 
E OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 
/ Py2) OX=78245 GN=rlmE PE=3 SV=1
Length=254

 Score = 35.0 bits (79),  Expect = 0.53, Method: Composition-based stats.
 Identities = 22/97 (23%), Positives = 38/97 (39%), Gaps = 2/97 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + DL++SDM    T +   ++    G       F +Q LA GG+   K+ +    A 
Sbjct  133  LGGQADLVMSDMAANATGHKKTDHLRIVGLVELAVEFARQVLAPGGTFLAKVIQGGMEAT  192

Query  180  -LYKLMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGK  214
             L  L   F            A S+E +++   + G+
Sbjct  193  LLADLKRDFTQVRHVKPAASRADSAELYVLATGFRGE  229


> sp|Q8UHR0|RLME_AGRFC Ribosomal RNA large subunit methyltransferase 
E OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 
GN=rlmE PE=3 SV=2
Length=246

 Score = 35.0 bits (79),  Expect = 0.57, Method: Composition-based stats.
 Identities = 21/93 (23%), Positives = 35/93 (38%), Gaps = 2/93 (2%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKL  183
             DL++SDM  P T +   ++            F  Q LA GG    K  +      L  +
Sbjct  138  PDLVLSDMAAPTTGHQKTDHIRTMHLCEVAADFAVQVLAEGGHFLAKTFQGGTEKALLDM  197

Query  184  MGH-FAWW-TAFVTNVNASSSEAFLIGCNYLGK  214
            +   F         +  + S E FL+  ++ G+
Sbjct  198  LKKNFKQVLHIKPASSRSESVEMFLLAKHFKGR  230


> sp|A1KT57|RLME_NEIMF Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria meningitidis serogroup C / serotype 2a 
(strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=rlmE PE=3 
SV=1
Length=206

 Score = 35.0 bits (79),  Expect = 0.59, Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 37/95 (39%), Gaps = 5/95 (5%)

Query  120  TANKW-DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
              N+  DL+I DM    + N   +             F  Q L  GGS  +K+ + +   
Sbjct  111  LNNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVKVFQGAGYQ  170

Query  179  DLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            +    M  F + T       AS   SSE +L+G N
Sbjct  171  EYMAAMREF-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|Q5P1G0|RLME_AROAE Ribosomal RNA large subunit methyltransferase 
E OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=rlmE 
PE=3 SV=1
Length=207

 Score = 34.6 bits (78),  Expect = 0.61, Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 35/93 (38%), Gaps = 4/93 (4%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFF-TYICGFIQQKLALGGSVAIKITE-HSWNADLYK  182
            D+++SDM  P    +   + ++  +       F    L  GG   +K+ +   +     +
Sbjct  116  DVVLSDM-APNMSGIDTTDQARSIYLGELALEFAGHHLKPGGGFVVKVFQGQGFMEYRNE  174

Query  183  LMGHFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
               HF          +   S+E +L+G  Y G 
Sbjct  175  AAKHFHALHVRKPKASRDRSAEVYLVGVGYRGS  207


> sp|C0QGP2|RLME_DESAH Ribosomal RNA large subunit methyltransferase 
E OS=Desulfobacterium autotrophicum (strain ATCC 43914 
/ DSM 3382 / HRM2) OX=177437 GN=rlmE PE=3 SV=1
Length=203

 Score = 34.6 bits (78),  Expect = 0.76, Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 53/171 (31%), Gaps = 24/171 (14%)

Query  59   LAVPYNMRVIHFGAGS-DKGVAPGTAVLRQWLPTGTLL-------VDSDLNDF---VSDA  107
            + +    +VI  GA   D G APG+     WL     L       V  DL      +   
Sbjct  36   MEIQKRFQVIKKGASVLDLGCAPGS-----WLIHAAELTGPSGRAVGIDLKPVDAALPPN  90

Query  108  DSTLIGDCATVH------TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKL  161
                 GD   +           +D +ISDM    T     +                  L
Sbjct  91   AIAHTGDIFEMESTLGEAVGQDYDAVISDMAPATTGRKDIDAARSFALCEAALRVACGLL  150

Query  162  ALGGSVAIKITEHSWNADL-YKLMGHFAWWTAFVT-NVNASSSEAFLIGCN  210
            A GG+   KI + +       ++   F     F   +   SS E ++IG  
Sbjct  151  ADGGNFVCKIFQGAEFKQFENQVKSRFTSHKIFKPDSCRKSSKEIYIIGLG  201


> sp|B0KHY6|RLME_PSEPG Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas putida (strain GB-1) OX=76869 GN=rlmE 
PE=3 SV=1
Length=208

 Score = 34.6 bits (78),  Expect = 0.77, Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 56/155 (36%), Gaps = 16/155 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT----------AN  122
            D G APG  + V  + +     L+ SD+ +  S AD T I    T              +
Sbjct  55   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDS  114

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGF-FTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
              DL+ISDM  P        +  +  F          + L  GG   IKI +   ++  L
Sbjct  115  HVDLVISDM-APNMSGTPAVDIPRAMFLCELALDLATRVLKPGGDFLIKIFQGEGFDVYL  173

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLGK  214
              +   F        ++    S E +L+G  + G 
Sbjct  174  KDVRSKFDKVQMRKPSSSRDRSREQYLLGRGFKGA  208


> sp|Q07LH9|RLME_RHOP5 Ribosomal RNA large subunit methyltransferase 
E OS=Rhodopseudomonas palustris (strain BisA53) OX=316055 
GN=rlmE PE=3 SV=1
Length=235

 Score = 34.2 bits (77),  Expect = 0.89, Method: Composition-based stats.
 Identities = 20/97 (21%), Positives = 36/97 (37%), Gaps = 2/97 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + D+++SDM    T +   +     G       F    L  GG+   K+ +   +A 
Sbjct  129  IGGRVDVVMSDMAANTTGHRKTDQLRIVGLVEDAAAFACDVLKPGGTFVAKVFQSGADAT  188

Query  180  L-YKLMGHFAWWTAFVTNVN-ASSSEAFLIGCNYLGK  214
            L  +L   FA         +   SSE +++   + G 
Sbjct  189  LMTQLKRDFASVKHLKPQASRKDSSERYVLALGFRGP  225


> sp|B9JSD2|RLME_AGRVS Ribosomal RNA large subunit methyltransferase 
E OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) OX=311402 
GN=rlmE PE=3 SV=1
Length=261

 Score = 34.6 bits (78),  Expect = 0.91, Method: Composition-based stats.
 Identities = 22/93 (24%), Positives = 34/93 (37%), Gaps = 2/93 (2%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD-LYK  182
             D++ISDM  P T +   ++            F  + LA GG    K  +     D L  
Sbjct  138  PDVVISDMAAPTTGHQKTDHIRTMHLCEVAAYFAVEVLAEGGHFLAKTFQGGTEKDLLNM  197

Query  183  LMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGK  214
            L  +F         +    S E FL+   + G+
Sbjct  198  LKQNFKQVIHIKPASSRQESVEMFLLAKGFKGR  230


> sp|Q88DV0|RLME_PSEPK Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 
/ NCIMB 11950 / KT2440) OX=160488 GN=rlmE PE=3 SV=1
Length=207

 Score = 34.2 bits (77),  Expect = 0.95, Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 56/154 (36%), Gaps = 16/154 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT----------AN  122
            D G APG  + V  + +     L+ SD+ +  S AD T I    T              +
Sbjct  55   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDS  114

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGF-FTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
              DL+ISDM  P        +  +  F          + L  GG   IKI +   ++  L
Sbjct  115  HVDLVISDM-APNMSGTPAVDIPRAMFLCELALDLATRVLKPGGDFLIKIFQGEGFDVYL  173

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLG  213
              +   F        ++    S E +L+G  + G
Sbjct  174  KDVRSKFDKVQMRKPSSSRDRSREQYLLGRGFKG  207


> sp|A5W995|RLME_PSEP1 Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 
/ BCRC 17059 / F1) OX=351746 GN=rlmE PE=3 SV=1
Length=207

 Score = 34.2 bits (77),  Expect = 0.95, Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 56/154 (36%), Gaps = 16/154 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHT----------AN  122
            D G APG  + V  + +     L+ SD+ +  S AD T I    T              +
Sbjct  55   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIADVTFIQGDFTHDEVLQRILEAVGDS  114

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGF-FTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
              DL+ISDM  P        +  +  F          + L  GG   IKI +   ++  L
Sbjct  115  HVDLVISDM-APNMSGTPAVDIPRAMFLCELALDLATRVLKPGGDFLIKIFQGEGFDVYL  173

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLG  213
              +   F        ++    S E +L+G  + G
Sbjct  174  KDVRSKFDKVQMRKPSSSRDRSREQYLLGRGFKG  207


> sp|Q89N72|RLME_BRADU Ribosomal RNA large subunit methyltransferase 
E OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / 
IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=rlmE PE=3 SV=1
Length=228

 Score = 34.2 bits (77),  Expect = 0.97, Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 35/95 (37%), Gaps = 2/95 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD-LYKL  183
            D+++SDM    T +   +     G       F    L  GG+   K  +   +AD L +L
Sbjct  134  DVVMSDMAANTTGHRKTDQLRIVGLIETAAAFACDVLKPGGTFLAKTFQSGADADLLAQL  193

Query  184  MGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPRE  217
               FA             SSE +++   + G  + 
Sbjct  194  KRDFATVRHVKPAASRQDSSERYVLATGFRGGAKA  228


> sp|Q8FVY1|RLME_BRUSU Ribosomal RNA large subunit methyltransferase 
E OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=rlmE 
PE=3 SV=2
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|A9WYY2|RLME_BRUSI Ribosomal RNA large subunit methyltransferase 
E OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 
GN=rlmE PE=3 SV=1
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|A5VUZ8|RLME_BRUO2 Ribosomal RNA large subunit methyltransferase 
E OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 
10512) OX=444178 GN=rlmE PE=3 SV=2
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|Q8YCD5|RLME_BRUME Ribosomal RNA large subunit methyltransferase 
E OS=Brucella melitensis biotype 1 (strain 16M / ATCC 
23456 / NCTC 10094) OX=224914 GN=rlmE PE=3 SV=1
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|C0RLJ5|RLME_BRUMB Ribosomal RNA large subunit methyltransferase 
E OS=Brucella melitensis biotype 2 (strain ATCC 23457) 
OX=546272 GN=rlmE PE=3 SV=1
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|A9MBW8|RLME_BRUC2 Ribosomal RNA large subunit methyltransferase 
E OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 
GN=rlmE PE=3 SV=1
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|Q578H4|RLME_BRUAB Ribosomal RNA large subunit methyltransferase 
E OS=Brucella abortus biovar 1 (strain 9-941) OX=262698 
GN=rlmE PE=3 SV=2
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|Q2YKU4|RLME_BRUA2 Ribosomal RNA large subunit methyltransferase 
E OS=Brucella abortus (strain 2308) OX=359391 GN=rlmE 
PE=3 SV=2
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|B2SAY0|RLME_BRUA1 Ribosomal RNA large subunit methyltransferase 
E OS=Brucella abortus (strain S19) OX=430066 GN=rlmE PE=3 
SV=1
Length=240

 Score = 34.2 bits (77),  Expect = 0.99, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|Q1QKB6|RLME_NITHX Ribosomal RNA large subunit methyltransferase 
E OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 
13809 / X14) OX=323097 GN=rlmE PE=3 SV=1
Length=228

 Score = 34.2 bits (77),  Expect = 1.1, Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 36/95 (38%), Gaps = 2/95 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD-LYKL  183
            D+++SDM    T +   +     G       F    L  GG+   K+ +   +AD L +L
Sbjct  134  DIVLSDMAANTTGHRKTDQLRIIGLVESAAAFAADVLRPGGTFIAKVFQSGADADLLVQL  193

Query  184  MGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPRE  217
               F         +    SSE +++   + G P  
Sbjct  194  KRDFRTVRHVKPASSRQDSSERYVMATGFRGTPAV  228


> sp|Q212R3|RLME_RHOPB Ribosomal RNA large subunit methyltransferase 
E OS=Rhodopseudomonas palustris (strain BisB18) OX=316056 
GN=rlmE PE=3 SV=1
Length=238

 Score = 34.2 bits (77),  Expect = 1.1, Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 36/98 (37%), Gaps = 2/98 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               K D+++SDM    T +   +     G       F    L  GG+   K+ +   +A 
Sbjct  129  IGGKVDVVLSDMAANTTGHRKTDQLRIVGLVEDAAAFACDVLKPGGTFVAKVFQSGADAT  188

Query  180  L-YKLMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKP  215
            L  +L   F         +    SSE +++   + G P
Sbjct  189  LVTQLKRDFVTVKHVKPASSRKDSSERYVLAMGFRGVP  226


> sp|A5EHP2|RLME_BRASB Ribosomal RNA large subunit methyltransferase 
E OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) 
OX=288000 GN=rlmE PE=3 SV=1
Length=231

 Score = 33.8 bits (76),  Expect = 1.3, Method: Composition-based stats.
 Identities = 20/102 (20%), Positives = 38/102 (37%), Gaps = 2/102 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + D+++SDM    T +   +     G       F  + L  GGS   K  +   +A+
Sbjct  129  LGGRADVVMSDMAANTTGHRKTDQLRIVGLVELAAHFAGEVLKPGGSFLAKTFQSGADAE  188

Query  180  -LYKLMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPREQI  219
             L +L   +A             SSE +++   + G    ++
Sbjct  189  LLAQLKRDYATVRHVKPAASRQDSSERYVLAMGFRGGEPAEL  230


> sp|Q2RXU5|RLME_RHORT Ribosomal RNA large subunit methyltransferase 
E OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 
/ DSM 467 / LMG 4362 / NCIB 8255 / S1) OX=269796 GN=rlmE 
PE=3 SV=1
Length=263

 Score = 33.8 bits (76),  Expect = 1.4, Method: Composition-based stats.
 Identities = 36/172 (21%), Positives = 57/172 (33%), Gaps = 19/172 (11%)

Query  65   MRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK-  123
            MRV+  GA             R   P G  +V  D+ ++   A +T    C T    +  
Sbjct  92   MRVVDLGAAPGGWTQIAVERTRSLHPNGGKVVGMDILEWEGVAGAT----CLTHDFMDDA  147

Query  124  ------------WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKI  171
                         DL++SDM  P T +   ++    G       F ++ LA GG+   K+
Sbjct  148  APLMLKGAMDGAVDLVLSDMAAPTTGHRQTDHLRVMGLAEAAWYFAEEVLAPGGAFVCKV  207

Query  172  TEHSWNADLYKLMGHFAWW--TAFVTNVNASSSEAFLIGCNYLGKPREQIDG  221
             +      L   M         A        S E ++I   + G    +  G
Sbjct  208  FQGGTEGALLTRMKKMCEVIRHAKPPASRQGSPEVYVIAQGFRGLSGGEDTG  259


> sp|Q2W0P2|RLME_MAGSA Ribosomal RNA large subunit methyltransferase 
E OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 
700264) OX=342108 GN=rlmE PE=3 SV=1
Length=244

 Score = 33.8 bits (76),  Expect = 1.4, Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 37/94 (39%), Gaps = 4/94 (4%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            D+++SDM  P T + + ++    G       F  + L  GG+   K+ +      L   +
Sbjct  151  DVVLSDMAAPTTGHPSTDHLRIIGLVEVALHFALEVLTPGGTFVAKVFQGGTEKTLLDQL  210

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKP  215
                + T       AS   S+E +++   + G  
Sbjct  211  KK-NFTTVRHAKPPASRQGSAETYVVATGFRGSS  243


> sp|Q0C187|RLME_HYPNA Ribosomal RNA large subunit methyltransferase 
E OS=Hyphomonas neptunium (strain ATCC 15444) OX=228405 
GN=rlmE PE=3 SV=1
Length=234

 Score = 33.8 bits (76),  Expect = 1.5, Method: Composition-based stats.
 Identities = 32/148 (22%), Positives = 49/148 (33%), Gaps = 11/148 (7%)

Query  75   DKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCATVH--------TANKWD  125
            D G APG  +          +V  DL        +T+I GD              +   D
Sbjct  85   DLGCAPGGWIQVSLQQGAAEVVGIDLLPLDPIEGATIIEGDVNNPDDVARMMAGLSGTPD  144

Query  126  LIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD-LYKLM  184
            LI+SDM    T +   ++            F  + L  GG+   K+ +     D L  L 
Sbjct  145  LILSDMAANTTGHKQTDHLRTVALVEMAVAFAIEHLDDGGAFCAKVFQGGATKDVLNLLK  204

Query  185  GHFAWW-TAFVTNVNASSSEAFLIGCNY  211
             HF            A S E +++   +
Sbjct  205  QHFRTVKHIKPAASRAGSPEIYVVAKGF  232


> sp|A8H748|RLME_SHEPA Ribosomal RNA large subunit methyltransferase 
E OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) 
OX=398579 GN=rlmE PE=3 SV=1
Length=209

 Score = 33.4 bits (75),  Expect = 1.5, Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 56/148 (38%), Gaps = 22/148 (15%)

Query  73   GSDKGVAPGTAVLRQWLPTGTLL-VDSDLNDF----VSDADSTLIGDCATVHTANKWDLI  127
              DK    G  +    LP   ++ VD    DF    V DA  T +GD        K D++
Sbjct  73   AGDK----GKVIACDILPMDPIVGVDFLQGDFREEKVLDALLTRVGDA-------KVDVV  121

Query  128  ISDMYDPKTKNVTKENDSKEGFFT-YICGFIQQKLALGGSVAIKITEHSWNADLYKLMGH  186
            +SDM  P        +  +  +          Q LA  GS A+K+ +     +  K +  
Sbjct  122  LSDM-APNMSGTGGVDQPRAMYLVELALDMCHQVLAPNGSFAVKVFQGEGFDEYMKAVKE  180

Query  187  FAWWTAFVTNVNAS---SSEAFLIGCNY  211
             A+ T      ++S   S E +L+   Y
Sbjct  181  -AFKTVKTRKPDSSRPRSREVYLVATGY  207


> sp|B1J262|RLME_PSEPW Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas putida (strain W619) OX=390235 GN=rlmE 
PE=3 SV=1
Length=208

 Score = 33.4 bits (75),  Expect = 1.5, Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 57/155 (37%), Gaps = 16/155 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCATVHT---------AN  122
            D G APG  + V  + +     L+ SD+ +  S  D T I GD                +
Sbjct  55   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIPDVTFIQGDFTQDEVLQQILDAVGDS  114

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGF-FTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
              DL+ISDM  P      + +  +  F          + L  GG   IKI +   ++  L
Sbjct  115  HVDLVISDM-APNMSGTPEVDMPRAMFLCELALDLATRVLKPGGDFLIKIFQGEGFDMYL  173

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLGK  214
              +   F        ++    S E +L+G  + G 
Sbjct  174  KDVRTKFDKVQMRKPSSSRDRSREQYLLGKGFKGA  208


> sp|A6X5L4|RLME_OCHA4 Ribosomal RNA large subunit methyltransferase 
E OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 
/ JCM 21032 / NBRC 15819 / NCTC 12168) OX=439375 GN=rlmE 
PE=3 SV=1
Length=240

 Score = 33.8 bits (76),  Expect = 1.5, Method: Composition-based stats.
 Identities = 22/96 (23%), Positives = 35/96 (36%), Gaps = 2/96 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
              +K DL+ISDM  P T +   ++            F    L  GG    K  +     +
Sbjct  145  LGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAISVLKPGGHFLTKTFQGGTENE  204

Query  180  LYKLM-GHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            L  L+   F          + A S E +L+  ++ G
Sbjct  205  LLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG  240


> sp|A4YSS3|RLME_BRASO Ribosomal RNA large subunit methyltransferase 
E OS=Bradyrhizobium sp. (strain ORS 278) OX=114615 GN=rlmE 
PE=3 SV=1
Length=231

 Score = 33.4 bits (75),  Expect = 1.6, Method: Composition-based stats.
 Identities = 20/102 (20%), Positives = 38/102 (37%), Gaps = 2/102 (2%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD  179
               + D+++SDM    T +   +     G       F  + L  GGS   K  +   +A+
Sbjct  129  IGGRADVVMSDMAANTTGHRKTDQLRIVGLVELAAHFAGEVLKPGGSFLAKTFQSGADAE  188

Query  180  -LYKLMGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKPREQI  219
             L +L   +A             SSE +++   + G  +  +
Sbjct  189  LLAQLKRDYATVRHVKPAASRQDSSERYVLAMGFRGGEQADL  230


> sp|Q138J5|RLME_RHOPS Ribosomal RNA large subunit methyltransferase 
E OS=Rhodopseudomonas palustris (strain BisB5) OX=316057 
GN=rlmE PE=3 SV=1
Length=235

 Score = 33.4 bits (75),  Expect = 1.7, Method: Composition-based stats.
 Identities = 21/93 (23%), Positives = 36/93 (39%), Gaps = 2/93 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL-YKL  183
            D+++SDM    T +   +     G       F  + L  GG+   K+ +   +A L  +L
Sbjct  134  DVVMSDMAANTTGHRKTDQLRIVGLVESAAQFASEVLKPGGTFVAKVFQSGADATLMTQL  193

Query  184  MGHFAWW-TAFVTNVNASSSEAFLIGCNYLGKP  215
               FA             SSE +++   + G P
Sbjct  194  KRDFATVKHVKPAASRKDSSERYVLAMGFRGVP  226


> sp|Q86AH1|MRM2_DICDI rRNA methyltransferase 2, mitochondrial 
OS=Dictyostelium discoideum OX=44689 GN=fsjB PE=3 SV=1
Length=640

 Score = 34.2 bits (77),  Expect = 1.7, Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 41/98 (42%), Gaps = 2/98 (2%)

Query  119  HTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNA  178
             +A   D+++SDM    +     ++            F  + L  GG+   K++      
Sbjct  543  KSACYVDVVVSDMAPSYSGLQQVDHSRLIDLQRLALFFAFKTLKKGGTFVCKVSRGGEEK  602

Query  179  DLYKLMG-HFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
              +KL+  +F    +     + S S+E + IG NY+GK
Sbjct  603  KFFKLLESNFISVKSMKPGASRSESTEIYYIGKNYIGK  640


> sp|B0T8J6|RLME_CAUSK Ribosomal RNA large subunit methyltransferase 
E OS=Caulobacter sp. (strain K31) OX=366602 GN=rlmE PE=3 
SV=2
Length=226

 Score = 33.4 bits (75),  Expect = 2.0, Method: Composition-based stats.
 Identities = 23/93 (25%), Positives = 37/93 (40%), Gaps = 2/93 (2%)

Query  124  WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADL-YK  182
             DL++SDM      +   ++    G       F  + L  GG+   K  +    A +  +
Sbjct  134  PDLVMSDMAPNTVGHRETDHLRIVGLIEIGADFAIEVLKPGGAFVAKAFQGGETAAVIAQ  193

Query  183  LMGHFAWWTAFVTNVNAS-SSEAFLIGCNYLGK  214
            L  HF     F    + S SSE FL+   + G+
Sbjct  194  LKKHFTKVVHFKPKASRSDSSEVFLVATGFKGR  226


> sp|Q5RAS1|SPB1_PONAB pre-rRNA 2'-O-ribose RNA methyltransferase 
FTSJ3 OS=Pongo abelii OX=9601 GN=FTSJ3 PE=2 SV=1
Length=841

 Score = 33.8 bits (76),  Expect = 2.2, Method: Composition-based stats.
 Identities = 34/156 (22%), Positives = 54/156 (35%), Gaps = 20/156 (13%)

Query  79   APGT--AVLRQWLPTGTLLVDSDLNDFVS-DADSTLIGDCATVHTAN---------KWDL  126
            APG    V  +++P  +L+V  DL          TL  D  T              K D+
Sbjct  54   APGGWLQVAAKFMPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDV  113

Query  127  IISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD--LYKLM  184
            +++D       +   +  S+              LA GGS   K+   S +    L+   
Sbjct  114  VLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFR-SRDYQPLLWIFQ  172

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPRE  217
              F    A  T   AS   S+E F++   +L   + 
Sbjct  173  QLFRRVQA--TKPQASRHESAEIFVVCQGFLAPDKV  206


> sp|C6C068|RLME_DESAD Ribosomal RNA large subunit methyltransferase 
E OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 
2638 / NCIB 8403 / VKM B-1763) OX=526222 GN=rlmE PE=3 SV=1
Length=199

 Score = 33.1 bits (74),  Expect = 2.2, Method: Composition-based stats.
 Identities = 32/154 (21%), Positives = 52/154 (34%), Gaps = 15/154 (10%)

Query  75   DKGVAPGTAVL---------RQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANK--  123
            D G APG+  L          + L       D+   D  +   + +  D   +  A    
Sbjct  43   DLGAAPGSWTLFAAKKVGDTGRVLAVDIQSTDTAFPDNATFLQADVFEDSPELLAAMDKQ  102

Query  124  --WDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEH-SWNADL  180
              +DLIISDM    T     +  +           +  +L  GG   +KI +       +
Sbjct  103  LPYDLIISDMAPKTTGVKFADQANSLELCERARDIVPSRLKQGGHFIVKIFDGPDVKEYI  162

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLG  213
              L   F+    F   +    S E F++G  + G
Sbjct  163  DSLRKMFSKVKRFKPKSCREESKEFFIVGLGFRG  196


> sp|A1TQF0|RLME_ACIAC Ribosomal RNA large subunit methyltransferase 
E OS=Acidovorax citrulli (strain AAC00-1) OX=397945 GN=rlmE 
PE=3 SV=1
Length=218

 Score = 33.1 bits (74),  Expect = 2.4, Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 34/88 (39%), Gaps = 2/88 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            D+++SDM    +   + +             F QQ L   G++ +K+   S  A L +L 
Sbjct  128  DVVVSDMAPNLSGVESVDAVRIAHLIELAVDFAQQHLKPDGALVVKLFHGSGYAQLVQLF  187

Query  185  G-HFAWWT-AFVTNVNASSSEAFLIGCN  210
              HF              SSE FL+G  
Sbjct  188  KEHFRTVKPMKPKASRDKSSETFLVGMG  215


> sp|C5CKU4|RLME_VARPS Ribosomal RNA large subunit methyltransferase 
E OS=Variovorax paradoxus (strain S110) OX=543728 GN=rlmE 
PE=3 SV=1
Length=222

 Score = 32.7 bits (73),  Expect = 2.9, Method: Composition-based stats.
 Identities = 25/105 (24%), Positives = 40/105 (38%), Gaps = 2/105 (2%)

Query  108  DSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSV  167
            ++ L+     V    K DL++SDM    +   + +             F Q  L   G++
Sbjct  111  EAELLEQVLGVLAGRKADLVVSDMAPNLSGIHSADAARVAHLIELAIDFAQHHLKPEGAL  170

Query  168  AIKITEHSWNADLYKLMG-HFAWWTAFVTNVNA-SSSEAFLIGCN  210
              K+   S   +L KL   +F     F    +   SSE FL+G  
Sbjct  171  VAKLFHGSGYDELVKLFKANFRTVKPFKPKASRDKSSETFLVGMG  215


> sp|Q13W47|RLME_PARXL Ribosomal RNA large subunit methyltransferase 
E OS=Paraburkholderia xenovorans (strain LB400) OX=266265 
GN=rlmE PE=3 SV=1
Length=220

 Score = 32.7 bits (73),  Expect = 2.9, Method: Composition-based stats.
 Identities = 28/134 (21%), Positives = 48/134 (36%), Gaps = 8/134 (6%)

Query  81   GTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNV  139
            GT +    LP   +  V     DF  D+    + +   +    + DL+ISDM    +   
Sbjct  86   GTIIALDLLPMEPIADVHFIQGDFREDSVIAQLEE---LVGERQVDLVISDMAPNLSGVA  142

Query  140  TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNA  199
              +    E        F Q  L   G++ +K    S  + + +      +         A
Sbjct  143  VADAARIEHLCDLALEFSQNHLKPDGALLVKCFHGSGYSQIVEKFKR-QFRVVAARKPKA  201

Query  200  S---SSEAFLIGCN  210
            S   SSE F++G +
Sbjct  202  SRDKSSETFILGKH  215


> sp|Q1IF51|RLME_PSEE4 Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas entomophila (strain L48) OX=384676 GN=rlmE 
PE=3 SV=1
Length=208

 Score = 32.7 bits (73),  Expect = 2.9, Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 56/155 (36%), Gaps = 16/155 (10%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCATVHT---------AN  122
            D G APG  + V  + +     L+ SD+ +  S  D T I GD                +
Sbjct  55   DLGAAPGGWSQVTSRLIGGQGRLIASDILEMDSIPDVTFIQGDFTQDEVLQQILQAVGDS  114

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGF-FTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
              DL+ISDM  P        +  +  F          + L  GG   IKI +   ++  L
Sbjct  115  HVDLVISDM-APNMSGTPAVDMPRAMFLCELALDLATRVLKPGGDFLIKIFQGEGFDMYL  173

Query  181  YKLMGHFAWWTAFV-TNVNASSSEAFLIGCNYLGK  214
              +   F        ++    S E +L+G  + G 
Sbjct  174  KDVRSKFDKVQMRKPSSSRDRSREQYLLGKGFKGA  208


> sp|Q8IY81|SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase 
FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
Length=847

 Score = 33.4 bits (75),  Expect = 3.1, Method: Composition-based stats.
 Identities = 34/156 (22%), Positives = 54/156 (35%), Gaps = 20/156 (13%)

Query  79   APGT--AVLRQWLPTGTLLVDSDLNDFVS-DADSTLIGDCATVHTAN---------KWDL  126
            APG    V  +++P  +L+V  DL          TL  D  T              K D+
Sbjct  54   APGGWLQVAAKFMPVSSLIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDV  113

Query  127  IISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNAD--LYKLM  184
            +++D       +   +  S+              LA GGS   K+   S +    L+   
Sbjct  114  VLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFR-SRDYQPLLWIFQ  172

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIGCNYLGKPRE  217
              F    A  T   AS   S+E F++   +L   + 
Sbjct  173  QLFRRVQA--TKPQASRHESAEIFVVCQGFLAPDKV  206


> sp|Q21H48|RLME_SACD2 Ribosomal RNA large subunit methyltransferase 
E OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 
/ DSM 17024) OX=203122 GN=rlmE PE=3 SV=1
Length=206

 Score = 32.7 bits (73),  Expect = 3.3, Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 58/155 (37%), Gaps = 18/155 (12%)

Query  75   DKGVAPG--TAVLRQWLPTGTLLVDSDLNDFVSDADSTLI-GDCATVHTAN---------  122
            D G APG  + V  Q +  G  +V SD+    S A    + GD                 
Sbjct  54   DLGAAPGGWSQVAAQIVGDGGRVVASDILPMDSLAGVDFVQGDFTEEAVLEQLLELLGEA  113

Query  123  KWDLIISDMYDPKTKNVTKENDSKEGFFT-YICGFIQQKLALGGSVAIKITEHSWNADLY  181
            K DL+ISDM  P    +   +  K  +         +  L +GGS A K+ +     +L 
Sbjct  114  KADLVISDM-APNMSGIADVDQPKSMYLVELALDMAKTTLKIGGSFACKVFQGEGFDELV  172

Query  182  KLMGHFAWWTAFVTNVNAS---SSEAFLIGCNYLG  213
             L     +    V   +AS   S E +++   Y G
Sbjct  173  -LACRECFQKVLVRKPSASRPRSREVYIVAKGYKG  206


> sp|Q2SUW0|RLME_BURTA Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia thailandensis (strain ATCC 700388 / 
DSM 13276 / CIP 106301 / E264) OX=271848 GN=rlmE PE=3 SV=1
Length=220

 Score = 32.7 bits (73),  Expect = 3.3, Method: Composition-based stats.
 Identities = 30/132 (23%), Positives = 49/132 (37%), Gaps = 8/132 (6%)

Query  81   GTAVLRQWLPTGTLLVDSDLNDFVSD-ADSTLIGDCATVHTANKWDLIISDMYDPKTKNV  139
            GT +    LP   +    D++    D  + T++     V      DL+ISDM    +   
Sbjct  86   GTIIALDMLPMEPIA---DVHFIQGDFREETVLHQLEEVLAGRSVDLVISDMAPNLSGVA  142

Query  140  TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNA  199
              +    E        F Q  L   G++ +K    S  + + +   H  + T       A
Sbjct  143  VADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKFKH-QFKTVAPRKPKA  201

Query  200  S---SSEAFLIG  208
            S   SSE F++G
Sbjct  202  SRDKSSETFILG  213


> sp|A4VNP3|RLME_PSEU5 Ribosomal RNA large subunit methyltransferase 
E OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=rlmE 
PE=3 SV=2
Length=206

 Score = 32.7 bits (73),  Expect = 3.3, Method: Composition-based stats.
 Identities = 38/173 (22%), Positives = 63/173 (36%), Gaps = 18/173 (10%)

Query  54   LNTLTLAVPYNMRVIHFG---------AGSDKGVAPGTAVLRQWLPTGTL-LVDSDLNDF  103
            LN     +   M V+  G         AG   G   G  +    LP G L  VD    DF
Sbjct  39   LNEKDKLIRPGMLVMDLGSAPGGWSQVAGGIVG-EKGRVLATDILPMGGLDNVDFVQGDF  97

Query  104  VSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLAL  163
              DA    I D   +    + DLI+SD+    +     +  +           ++Q L  
Sbjct  98   TEDAVFQQILD---MLDGRQPDLIVSDIAPNISGVAAADQAASMYLVELTLDMVRQVLKP  154

Query  164  GGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCNYLG  213
            GG+  +K+ +   + +  K +   ++    +    AS   S E +L+   + G
Sbjct  155  GGNYVVKVFQGEGSDEFLKDV-RSSFEKVVIRKPEASRPRSREVYLVAKGFKG  206


> sp|B2JFN9|RLME_PARP8 Ribosomal RNA large subunit methyltransferase 
E OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 
108236 / LMG 21445 / STM815) OX=391038 GN=rlmE PE=3 SV=1
Length=220

 Score = 32.7 bits (73),  Expect = 3.4, Method: Composition-based stats.
 Identities = 30/132 (23%), Positives = 46/132 (35%), Gaps = 8/132 (6%)

Query  81   GTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNV  139
            GT +    LP   +  V     DF  D     + +          DL+ISDM    +   
Sbjct  86   GTIIALDLLPMEPIADVHFIQGDFREDNVLAQLEEVVG---DRDVDLVISDMAPNLSGVA  142

Query  140  TKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNA  199
              +    E        F Q  L   G++ +K    S  + + +   H  + T       A
Sbjct  143  VADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKFKH-QFKTVAARKPKA  201

Query  200  S---SSEAFLIG  208
            S   SSE F++G
Sbjct  202  SRDKSSETFILG  213


> sp|A0KNF1|RLME_AERHH Ribosomal RNA large subunit methyltransferase 
E OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 
7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) OX=380703 
GN=rlmE PE=3 SV=1
Length=209

 Score = 32.3 bits (72),  Expect = 3.4, Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 37/93 (40%), Gaps = 4/93 (4%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFT-YICGFIQQKLALGGSVAIKITE-HSWNAD  179
            +K D+++SDM  P      + + ++  +          Q L   GS  +K+ +   ++  
Sbjct  116  DKVDVVMSDM-APNMSGTQQVDQARSMYLVELALDMCNQVLRANGSFVVKVFQGEGFDIY  174

Query  180  LYKLMGHFAWWTAFVT-NVNASSSEAFLIGCNY  211
            L ++   F         +  A S E +++   +
Sbjct  175  LNEIRKLFTAVKIRKPDSSRARSREVYIVATGF  207


> sp|A8II77|RLME_AZOC5 Ribosomal RNA large subunit methyltransferase 
E OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 
5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 
GN=rlmE PE=3 SV=1
Length=240

 Score = 32.7 bits (73),  Expect = 3.5, Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 6/99 (6%)

Query  120  TANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKI----TEHS  175
               K DL++SDM    T +   ++            F +Q LA GG+   K+    TE +
Sbjct  133  LDGKADLVMSDMAANTTGHKKTDHLKIIALVELAADFARQVLAPGGAFIAKVFQGGTEGT  192

Query  176  WNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGK  214
              ADL +   +            A S+E +L+   + G 
Sbjct  193  LLADLKR--DYAQVRHLKPAASRADSAELYLVATGFRGS  229


> sp|Q7MI01|RLME_VIBVY Ribosomal RNA large subunit methyltransferase 
E OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=rlmE 
PE=3 SV=1
Length=209

 Score = 32.3 bits (72),  Expect = 3.6, Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM      N + +               +Q LA  GS  +K+ +   ++  +
Sbjct  116  DMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGSFVVKVFQGEGFDEYV  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
             ++   F         +  A S E F++   Y G
Sbjct  176  KEVRNMFKVVKIRKPDSSRARSREVFVVATGYKG  209


> sp|Q8DBW7|RLME_VIBVU Ribosomal RNA large subunit methyltransferase 
E OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=rlmE 
PE=3 SV=1
Length=209

 Score = 32.3 bits (72),  Expect = 3.6, Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM      N + +               +Q LA  GS  +K+ +   ++  +
Sbjct  116  DMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGSFVVKVFQGEGFDEYV  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
             ++   F         +  A S E F++   Y G
Sbjct  176  KEVRNMFKVVKIRKPDSSRARSREVFVVATGYKG  209


> sp|Q1QSY2|RLME_CHRSD Ribosomal RNA large subunit methyltransferase 
E OS=Chromohalobacter salexigens (strain ATCC BAA-138 
/ DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=rlmE 
PE=3 SV=1
Length=210

 Score = 32.3 bits (72),  Expect = 3.8, Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 53/163 (33%), Gaps = 20/163 (12%)

Query  65   MRVIHFGAG------------SDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLI  112
            M VI  GA              DKG    + +L      G   V  D  +        ++
Sbjct  54   MTVIDLGAAPGGWSQIAADKVGDKGCVIASDILEMDALAGVTFVQGDFTE------MEVL  107

Query  113  GDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKIT  172
                      + DL++SDM    +     +               +Q L+ GG    K+ 
Sbjct  108  EQILVALEGRRVDLVMSDMAPNMSGMAAIDQPQAMYLVELALDLARQTLSPGGRFLAKVF  167

Query  173  E-HSWNADLYKLMGHF-AWWTAFVTNVNASSSEAFLIGCNYLG  213
            +   ++A L +L G F    T       A S E +L+   + G
Sbjct  168  QGEGFDAYLKELRGSFRKVVTRKPEASRARSREVYLLAEGFHG  210


> sp|Q7NRI3|RLME_CHRVO Ribosomal RNA large subunit methyltransferase 
E OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 
30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 
GN=rlmE PE=3 SV=1
Length=205

 Score = 32.3 bits (72),  Expect = 4.0, Method: Composition-based stats.
 Identities = 20/87 (23%), Positives = 31/87 (36%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +             F +  L  GG   +K+ + S +   Y   
Sbjct  116  DLVISDMAPNMSGMSAIDQARSFLLCELALEFARDHLKPGGHFLVKVFQGS-DFQPYLKA  174

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
                +         AS   SSE +L+G
Sbjct  175  MRELFDEVVTRKPKASRDRSSEIYLLG  201


> sp|A2SF90|RLME_METPP Ribosomal RNA large subunit methyltransferase 
E OS=Methylibium petroleiphilum (strain ATCC BAA-1232 
/ LMG 22953 / PM1) OX=420662 GN=rlmE PE=3 SV=1
Length=224

 Score = 32.3 bits (72),  Expect = 4.1, Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 34/88 (39%), Gaps = 2/88 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            D+++SDM    +   + ++            F +  L   G++  K+   S ++ L +L 
Sbjct  133  DVVVSDMAPNLSGIASSDSARIALLVELAVEFAETHLHPHGALVCKVFHGSGHSQLVELF  192

Query  185  -GHFAWWTAFVTNVNA-SSSEAFLIGCN  210
               F          +   SSE FL+G  
Sbjct  193  KKRFRVVKPIKPKASRDKSSETFLVGIG  220


> sp|Q32BF4|RLME_SHIDS Ribosomal RNA large subunit methyltransferase 
E OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 
GN=rlmE PE=3 SV=1
Length=209

 Score = 32.3 bits (72),  Expect = 4.1, Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 34/92 (37%), Gaps = 2/92 (2%)

Query  121  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNAD  179
             +K  +++SDM    +     +               +  LALGGS  +K+ +   ++  
Sbjct  115  DSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLALGGSFVVKVFQGEGFDEY  174

Query  180  LYKLMGHFAWWTAFVT-NVNASSSEAFLIGCN  210
            L ++   F         +  A S E +++   
Sbjct  175  LREIRSLFTKVKVRKPDSSRARSREVYIVATG  206


> sp|Q5FNQ1|RLME_GLUOX Ribosomal RNA large subunit methyltransferase 
E OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=rlmE 
PE=3 SV=1
Length=268

 Score = 32.3 bits (72),  Expect = 4.3, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 35/89 (39%), Gaps = 2/89 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL++SDM    T +   ++    G       F  Q LA GGS   K+ +     D+  LM
Sbjct  168  DLVMSDMAPNTTGHAATDHMRIMGLAEGALDFAFQVLAEGGSFIAKVFQGGSEKDMLALM  227

Query  185  GH-FAWW-TAFVTNVNASSSEAFLIGCNY  211
               F+             SSE ++I   +
Sbjct  228  KTAFSSVKHVKPPASRKESSELYVIATGF  256


> sp|Q7DDL2|RLME_NEIMB Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria meningitidis serogroup B (strain MC58) 
OX=122586 GN=rlmE PE=3 SV=1
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (37%), Gaps = 4/103 (4%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++    T+      DL+I DM    + N   +             F  Q L  GGS  +K
Sbjct  103  VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVK  162

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            + + +   +    M    + T       AS   SSE +L+G N
Sbjct  163  VFQGAGYQEYMAAMREI-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|Q9JQX5|RLME_NEIMA Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria meningitidis serogroup A / serotype 4A 
(strain Z2491) OX=122587 GN=rlmE PE=3 SV=1
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (37%), Gaps = 4/103 (4%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++    T+      DL+I DM    + N   +             F  Q L  GGS  +K
Sbjct  103  VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVK  162

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            + + +   +    M    + T       AS   SSE +L+G N
Sbjct  163  VFQGAGYQEYMAAMREI-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|A9M3N1|RLME_NEIM0 Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria meningitidis serogroup C (strain 053442) 
OX=374833 GN=rlmE PE=3 SV=1
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (37%), Gaps = 4/103 (4%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++    T+      DL+I DM    + N   +             F  Q L  GGS  +K
Sbjct  103  VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVK  162

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            + + +   +    M    + T       AS   SSE +L+G N
Sbjct  163  VFQGAGYQEYMAAMREI-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|B4RK82|RLME_NEIG2 Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 
GN=rlmE PE=3 SV=1
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (37%), Gaps = 4/103 (4%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++    T+      DL+I DM    + N   +             F  Q L  GGS  +K
Sbjct  103  VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVK  162

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            + + +   +    M    + T       AS   SSE +L+G N
Sbjct  163  VFQGAGYQEYMAAMREI-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|Q5F9L0|RLME_NEIG1 Ribosomal RNA large subunit methyltransferase 
E OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) 
OX=242231 GN=rlmE PE=3 SV=1
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 38/103 (37%), Gaps = 4/103 (4%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++    T+      DL+I DM    + N   +             F  Q L  GGS  +K
Sbjct  103  VLAQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVK  162

Query  171  ITEHSWNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCN  210
            + + +   +    M    + T       AS   SSE +L+G N
Sbjct  163  VFQGAGYQEYMAAMREI-FGTVQTRKPEASRNRSSEIYLLGKN  204


> sp|Q9CPY0|MRM2_MOUSE rRNA methyltransferase 2, mitochondrial 
OS=Mus musculus OX=10090 GN=Mrm2 PE=1 SV=1
Length=246

 Score = 32.3 bits (72),  Expect = 4.6, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 37/109 (34%), Gaps = 2/109 (2%)

Query  107  ADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGS  166
             D         +  + + D+I+SDM    T     ++D        +       L  GG+
Sbjct  131  TDPRTFQKILELLPSRRADVILSDMAPNATGIRDLDHDKLISLCLTLVDMAVDILHPGGT  190

Query  167  VAIKITEHSWNADLYK-LMGHFAWWTAFVTNVN-ASSSEAFLIGCNYLG  213
            +  K    S +  L K L   F          +   SSE +L+   Y G
Sbjct  191  LLCKTWAGSKSHLLQKRLTQEFQSTRVVKPEASRKESSEVYLLATQYRG  239


> sp|Q1GHF1|RLME_RUEST Ribosomal RNA large subunit methyltransferase 
E OS=Ruegeria sp. (strain TM1040) OX=292414 GN=rlmE PE=3 
SV=1
Length=238

 Score = 32.3 bits (72),  Expect = 4.8, Method: Composition-based stats.
 Identities = 20/102 (20%), Positives = 36/102 (35%), Gaps = 2/102 (2%)

Query  114  DCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE  173
            D        + D+++SDM    + +   ++            F    L  GG+   K+  
Sbjct  137  DQVKEWLGGQADVVMSDMAASSSGHKQTDHLRIMSLCETAAYFAFDVLEEGGTFVAKVLA  196

Query  174  HSWNADLYKLM-GHFAWW-TAFVTNVNASSSEAFLIGCNYLG  213
                 +L KL+   F         +  A SSE F++   + G
Sbjct  197  GGAEGELQKLLKQKFKSVANVKPPSSRADSSEKFVVATGFRG  238


> sp|Q3J2Q5|RLME_RHOS4 Ribosomal RNA large subunit methyltransferase 
E OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 
/ NCIB 8253 / DSM 158) OX=272943 GN=rlmE PE=3 SV=1
Length=244

 Score = 32.3 bits (72),  Expect = 4.9, Method: Composition-based stats.
 Identities = 28/128 (22%), Positives = 47/128 (37%), Gaps = 18/128 (14%)

Query  102  DFVSD-ADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK  160
            DF+SD AD  + G         + D+++SDM    + +   ++            F    
Sbjct  125  DFLSDDADEKVKG-----WLGGRADVVMSDMAAAASGHKGTDHLRIIALCEAAAAFAFDV  179

Query  161  LALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVN-------ASSSEAFLIGCNYLG  213
            L  GG+   K+       +L  L+        F    N       A SSE F++   + G
Sbjct  180  LEEGGTFVAKVLAGGAENELQALLKK-----NFTKVANVKPPASRADSSEKFVVAMGFRG  234

Query  214  KPREQIDG  221
            +  E  +G
Sbjct  235  RASEPEEG  242


> sp|A3PJK8|RLME_RHOS1 Ribosomal RNA large subunit methyltransferase 
E OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 
2.4.9) OX=349101 GN=rlmE PE=3 SV=1
Length=244

 Score = 32.3 bits (72),  Expect = 4.9, Method: Composition-based stats.
 Identities = 28/128 (22%), Positives = 47/128 (37%), Gaps = 18/128 (14%)

Query  102  DFVSD-ADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK  160
            DF+SD AD  + G         + D+++SDM    + +   ++            F    
Sbjct  125  DFLSDDADEKVKG-----WLGGRADVVMSDMAAAASGHKGTDHLRIIALCEAAAAFAFDV  179

Query  161  LALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVN-------ASSSEAFLIGCNYLG  213
            L  GG+   K+       +L  L+        F    N       A SSE F++   + G
Sbjct  180  LEEGGTFVAKVLAGGAENELQALLKK-----NFTKVANVKPPASRADSSEKFVVAMGFRG  234

Query  214  KPREQIDG  221
            +  E  +G
Sbjct  235  RASEPEEG  242


> sp|B7VJI4|RLME_VIBTL Ribosomal RNA large subunit methyltransferase 
E OS=Vibrio tasmaniensis (strain LGP32) OX=575788 GN=rlmE 
PE=3 SV=1
Length=209

 Score = 31.9 bits (71),  Expect = 5.1, Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 35/94 (37%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            N  D+++SDM      N + +               +Q LA  GS  +K+ +   ++  +
Sbjct  116  NMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLATNGSFVVKVFQGEGFDQYV  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
              +   F         +  A S E F++   Y G
Sbjct  176  KDVREMFKTVKVRKPDSSRARSREVFIVATGYKG  209


> sp|B5FA72|RLME_ALIFM Ribosomal RNA large subunit methyltransferase 
E OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=rlmE 
PE=3 SV=1
Length=209

 Score = 31.9 bits (71),  Expect = 5.5, Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 37/94 (39%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM    + N+  +               +Q LA  GS  +K+ +   ++  L
Sbjct  116  DMVDVVMSDMAPNMSGNLAVDQPRAMYLVELALDMCRQVLAPNGSFTVKVFQGEGFDQYL  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
             ++   F         +  A S E +++   Y G
Sbjct  176  QEVRNMFKVVKIRKPDSSRARSREVYIVATGYKG  209


> sp|Q5E7M3|RLME_ALIF1 Ribosomal RNA large subunit methyltransferase 
E OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) 
OX=312309 GN=rlmE PE=3 SV=1
Length=209

 Score = 31.9 bits (71),  Expect = 5.5, Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 37/94 (39%), Gaps = 2/94 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM    + N+  +               +Q LA  GS  +K+ +   ++  L
Sbjct  116  DMVDVVMSDMAPNMSGNLAVDQPRAMYLVELALDMCRQVLAPNGSFTVKVFQGEGFDQYL  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
             ++   F         +  A S E +++   Y G
Sbjct  176  QEVRNMFKVVKIRKPDSSRARSREVYIVATGYKG  209


> sp|Q5WT13|RLME_LEGPL Ribosomal RNA large subunit methyltransferase 
E OS=Legionella pneumophila (strain Lens) OX=297245 GN=rlmE 
PE=3 SV=1
Length=206

 Score = 31.5 bits (70),  Expect = 7.1, Method: Composition-based stats.
 Identities = 36/159 (23%), Positives = 60/159 (38%), Gaps = 16/159 (10%)

Query  65   MRVIHFGA--------GSDKGVAPGTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDC  115
            M V+  GA         S+K    G  V    LP   L  V+  L DF  D    ++ + 
Sbjct  50   MTVVDLGASPGGWTQYASEKMKGSGRLVALDILPMDALPNVEFILGDFRED---NVLQEL  106

Query  116  ATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS  175
              +      DL++SDM    + +   +             F ++ L  GG++ +KI   S
Sbjct  107  INLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMYLVELAFDFAEKMLKPGGNMLVKIFHGS  166

Query  176  WNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCNY  211
               +L K     ++    +   +AS   S E +L+   Y
Sbjct  167  GFDELVK-QARASFEKVVIRKPSASRSRSKETYLLAKGY  204


> sp|A5IHX0|RLME_LEGPC Ribosomal RNA large subunit methyltransferase 
E OS=Legionella pneumophila (strain Corby) OX=400673 GN=rlmE 
PE=3 SV=2
Length=206

 Score = 31.5 bits (70),  Expect = 7.1, Method: Composition-based stats.
 Identities = 36/159 (23%), Positives = 60/159 (38%), Gaps = 16/159 (10%)

Query  65   MRVIHFGAG--------SDKGVAPGTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDC  115
            M V+  GA         S+K    G  V    LP   L  V+  L DF  D    ++ + 
Sbjct  50   MTVVDLGAAPGGWTQYASEKMKGSGRLVALDILPMDALPNVEFILGDFRED---NVLQEL  106

Query  116  ATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS  175
              +      DL++SDM    + +   +             F ++ L  GG++ +KI   S
Sbjct  107  INLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMYLVELAFDFAEKMLKPGGNMLVKIFHGS  166

Query  176  WNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCNY  211
               +L K     ++    +   +AS   S E +L+   Y
Sbjct  167  GFDELVK-QARASFEKVVIRKPSASRSRSKETYLLAKGY  204


> sp|P83543|TAMP_STRMB Transglutaminase-activating metalloprotease 
OS=Streptomyces mobaraensis OX=35621 PE=1 SV=2
Length=760

 Score = 32.3 bits (72),  Expect = 7.1, Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 32/83 (39%), Gaps = 8/83 (10%)

Query  59   LAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATV  118
            L V  N+   + G  +   VAP     R        L +SD  D  +D   T   D ++V
Sbjct  681  LKVDVNITHTYRGDLTIDLVAPNGKTWR--------LKNSDAWDSAADVSETYTVDASSV  732

Query  119  HTANKWDLIISDMYDPKTKNVTK  141
                 W L + D+Y   +  + K
Sbjct  733  SANGTWKLKVQDVYSGDSGTIDK  755


> sp|Q6LUJ9|RLME_PHOPR Ribosomal RNA large subunit methyltransferase 
E OS=Photobacterium profundum (strain SS9) OX=298386 GN=rlmE 
PE=3 SV=1
Length=209

 Score = 31.5 bits (70),  Expect = 7.3, Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query  122  NKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADL  180
            +  D+++SDM    + N+  +               +Q LA  GS A+K+ +   ++  L
Sbjct  116  DMVDVVLSDMAPNMSGNLASDQPRAMYLVELALEMCKQVLAPNGSFAVKVFQGEGFDQYL  175

Query  181  YKLMGHFAWWTAFVT-NVNASSSEAFLIGCNY  211
             ++   F         +    S E +++   Y
Sbjct  176  AEIRNMFKVVKIRKPDSSRDRSREVYIVATGY  207


> sp|Q5ZRT1|RLME_LEGPH Ribosomal RNA large subunit methyltransferase 
E OS=Legionella pneumophila subsp. pneumophila (strain 
Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=rlmE PE=3 
SV=2
Length=206

 Score = 31.5 bits (70),  Expect = 7.5, Method: Composition-based stats.
 Identities = 36/159 (23%), Positives = 60/159 (38%), Gaps = 16/159 (10%)

Query  65   MRVIHFGAG--------SDKGVAPGTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDC  115
            M V+  GA         S+K    G  V    LP   L  V+  L DF  D    ++ + 
Sbjct  50   MTVVDLGAAPGGWTQYASEKMRGSGRLVALDILPMDALPNVEFILGDFRED---NVLQEL  106

Query  116  ATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS  175
              +      DL++SDM    + +   +             F ++ L  GG++ +KI   S
Sbjct  107  INLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMYLVELAFDFAEKMLKPGGNMLVKIFHGS  166

Query  176  WNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCNY  211
               +L K     ++    +   +AS   S E +L+   Y
Sbjct  167  GFDELVK-QARASFEKVVIRKPSASRSRSKETYLLAKGY  204


> sp|Q5X1A0|RLME_LEGPA Ribosomal RNA large subunit methyltransferase 
E OS=Legionella pneumophila (strain Paris) OX=297246 GN=rlmE 
PE=3 SV=1
Length=206

 Score = 31.5 bits (70),  Expect = 7.5, Method: Composition-based stats.
 Identities = 36/159 (23%), Positives = 60/159 (38%), Gaps = 16/159 (10%)

Query  65   MRVIHFGAG--------SDKGVAPGTAVLRQWLPTGTLL-VDSDLNDFVSDADSTLIGDC  115
            M V+  GA         S+K    G  V    LP   L  V+  L DF  D    ++ + 
Sbjct  50   MTVVDLGAAPGGWTQYASEKMRGSGRLVALDILPMDALPNVEFILGDFRED---NVLQEL  106

Query  116  ATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHS  175
              +      DL++SDM    + +   +             F ++ L  GG++ +KI   S
Sbjct  107  INLIPQRTLDLLLSDMAPNMSGSSAIDIPRAMYLVELAFDFAEKMLKPGGNMLVKIFHGS  166

Query  176  WNADLYKLMGHFAWWTAFVTNVNAS---SSEAFLIGCNY  211
               +L K     ++    +   +AS   S E +L+   Y
Sbjct  167  GFDELVK-QARASFEKVVIRKPSASRSRSKETYLLAKGY  204


> sp|Q2N843|RLME_ERYLH Ribosomal RNA large subunit methyltransferase 
E OS=Erythrobacter litoralis (strain HTCC2594) OX=314225 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.2, Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 60/152 (39%), Gaps = 12/152 (8%)

Query  75   DKGVAPG--TAVLRQWLPTGTL----LVDSDLNDFVSDADSTLIGDCA----TVHTANKW  124
            D G+APG    V+R+  P   +    L++++  + V+      + D A            
Sbjct  69   DLGIAPGGWAQVVRKVRPKAGIVGIDLLETEPIEGVTILQMDFMADEAPAGLEAALDGPP  128

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL++SDM      +   ++    G       F  + L  GG+   K+     + DL KL+
Sbjct  129  DLVMSDMAANTVGHKQTDHLRTMGLVEAAAWFAIETLEEGGTFLAKVLAGGTDNDLLKLL  188

Query  185  G-HFAWW-TAFVTNVNASSSEAFLIGCNYLGK  214
              HF     A        SSE +++   + G+
Sbjct  189  KSHFKTVKHAKPPASRKGSSEWYVVAQGFKGR  220


> sp|Q63V86|RLME_BURPS Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia pseudomallei (strain K96243) OX=272560 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|A3N853|RLME_BURP6 Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia pseudomallei (strain 668) OX=320373 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|Q3JTT5|RLME_BURP1 Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia pseudomallei (strain 1710b) OX=320372 
GN=rlmE PE=3 SV=2
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|A3NTW3|RLME_BURP0 Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia pseudomallei (strain 1106a) OX=357348 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|A1V319|RLME_BURMS Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia mallei (strain SAVP1) OX=320388 GN=rlmE 
PE=3 SV=2
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|Q62L80|RLME_BURMA Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia mallei (strain ATCC 23344) OX=243160 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|A2S3Q7|RLME_BURM9 Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia mallei (strain NCTC 10229) OX=412022 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|A3MIQ3|RLME_BURM7 Ribosomal RNA large subunit methyltransferase 
E OS=Burkholderia mallei (strain NCTC 10247) OX=320389 
GN=rlmE PE=3 SV=1
Length=220

 Score = 31.5 bits (70),  Expect = 8.3, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLM  184
            DL+ISDM    +     +    E        F Q  L   G++ +K    S  + + +  
Sbjct  128  DLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNHLKPDGALLVKCFHGSGYSQIVEKF  187

Query  185  GHFAWWTAFVTNVNAS---SSEAFLIG  208
             H  + T       AS   SSE F++G
Sbjct  188  KH-QFKTVAPRKPKASRDKSSETFILG  213


> sp|Q65TZ0|RLME_MANSM Ribosomal RNA large subunit methyltransferase 
E OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 
GN=rlmE PE=3 SV=1
Length=208

 Score = 31.1 bits (69),  Expect = 8.8, Method: Composition-based stats.
 Identities = 16/95 (17%), Positives = 36/95 (38%), Gaps = 2/95 (2%)

Query  121  ANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNAD  179
             ++ D+++SDM    +   + +               +Q LA  GS  +K+ +   ++  
Sbjct  114  EDQVDVVMSDMAPNFSGMPSVDIPRAMYLVELALDMCKQVLAKKGSFVVKVFQGEGFDEY  173

Query  180  LYKLMGHFAWWTAFVTNVNAS-SSEAFLIGCNYLG  213
            L ++   F          +   S E +++   Y G
Sbjct  174  LREIRSLFTTVKVRKPEASRDRSREVYIVATGYRG  208


> sp|A4G4B0|RLME_HERAR Ribosomal RNA large subunit methyltransferase 
E OS=Herminiimonas arsenicoxydans OX=204773 GN=rlmE PE=3 
SV=1
Length=214

 Score = 31.1 bits (69),  Expect = 8.8, Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 36/103 (35%), Gaps = 8/103 (8%)

Query  111  LIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIK  170
            ++     V    K DL++SDM    +     +             F Q  +   GS+ +K
Sbjct  108  VLEQLEVVLAGRKVDLVLSDMAPNLSGIAVADAARMMDIIELAIDFAQHHMKPSGSLLVK  167

Query  171  ITEHSWNADLYKLMGHF--AWWTAFVTNVNAS---SSEAFLIG  208
                S       ++  F   + T       AS   SSE FL+G
Sbjct  168  CFNGS---GFNDIVEKFRHEFKTVTQKKPKASRDKSSEIFLLG  207


> sp|Q87LZ4|RLME_VIBPA Ribosomal RNA large subunit methyltransferase 
E OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 
2210633) OX=223926 GN=rlmE PE=3 SV=1
Length=209

 Score = 31.1 bits (69),  Expect = 9.8, Method: Composition-based stats.
 Identities = 18/91 (20%), Positives = 35/91 (38%), Gaps = 2/91 (2%)

Query  125  DLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITE-HSWNADLYKL  183
            D+++SDM      N + +               +Q LA  GS  +K+ +   ++  + ++
Sbjct  119  DVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGSFVVKVFQGEGFDQYVKEV  178

Query  184  MGHFAWWTAFVT-NVNASSSEAFLIGCNYLG  213
               F         +  A S E F++   Y G
Sbjct  179  RDMFKVVKIRKPDSSRARSREVFVVATGYKG  209



Lambda      K        H        a         alpha
   0.315    0.139    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0425    0.140     1.90     42.6     43.6 

Effective search space used: 24782243432


  Database: uniprot_sprot.fasta
    Posted date:  Aug 19, 2020  9:15 PM
  Number of letters in database: 202,799,066
  Number of sequences in database:  563,082



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40