ID   NS6_CVHSA               Reviewed;          63 AA.
AC   P59634; Q7T6R9; Q7TA25; Q7TFA7; Q80BV3;
DT   23-APR-2003, integrated into UniProtKB/Swiss-Prot.
DT   23-APR-2003, sequence version 1.
DT   22-APR-2020, entry version 71.
DE   RecName: Full=Non-structural protein 6;
DE            Short=ns6;
DE   AltName: Full=Accessory protein 6;
DE   AltName: Full=Protein X3;
GN   ORFNames=6;
OS   Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome
OS   coronavirus).
OC   Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae;
OC   Orthocoronavirinae; Betacoronavirus; Sarbecovirus.
OX   NCBI_TaxID=694009;
OH   NCBI_TaxID=9606; Homo sapiens (Human).
OH   NCBI_TaxID=9675; Paguma larvata (Masked palm civet).
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate Urbani;
RX   PubMed=12730500; DOI=10.1126/science.1085952;
RA   Rota P.A., Oberste M.S., Monroe S.S., Nix W.A., Campagnoli R.,
RA   Icenogle J.P., Penaranda S., Bankamp B., Maher K., Chen M.-H., Tong S.,
RA   Tamin A., Lowe L., Frace M., DeRisi J.L., Chen Q., Wang D., Erdman D.D.,
RA   Peret T.C.T., Burns C., Ksiazek T.G., Rollin P.E., Sanchez A., Liffick S.,
RA   Holloway B., Limor J., McCaustland K., Olsen-Rasmussen M., Fouchier R.,
RA   Guenther S., Osterhaus A.D.M.E., Drosten C., Pallansch M.A., Anderson L.J.,
RA   Bellini W.J.;
RT   "Characterization of a novel coronavirus associated with severe acute
RT   respiratory syndrome.";
RL   Science 300:1394-1399(2003).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate Tor2;
RX   PubMed=12730501; DOI=10.1126/science.1085953;
RA   Marra M.A., Jones S.J.M., Astell C.R., Holt R.A., Brooks-Wilson A.,
RA   Butterfield Y.S.N., Khattra J., Asano J.K., Barber S.A., Chan S.Y.,
RA   Cloutier A., Coughlin S.M., Freeman D., Girn N., Griffith O.L., Leach S.R.,
RA   Mayo M., McDonald H., Montgomery S.B., Pandoh P.K., Petrescu A.S.,
RA   Robertson A.G., Schein J.E., Siddiqui A., Smailus D.E., Stott J.M.,
RA   Yang G.S., Plummer F., Andonov A., Artsob H., Bastien N., Bernard K.,
RA   Booth T.F., Bowness D., Czub M., Drebot M., Fernando L., Flick R.,
RA   Garbutt M., Gray M., Grolla A., Jones S., Feldmann H., Meyers A.,
RA   Kabani A., Li Y., Normand S., Stroher U., Tipples G.A., Tyler S.,
RA   Vogrig R., Ward D., Watson B., Brunham R.C., Krajden M., Petric M.,
RA   Skowronski D.M., Upton C., Roper R.L.;
RT   "The genome sequence of the SARS-associated coronavirus.";
RL   Science 300:1399-1404(2003).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate CUHK-Su10, and Isolate CUHK-W1;
RX   PubMed=12853594; DOI=10.1056/nejm200307103490216;
RA   Tsui S.K.W., Chim S.S.C., Lo Y.M.D.;
RT   "Coronavirus genomic-sequence variations and the epidemiology of the severe
RT   acute respiratory syndrome.";
RL   N. Engl. J. Med. 349:187-188(2003).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate HKU-39849;
RX   PubMed=12876307; DOI=10.1177/15353702-0322807-13;
RA   Zeng F.Y., Chan C.W., Chan M.N., Chen J.D., Chow K.Y.C., Hon C.C.C.,
RA   Hui R.K.H., Li J., Li V.Y.Y., Wang C.Y., Wang P.Y., Guan Y., Zheng B.,
RA   Poon L.L.M., Chan K.H., Yuen K.Y., Peiris J.S.M., Leung F.C.;
RT   "The complete genome sequence of severe acute respiratory syndrome
RT   coronavirus strain HKU-39849 (HK-39).";
RL   Exp. Biol. Med. 228:866-873(2003).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate BJ01, Isolate BJ02, Isolate BJ03, Isolate BJ04, and
RC   Isolate GD01;
RA   Qin E., Zhu Q., Yu M., Fan B., Chang G., Si B., Yang B., Peng W., Jiang T.,
RA   Liu B., Deng Y., Liu H., Zhang Y., Wang C., Li Y., Gan Y., Li X., Lu F.,
RA   Tan G., Yang R., Cao W.S., Wang J., Chen W., Cong L., Deng Y., Dong W.,
RA   Han Y., Hu W., Lei M., Li C., Li G., Li G., Li H., Li S., Li S., Li W.,
RA   Li W., Lin W., Liu J., Liu Z., Lu H., Ni P., Qi Q., Sun Y., Tang L.,
RA   Tong Z., Wang J., Wang X., Wu Q., Xi Y., Xu Z., Yang L., Ye C., Ye J.,
RA   Zhang B., Zhang F., Zhang J., Zhang X., Zhou J., Yang H.;
RL   Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate TW1;
RA   Yeh S.-H., Kao C.-L., Tsai C.-Y., Liu C.-J., Chen D.-S., Chen P.-J.;
RT   "The complete genome of SARS coronavirus clone TW1.";
RL   Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
RN   [7]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate FRA;
RA   Eickmann M., Becker S., Klenk H.-D., Doerr H.W., Stadler K., Censini S.,
RA   Guidotti S., Masignani V., Scarselli M., Mora M., Donati C., Han J.,
RA   Song H.C., Abrignani S., Covacci A., Rappuoli R.;
RT   "SARS virus is a close relative of type II coronaviruses.";
RL   Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
RN   [8]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate Frankfurt 1;
RA   Thiel V., Hertzig T., Putics A., Ivanov K.A., Schelle B., Bayer S.,
RA   Scheiner B., Weinand H., Weissbrich B., Ziebuhr J.;
RL   Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
RN   [9]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate Shanghai QXC1;
RA   Yuan Z., Zhang X., Hu Y., Lan S., Wang H., Zhou Z., Wen Y.;
RT   "Analysis of SARS coronavirus genome in Shanghai isolates.";
RL   Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases.
RN   [10]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate Taiwan TC1, Isolate Taiwan TC2, and Isolate Taiwan TC3;
RA   Chang J.-G.C., Lin T.-H., Chen C.-M., Lin C.-S., Chan W.-L., Shih M.-C.;
RL   Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases.
RN   [11]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate TWH, Isolate TWJ, Isolate TWK, Isolate TWS, and Isolate TWY;
RA   Shu H.Y., Wu K.M., Tsai S.F.;
RT   "The complete genome of SARS coronavirus TWH.";
RL   Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases.
RN   [12]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate HSR 1;
RA   Canducci F., Clementi M., Poli G., Vicenzi E.;
RL   Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases.
RN   [13]
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA].
RC   STRAIN=Isolate AS;
RA   Balotta C., Corvasce S., Violin M., Galli M., Moroni M., Vigevani G.M.,
RA   Ruan Y.J., Salemi M.;
RL   Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
RN   [14]
RP   SUBCELLULAR LOCATION.
RX   PubMed=16103185; DOI=10.1128/jvi.79.17.11335-11342.2005;
RA   Pewe L., Zhou H., Netland J., Tangudu C., Olivares H., Shi L., Look D.,
RA   Gallagher T., Perlman S.;
RT   "A severe acute respiratory syndrome-associated coronavirus-specific
RT   protein enhances virulence of an attenuated murine coronavirus.";
RL   J. Virol. 79:11335-11342(2005).
RN   [15]
RP   FUNCTION, AND SUBCELLULAR LOCATION.
RC   STRAIN=Isolate CUHK-W1;
RX   PubMed=16310783; DOI=10.1016/j.febslet.2005.11.007;
RA   Geng H., Liu Y.-M., Chan W.S., Lo A.W.-I., Au D.M.-Y., Waye M.M.-Y.,
RA   Ho Y.-Y.;
RT   "The putative protein 6 of the severe acute respiratory syndrome-associated
RT   coronavirus: expression and functional characterization.";
RL   FEBS Lett. 579:6763-6768(2005).
RN   [16]
RP   FUNCTION, AND SUBCELLULAR LOCATION.
RX   PubMed=17108045; DOI=10.1128/jvi.01515-06;
RA   Tangudu C., Olivares H., Netland J., Perlman S., Gallagher T.;
RT   "Severe acute respiratory syndrome coronavirus protein 6 accelerates murine
RT   coronavirus infections.";
RL   J. Virol. 81:1220-1229(2007).
CC   -!- FUNCTION: Could be a determinant of virus virulence, since, when
CC       expressed in an otherwise attenuated JHM strain of murine coronavirus,
CC       it can dramatically increase the lethality of the latter. Seems to
CC       stimulate cellular DNA synthesis in vitro.
CC       {ECO:0000269|PubMed:16310783, ECO:0000269|PubMed:17108045}.
CC   -!- INTERACTION:
CC       P59634; Q13561: DCTN2; Xeno; NbExp=2; IntAct=EBI-25489038, EBI-715074;
CC   -!- SUBCELLULAR LOCATION: Host endoplasmic reticulum membrane. Host Golgi
CC       apparatus membrane.
CC   -!- SIMILARITY: Belongs to the coronaviruses accessory protein 6 family.
CC       {ECO:0000305}.
DR   EMBL; AY278741; AAP13448.1; -; Genomic_RNA.
DR   EMBL; AY274119; AAP41042.1; -; Genomic_RNA.
DR   EMBL; AY282752; -; NOT_ANNOTATED_CDS; Genomic_RNA.
DR   EMBL; AY278554; AAP13572.1; -; Genomic_RNA.
DR   EMBL; AY278491; -; NOT_ANNOTATED_CDS; Genomic_RNA.
DR   EMBL; AY278487; -; NOT_ANNOTATED_CDS; Genomic_RNA.
DR   EMBL; AY278488; AAP30035.1; -; Genomic_RNA.
DR   EMBL; AY278489; AAP51232.1; -; Genomic_RNA.
DR   EMBL; AY278490; -; NOT_ANNOTATED_CDS; Genomic_RNA.
DR   EMBL; AY279354; -; NOT_ANNOTATED_CDS; Genomic_RNA.
DR   EMBL; AY291451; AAP37022.1; -; Genomic_RNA.
DR   EMBL; AY310120; AAP50490.1; -; Genomic_RNA.
DR   EMBL; AY291315; AAP33702.1; -; Genomic_RNA.
DR   EMBL; AY463059; AAR86791.1; -; Genomic_RNA.
DR   EMBL; AY338174; AAQ01602.1; -; Genomic_RNA.
DR   EMBL; AY338175; AAQ01614.1; -; Genomic_RNA.
DR   EMBL; AY348314; AAP97887.1; -; Genomic_RNA.
DR   EMBL; AP006557; BAC81353.1; -; Genomic_RNA.
DR   EMBL; AP006558; BAC81367.1; -; Genomic_RNA.
DR   EMBL; AP006559; BAC81381.1; -; Genomic_RNA.
DR   EMBL; AP006560; BAC81395.1; -; Genomic_RNA.
DR   EMBL; AP006561; BAC81409.1; -; Genomic_RNA.
DR   EMBL; AY323977; AAP72979.1; -; Genomic_RNA.
DR   EMBL; AY427439; AAQ94065.1; -; Genomic_RNA.
DR   RefSeq; NP_828856.1; NC_004718.3.
DR   IntAct; P59634; 2.
DR   GeneID; 1489673; -.
DR   KEGG; vg:1489673; -.
DR   Proteomes; UP000000354; Genome.
DR   Proteomes; UP000103670; Genome.
DR   Proteomes; UP000109640; Genome.
DR   Proteomes; UP000116947; Genome.
DR   Proteomes; UP000121636; Genome.
DR   Proteomes; UP000131569; Genome.
DR   Proteomes; UP000131955; Genome.
DR   Proteomes; UP000137377; Genome.
DR   Proteomes; UP000138690; Genome.
DR   Proteomes; UP000143093; Genome.
DR   Proteomes; UP000145651; Genome.
DR   Proteomes; UP000146108; Genome.
DR   Proteomes; UP000146181; Genome.
DR   Proteomes; UP000146296; Genome.
DR   Proteomes; UP000148194; Genome.
DR   Proteomes; UP000153467; Genome.
DR   Proteomes; UP000160648; Genome.
DR   Proteomes; UP000164441; Genome.
DR   Proteomes; UP000172416; Genome.
DR   GO; GO:0044167; C:host cell endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0044178; C:host cell Golgi membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0016020; C:membrane; IEA:UniProtKB-KW.
DR   GO; GO:0009405; P:pathogenesis; IEA:UniProtKB-KW.
DR   InterPro; IPR022736; SARS_NS6.
DR   Pfam; PF12133; Sars6; 1.
PE   1: Evidence at protein level;
KW   Host endoplasmic reticulum; Host Golgi apparatus; Host membrane; Membrane;
KW   Reference proteome; Virulence.
FT   CHAIN           1..63
FT                   /note="Non-structural protein 6"
FT                   /id="PRO_0000106134"
FT   VARIANT         32..63
FT                   /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in
FT                   strain: Isolate TWJ)"
FT   VARIANT         57
FT                   /note="P -> L (in strain: Isolate GD01, Isolate BJ01,
FT                   Isolate BJ02, Isolate BJ03 and Isolate BJ04)"
SQ   SEQUENCE   63 AA;  7527 MW;  70C9150941C759BF CRC64;
     MFHLVDFQVT IAEILIIIMR TFRIAIWNLD VIISSIVRQL FKPLTKKNYS ELDDEEPMEL
     DYP
//